>gi|26554387|ref|NP_758321.1| methionyl-tRNA synthetase [Mycoplasma penetrans HF-2] >gi|26454397|dbj|BAC44725.1| methionyl-tRNA synthetase [Mycoplasma penetrans HF-2] (1087 aa)
Score = 5350, Expect = 0.0e+00, Identities = 1086/1087 (99%), Positives = 1087/1087 (100%)
  Q:     1 VDKNRKYMNFNSVIINVNTSKKNKFILNGFNLNGLFSINEKTIMDNNIELFSEANLNVYIVIEKQYSNILKKHLVNIEKVQILLKEDFFNQKNFIKSDEKTLIVDDNFYFNQEILNNLLTNEKYSNLSTLIKLNYNTHFDYIGIFDSTSINYIDFKNNSISDDIKVLSNLVELKEKQYLPIKIYDYKTLSKMDSKYECDKGFLYFTPGPVQIREWVKEVLGEYVNHHRSLSIKEIYKEAAENIKWAFNSKKGYPIAMANTGLGAIESTFVNLLEQGDEILILSNGFFGENLIDIAKRHQLNQSLLQIKQGESFDLKEVENLIKNKKAVFMVYMDTSCGILNPVKKVGELCKDYGCLFIVDAISGILNEEFNFDEYGVTAAVSTSGKGFEVSPGLAFVCVSEQGMQISANIKKRKPKFLDWQTFKVRSLYDGLTPSTYPVNIFASLNKVCEEIKDNGGLTRLIDKKFNLNLYLSESLITLGFRHIIENENSRSNWVLVMETPNIIKANELRAYLYAMKNILIECGIADSSNRIVRLAISAAHDIEDVTQLIEAIKEYIDLKITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           +DKNRKYMNFNSVIINVNTSKKNKFILNGFNLNGLFSINEKTIMDNNIELFSEANLNVYIVIEKQYSNILKKHLVNIEKVQILLKEDFFNQKNFIKSDEKTLIVDDNFYFNQEILNNLLTNEKYSNLSTLIKLNYNTHFDYIGIFDSTSINYIDFKNNSISDDIKVLSNLVELKEKQYLPIKIYDYKTLSKMDSKYECDKGFLYFTPGPVQIREWVKEVLGEYVNHHRSLSIKEIYKEAAENIKWAFNSKKGYPIAMANTGLGAIESTFVNLLEQGDEILILSNGFFGENLIDIAKRHQLNQSLLQIKQGESFDLKEVENLIKNKKAVFMVYMDTSCGILNPVKKVGELCKDYGCLFIVDAISGILNEEFNFDEYGVTAAVSTSGKGFEVSPGLAFVCVSEQGMQISANIKKRKPKFLDWQTFKVRSLYDGLTPSTYPVNIFASLNKVCEEIKDNGGLTRLIDKKFNLNLYLSESLITLGFRHIIENENSRSNWVLVMETPNIIKANELRAYLYAMKNILIECGIADSSNRIVRLAISAAHDIEDVTQLIEAIKEYIDLKITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK
  S:     1 MDKNRKYMNFNSVIINVNTSKKNKFILNGFNLNGLFSINEKTIMDNNIELFSEANLNVYIVIEKQYSNILKKHLVNIEKVQILLKEDFFNQKNFIKSDEKTLIVDDNFYFNQEILNNLLTNEKYSNLSTLIKLNYNTHFDYIGIFDSTSINYIDFKNNSISDDIKVLSNLVELKEKQYLPIKIYDYKTLSKMDSKYECDKGFLYFTPGPVQIREWVKEVLGEYVNHHRSLSIKEIYKEAAENIKWAFNSKKGYPIAMANTGLGAIESTFVNLLEQGDEILILSNGFFGENLIDIAKRHQLNQSLLQIKQGESFDLKEVENLIKNKKAVFMVYMDTSCGILNPVKKVGELCKDYGCLFIVDAISGILNEEFNFDEYGVTAAVSTSGKGFEVSPGLAFVCVSEQGMQISANIKKRKPKFLDWQTFKVRSLYDGLTPSTYPVNIFASLNKVCEEIKDNGGLTRLIDKKFNLNLYLSESLITLGFRHIIENENSRSNWVLVMETPNIIKANELRAYLYAMKNILIECGIADSSNRIVRLAISAAHDIEDVTQLIEAIKEYIDLKITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
>gi|185178808|ref|ZP_02964601.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024305|ref|ZP_02996992.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039529|ref|ZP_02998260.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] >gi|195867767|ref|ZP_03079768.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209436|gb|EDU06479.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018979|gb|EDU57019.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195660622|gb|EDX53878.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (521 aa)
Score = 1285, Expect = 5.1e-139, Identities = 257/519 (49%), Positives = 351/519 (67%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   +D  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV+DP   I+TYG DA RYYL+ +LSL  D++FSE  LI T+N  LAN+ GN+ +R++GM+ KYR+ I+PKY    L  + + E  + +  + +   I K +I K L+ + +++ E N ++E  KPW+L K   E++LD  L  ++  ++     L P+LI+GSK+A++Q N D S   +  +  +  L+  K+N  +PI+ RI  E +
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLHISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMINNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNDELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIELVQENINKYSIDKALNCIQEILVEANKYVEDNKPWELAKNQQEQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDILNYHKVNDSKPIFARIIVEKQ 521
>gi|13357755|ref|NP_078029.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761906|ref|YP_001752278.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508737|ref|ZP_02958215.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701992|ref|ZP_02971615.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|25009406|sp|Q9PQU6|SYM_UREPA Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|11356980|pir||C82922 methionyl-tRNA synthetase UU197 [imported] - Ureaplasma urealyticum >gi|6899162|gb|AAF30604.1|AE002119_9 methionyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827483|gb|ACA32745.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675666|gb|EDT87571.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700768|gb|EDU19050.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] (521 aa)
Score = 1278, Expect = 3.1e-138, Identities = 256/519 (49%), Positives = 350/519 (67%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   ++  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV+DP   I+TYG DA RYYL+ +LSL  D++FSE  LI T+N  LAN+ GN+ +R++GM+ KYR+ I+PKY    L  + + E  + +  + +   I K +I K L+ + +++ E N +IE  KPW+L K   E++LD  L  ++  ++     L P+LI+GSK+A++Q N D S   +  +  +   +  K+N  +PI+ RI  E +
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVNNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIELVQENINKYSIDKALNCIQEILVEANKYIEDNKPWELAKNQQEQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARIIVEKQ 521
>gi|171920487|ref|ZP_02931504.2| methionyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902953|gb|EDT49242.1| methionyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] (521 aa)
Score = 1277, Expect = 4.5e-138, Identities = 255/519 (49%), Positives = 350/519 (67%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   ++  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV+DP   I+TYG DA RYYL+ +LSL  D++FSE  LI T+N  LAN+ GN+ +R++GM+ KYR+ I+PKY    L  + + E  + +  + +   I K +I K L+ + +++ E N ++E  KPW+L K   E++LD  L  ++  ++     L P+LI+GSK+A++Q N D S   +  +  +   +  K+N  +PI+ RI  E +
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVNNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIELVQENINKYSIDKALNCIQEILVEANKYVEDNKPWELAKNQQEQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARIIVEKQ 521
>gi|171920815|ref|ZP_02931489.2| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188518520|ref|ZP_03003990.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188530827|ref|ZP_03005130.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568690|ref|ZP_03005454.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 2] >gi|188592500|ref|ZP_03005835.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 10] >gi|171903582|gb|EDT49871.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188997923|gb|EDU67020.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (521 aa)
Score = 1272, Expect = 1.7e-137, Identities = 254/519 (48%), Positives = 350/519 (67%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   ++  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV+DP   I+TYG DA RYYL+ +LSL  D++FSE  LI T+N  LAN+ GN+ +R++GM+ KYR+ I+PKY    L  + + E  + +  + +   I K +I K L+ + +++ E N ++E  KPW+L K   +++LD  L  ++  ++     L P+LI+GSK+A++Q N D S   +  +  +   +  K+N  +PI+ RI  E +
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLHISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVNNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIELVQENINKYSIDKALNCIQEILVEANKYVEDNKPWELAKNQQKQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARIIVEKQ 521
>gi|188524069|ref|ZP_03004160.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659982|gb|EDX53362.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (521 aa)
Score = 1270, Expect = 3.1e-137, Identities = 254/519 (48%), Positives = 349/519 (67%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   ++  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV+DP   I+TYG DA RYYL+ +LSL  D++FSE  LI T+N  LAN+ GN+ +R++GM+ KYR+ I+PKY    L  + + E  + +    +   I K +I K L+ + +++ E N ++E  KPW+L K   +++LD  L  ++  ++     L P+LI+GSK+A++Q N D S   +  +  +   +  K+N  +PI+ RI  E +
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLHISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMVNNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNEELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDTYGVDALRYYLMADLSLFRDAIFSEDNLIETYNTQLANSYGNMISRTLGMLKKYRNNIVPKYVGCVLKNDEKLENLINKNIKLVQENINKYSIDKALNCIQEILVEANKYVEDNKPWELAKNQQKQELDSLLVHLVKVIQVTTTLLSPILIEGSKKAVEQLNFDESFLTLASLASYDIFNYHKVNDSKPIFARIIVEKQ 521
>gi|50364851|ref|YP_053276.1| methionyl-tRNA synthetase [Mesoplasma florum L1] >gi|50363407|gb|AAT75392.1| methionyl-tRNA synthetase [Mesoplasma florum L1] (509 aa)
Score = 1108, Expect = 1.6e-118, Identities = 230/514 (44%), Positives = 332/514 (64%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI----IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRI 1082
           KKFY+TTPIYYPSGN HIGHA+TT +AD+L RYK   GYETFF+TG DEHGQKIEEKA E  L P + ++   + F  LWK L I+Y+ FIRTT  YH+  V++ F+ LL K FIY G ++GLYC+SCEE +     + + N  K+   +L  +   +EE+YFLK   F++++ + +     + P  R NE+ NSF+   +  DLS++R++FSWGI I E+PKHVVYVWLDAL NY++ LGY Q DDSNFQKFW  ++ EI+QL  KEI RFH IYWPI+L+ LGLR+PT  + HGWI+++  KMSKSLGNV+DPI  IN YG DA R+Y+  EL  ++D  F++ L I +FN  LANNVGNL +R   MI KY DG I        + NI ++  L     E   +    +++  I   +  ++DL N CN +IE+  PW+L KE    +L   ++ +   +  +++ L+P+L++  ++ ++Q  +   +     + ++  +  +K+   + I+ R+
  S:     3 KKFYVTTPIYYPSGNLHIGHAYTTTLADILKRYKDMQGYETFFLTGSDEHGQKIEEKATEAGLTPIDYLEDKVESFKTLWKALKIDYTKFIRTTDSYHEETVKKIFTLLLDKGFIYKGNYEGLYCISCEE-FLNADQIDENNMCKISNTKLELV---KEETYFLKTSLFQEFMENEVLASEFLIPAYRRNEMLNSFVK-PELKDLSVTRTSFSWGIPINEDPKHVVYVWLDALTNYITALGYLQNDDSNFQKFWADENTEILQLAGKEIIRFHSIYWPIILKSLGLRQPTHLLGHGWILSKDTKMSKSLGNVIDPIEMINKYGADALRFYIGYELPTEKDGNFTDDLFIESFNAHLANNVGNLISRINQMITKYFDGFIE-------NDNIVYDDNLTAKGIETINLYIQNMDQYKISDAIRNILDLGNACNKYIEETMPWNLAKEEKIDELKNVMATLQRNISIMVFLLKPILVENYEDMIEQIGLSGVELTFDKINNWDKIIFKKLGDKKIIFKRV 508
>gi|188159854|ref|ZP_02998940.1| methionyl-tRNA synthetase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (509 aa)
Score = 1101, Expect = 1.2e-117, Identities = 236/515 (45%), Positives = 343/515 (66%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL-----KQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           KKFYITTPIYYPSGN H+GHA+TT +AD+L RYKK+ GYETFF+TG DEHGQKIE KAKE NL P E ++   + F +LW  L I Y  FIRTT +YH+  VQ+ F+ LL+K +IY G ++G+YCVSCEE  T      ++ D+   C   +   Q   E++YFLK+ QF++++ + LK   L+ P  R NE+  +F+      DLS++R +F WGI I E+ +H++YVWLDAL NY++ LGY Q+DDS F+KFW + D EI+QL  KEI RFH IYWP+MLE L L++PT  + HGWI+ +  KMSKSLGNV+DP+  I  Y  DA R+Y+  +L  ++D  FS +L I +FN  LANNVGNL +R+  MI+KY +G I       LS N+ ++++L     K  D+ +   +++  I + +  V++L N CN +IE   PW+L+KEN  ++L   L+ +   +  + Y L+PVL+D  K+ ++Q  +++ + D + +  FS++   K+N  + I+ RI+
  S:     3 KKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFFLTGSDEHGQKIENKAKEANLTPLEYLNPKVQAFKDLWTKLNINYDKFIRTTDDYHEKAVQKIFTILLEKGYIYKGQYEGIYCVSCEEFLTN-----EQIDENGLCKISNTKPQLVNEDTYFLKVSQFQEFVQNVLKSDFLI-PEYRRNEMLKNFVE-PGLKDLSVTRVSFKWGIPITEDQRHIIYVWLDALSNYITALGYLQEDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLEALNLKQPTHLLGHGWILNKNTKMSKSLGNVIDPVKIIELYSADALRFYIANDLPTEKDGNFSLELFIESFNAHLANNVGNLISRTHNMISKYFNGYI------NLS-NVNYDQELINLGIKTIDNYVFN-MDQYKISESIKAVLELSNACNKYIETKAPWNLEKENKIEELKTVLATLQRNIAIISYLLKPVLVDSYKDMIEQSGLENVQIDFENLKSFSNIKFNKLNNKKVIFNRIK 508
>gi|83320001|ref|YP_424033.1| methionyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283887|gb|ABC01819.1| methionyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (509 aa)
Score = 1091, Expect = 1.6e-116, Identities = 234/515 (45%), Positives = 339/515 (65%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL-----KQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           KKFYITTPIYYPSGN H+GHA+TT +AD+L RYKK+ GYETFF+TG DEHGQKIE KAKE NL P E ++   + F +LW  L I+Y  FIRTT +YH+N VQ+ F+ LL+K +IY G ++G+YCVSCEE  T      ++ D+   C   +   Q   E++YFLK+ QF++++ + LK   L+ P  R NE+  +F+      DLS++R +F WGI I ++ KH++YVWLDAL NY++ LGY QKDDS F+KFW + D EI+QL  KEI RFH IYWP+MLE L L++PT  + HGWI+ +  KMSKSLGNV+DP+  I  Y  DA R+Y+  +L  ++D  FS +L I +FN  LANNVGNL +R+  MI+KY +G I          N+ ++++L     K  D+ I   +++  I + +  V++L N CN +IE   PW+L+KEN  ++L   LS +   +  + Y L+PVL+D   + ++Q  +++   +   +  F ++   K++  + I+ RI+
  S:     3 KKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFFLTGSDEHGQKIENKAKEANLTPLEYLNPKVQAFKDLWTKLNIDYDKFIRTTDDYHQNTVQKIFTILLEKGYIYKGQYEGIYCVSCEEFLTN-----EQVDENGLCKISNTKPQLVNEDTYFLKVSQFQEFVQNILKSDFLI-PEYRRNEMLKNFVE-PGLKDLSVTRVSFKWGIPITQDEKHIIYVWLDALSNYITALGYLQKDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLEALNLKQPTHLLGHGWILNKNTKMSKSLGNVIDPVKIIELYSADALRFYIANDLPTEKDGNFSLELFIESFNAHLANNVGNLISRTHNMISKYFNGYIDLN-------NVNYDQELIDLGIKTIDNYIFN-MDQYKISEAIKAVLELSNACNKYIEVKTPWNLEKENKIEELKTVLSTLQRNIAIISYLLKPVLVDSYNDMIEQCGLENVDINFDNLKTFFNIKFNKLDNKKVIFNRIK 508
>gi|42560572|ref|NP_975023.1| methionyl-tRNA synthetase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492068|emb|CAE76665.1| Methionine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (509 aa)
Score = 1087, Expect = 4.8e-116, Identities = 234/515 (45%), Positives = 340/515 (66%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL-----KQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           KKFYITTPIYYPSGN H+GHA+TT +AD+L RYKK+ GYETFF+TG DEHGQKIE KAKE NL P E ++   + F +LW  L I+Y  FIRTT +YH+  VQ+ F+ LL+K +IY G ++G+YCVSCEE  T      ++ D+   C   +   Q   E +YFLK+ QF++++ + LK   L+ P  R NE+  +F+      DLSI+R NF WGI I ++ KH++YVWLDAL NY++ LGY Q+DDS F+KFW + D EI+QL  KEI RFH IYWP+MLE L L++PT  + HGWI+ +  KMSKSLGN++DP+  I  Y  DA R+Y+  +L  ++D  FS +L I +FN  LANNVGNL +R+  MI+KY +G I          NI+++++L     K  D+ I   +++  I + +  V++L N CN +IE   PW+L+KEN  ++L   L+ +   +  + Y L+PVL++   + ++Q  +++ + +   +  FS++   K+N  + I+ RI+
  S:     3 KKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFFLTGSDEHGQKIENKAKEANLTPLEYLNPKVQAFKDLWTKLNIDYDKFIRTTDDYHEKTVQKIFTILLEKGYIYKGQYEGIYCVSCEEFLTN-----EQIDENGLCKISNTKPQLVNENTYFLKVSQFQEFVQNILKSEFLI-PEYRRNEMLKNFVE-PGLKDLSITRVNFKWGIPITQDQKHIIYVWLDALSNYITALGYLQEDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLETLNLKQPTHLLGHGWILNKNTKMSKSLGNIIDPVKIIELYSADALRFYIANDLPTEKDGNFSLELFIESFNAHLANNVGNLISRTHNMISKYFNGYIDLN-------NIKYDQELIDLGIKTIDNYIFN-MDQYKISEAIKVVLELSNACNKYIEIKTPWNLEKENRIEELKTVLATLQRNIAIISYLLKPVLVNSYTDMIEQSGLENVQINFSDLKTFSNIKFNKLNNKKVIFNRIK 508
>gi|56418566|ref|YP_145884.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Geobacillus kaustophilus HTA426] >gi|56378408|dbj|BAD74316.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Geobacillus kaustophilus HTA426] (650 aa)
Score = 1087, Expect = 5.4e-116, Identities = 210/517 (40%), Positives = 316/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESE 1085
           K FY+TTPIYYPS   HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI+ KA+E  + PQ+ VD+       LWK L I Y  FIRTT E HK VV++ F+ L+++  IYLG ++G YC  CE  YT+   V     D   C +  P+ + +EESYF ++ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHV+YVW+DAL NY++ LGY   +D  F+K+W +     V L+ KEI RFH IYWPI+L  LGL  P K   HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  I   N DLAN++GNL +R++ MI KY DG+IP Y  PK  F+ E  +  ++   +    +E +     L+ V  LI+  N +I++ +PW L K+  ++D L   ++ +  +++     L+P L    +    Q  I D S  +   + DF  + +  K+   EP++ R++ E
  S:     4 KTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPD---CGR--PVEKVKEESYFFRMSKYVDRLLQYYEENPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITALGYGTDNDEKFRKYWPAD----VHLVGKEIVRFHTIYWPIILMALGLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNLLHRTVAMIEKYFDGVIPPYRGPKTPFDQELVQTAREVVRQYEEAMEGMEFSVALAAVWQLISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTAVLLQPFLTRTPERMFAQLGITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIE 514
>gi|31544361|ref|NP_852939.1| MetS/MetG [Mycoplasma gallisepticum R] >gi|31541205|gb|AAP56507.1| MetS/MetG [Mycoplasma gallisepticum R] (590 aa)
Score = 1080, Expect = 3.3e-115, Identities = 230/518 (44%), Positives = 332/518 (64%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEN-------------DDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD--PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           KK YI+TPIYY SGNPHIGHA+TT++ D L R+KK+ GY+ FF++G DE G+KIE KAK LNL PQ++VD+Y+  F  L+ LL IE + F+RTT   H+ VV++ F     K +IYL  W+GLYCV CEENYT +  ++K +             DD+LYC   H +    E SYF+K+ +F  +I   L D  P+ V+P +R  E+ N+F+N     DLSISR++ SWGI+   N  H +YVWLDAL +YL+ +G+  +DD  +Q+FWN+  +E + L++KEITRFH IYW I L+MLG+++PT+ ISHGWI+ E G KMSKSL N++DPI     +G D  RYYLLKELSL ED    ++L+  T N DL NN+GNL +R I M+   ++  I  Y         ++   L++   E   ++E+ +I+  +  V+++  E +  IE  KPW+L K N  ++L   L     A++ V   LEP+L   SKE  +Q N    +  +K + +F  L N KIN  + ++ +++  D
  S:    15 KKCYISTPIYYASGNPHIGHAYTTILGDFLARFKKQRGYDVFFLSGTDEFGKKIETKAKSLNLTPQKMVDQYSSKFKELFDLLNIELTRFVRTTEPKHQEVVKKIFGLFYLKKYIYLDQWQGLYCVDCEENYTTSSVLKKADLVEKTNLDLSMDPDDQLYCHVGHKISSINEPSYFIKLSEFSDFIKESLTDNVPS-VFPTSRNKEMLNNFVNV-GLKDLSISRTSISWGIETPLNKSHRIYVWLDALFSYLTSMGFGSEDDKLYQEFWNNDSSERIHLIAKEITRFHRIYWVIFLKMLGIKQPTRMISHGWILDENGNKMSKSLNNIIDPIELAELFGVDQLRYYLLKELSLSEDGKVGKRLIQETINSDLINNLGNLVHRLIPMLESRQESTILPYLAGN-EVEDKYLADLQKLPAEFEKLVEENDIRSAIKLVLNISKEYSSVIEVRKPWELYKNNKTQELANILFAGACAIRTVFVLLEPILTTKSKEVYEQMNFTPEQTQLKNINNFEQLFNHKINKSKKLFQKLDVTD 545
>gi|171325941|ref|ZP_02914436.1| methionyl-tRNA synthetase [Geobacillus sp. WCH70] >gi|171088054|gb|EDT34410.1| methionyl-tRNA synthetase [Geobacillus sp. WCH70] (648 aa)
Score = 1063, Expect = 2.7e-113, Identities = 210/519 (40%), Positives = 320/519 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESEDK 1087
           K FY+TTPIYYPSG  HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI+ KA+E  + PQ+ VD+  +    LWK L I Y  FIRTT E HK VV++ F+ L+++  IYLG ++G YC  CE  YT+   V     D   C +  P+ + +EESYF ++ ++  + +  + ++P  + P +R NE+ N+F+     +DL++SR+ F WGI++  +PKHV+YVW+DAL NY++ LGY   +D  F+K+W +     V L+ KEI RFH IYWPIML  L L  P K  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI KY DG+IP Y   K +F+ +  ++ K+   +    +EK+     L+ V  LIN  N +I++ +PW L K+  +K+ L   ++ +  +++ V   L+P L    ++   Q  I D        + +F  + +  K+   EP++ R++ E +
  S:     4 KTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVEGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPD---CGR--PVEKVKEESYFFRMSKYVDRLLQYYEENPEFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALTNYITALGYGTDNDEKFRKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMIEKYFDGMIPPYRGAKTAFDNDLVEKAKETVKQYEEAMEKMEFSIALASVWQLINRTNKYIDETQPWLLAKDEGKKEQLASVMTHLAESLRHVAILLQPFLTRTPEKIFAQLGIVDEQLKQWDSLYEFGLIKEGTKVTKGEPLFPRLDIEKE 516
>gi|195977657|ref|YP_002122901.1| methionyl-tRNA synthetase MetG [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974362|gb|ACG61888.1| methionyl-tRNA synthetase MetG [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (672 aa)
Score = 1063, Expect = 2.8e-113, Identities = 212/526 (40%), Positives = 326/526 (61%)
  Q:   560 KITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESE 1085
           K+T K    K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  L PQ  VD  A+    LWKLL I Y  FIRTT +YH+ VV   F  LL +D IYLG + G Y VS EE +T++    + ++   K+        H +    EESYFL++ ++   + +F K  P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY QKD +NF KFW+ +   +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y K   +F+ + E+ +     E    +E ++  + L  V  +I+  N +I++  PW L K  + K+ L   ++ +  +++ V + + P ++  S   ++Q  +D++ + ++ + D + L      +   EPI+ R++ E
  S:     5 KMTKK----KPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGYDVFYLTGLDEHGQKIQDKAQEAGLSPQAYVDGMAEEVKALWKLLDISYDKFIRTTDDYHEEVVAAVFERLLAQDDIYLGTYSGWYSVSDEEFFTESQLAEIYRDEAGKVIGGVAPSGHEVEWVSEESYFLRLSKYADRLVAFFKAQPDFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQKDHANFDKFWSGR---VFHMVGKDILRFHSIYWPILLMMLDLPMPERLIAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGRVPAYVKNVTAFDADLEQVVADHISEYHKQMEAVDYPRALEAVWTIISRTNKYIDETAPWVLAKAADSKEQLASVMAHLAASLRVVAHLIWPFMMTTSAAMMEQLGLDAT-YHLEEL-DLADLPTGVTVVAKGEPIFPRLDME 529
>gi|196250752|ref|ZP_03149439.1| methionyl-tRNA synthetase [Geobacillus sp. G11MC16] >gi|196209702|gb|EDY04474.1| methionyl-tRNA synthetase [Geobacillus sp. G11MC16] (650 aa)
Score = 1063, Expect = 3.3e-113, Identities = 208/517 (40%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESE 1085
           K FY+TTPIYYPS   HIGHA+TT+  D L RYK+  GY+  ++TG DEHGQKI+ KA+E  + PQ+ VD+       LWK L I Y  FIRTT E HK VV++ F+ L+++  IYLG ++G YC  CE  YT+   V     D   C +  P+ + +E+SYF ++ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WGI++  +PKHV+YVW+DAL NY++ LGY   +D  F+K+W +     V L+ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  I   N DLAN++GNL NR++ MI KY DG+IP Y  PK  F+ E  +  ++   +    +E++     L+ V  LI   N +I++ +PW L K E+  ++L   ++ +  +++     L+P L    +    Q  I D S  +   + +F  + +   +   EP++ R++ E
  S:     4 KTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPD---CGR--PVEKVKEQSYFFRMSKYVDRLLQYYEENPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITALGYGTDNDEKFRKYWPAD----VHLVGKEIIRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLNRTVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYEEAMERMEFSVALASVWQLIGRTNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTAVLLQPFLTRTPERIFAQLGIADRSLKEWDSLYEFGLIPEGTNVQKGEPLFPRLDIE 514
>gi|138893709|ref|YP_001124162.1| methionine-tRNA ligase/methionyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] >gi|134265222|gb|ABO65417.1| Methionine-tRNA ligase/methionyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] (650 aa)
Score = 1063, Expect = 3.3e-113, Identities = 208/517 (40%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESE 1085
           K FY+TTPIYYPS   HIGHA+TT+  D L RYK+  GY+  ++TG DEHGQKI+ KA+E  + PQ+ VD+       LWK L I Y  FIRTT E HK VV++ F+ L+++  IYLG ++G YC  CE  YT+   V     D   C +  P+ + +E+SYF ++ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WGI++  +PKHV+YVW+DAL NY++ LGY   +D  F+K+W +     V L+ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  I   N DLAN++GNL NR++ MI KY DG+IP Y  PK  F+ E  +  ++   +    +E++     L+ V  LI   N +I++ +PW L K E+  ++L   ++ +  +++     L+P L    +    Q  I D S  +   + +F  + +   +   EP++ R++ E
  S:     4 KTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPD---CGR--PVEKVKEQSYFFRMSKYVDRLLQYYEENPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITALGYGTDNDEKFRKYWPAD----VHLVGKEIIRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLNRTVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYEEAMERMEFSVALASVWQLIGRTNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTAVLLQPFLTRTPERIFAQLGIADRSLKEWDSLYEFGLIPEGTNVQKGEPLFPRLDIE 514
>gi|135148|sp|P23920|SYM_BACST Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|39989|emb|CAA40999.1| methionine--tRNA ligase; methionyl-tRNA synthetase [Geobacillus stearothermophilus] (649 aa)
Score = 1061, Expect = 5.0e-113, Identities = 205/515 (39%), Positives = 312/515 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIE 1083
           K FY+TTPIYYPS   HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI+ KA+E  + PQ+ VD        LW+ L I Y  FIRTT E HK +V++ F+ L+++  IYLG ++G YC  CE  YT+   V     D   C +  P+ + +EESYF ++ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WGI++  +PKHV+YVW+DAL NY++ LGY   +D  F+K+W +     V L+ KEI RFH IYWPIML  LGL  P K   HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  I   N DLAN++GNL +R++ MI KY  G IP Y  PK  F+ +  +  ++   +    +E++     LS V  LI   N +I++ +PW L KE +++ +L   ++ +  +++     L+P L    +    Q  I D S  +   + DF  + +   +   EP++ R++
  S:     4 KTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKAQEKGVTPQQYVDDIVAGIQELWRKLDISYDDFIRTTQERHKKIVEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPD---CGR--PVEKVKEESYFFRMSKYVDRLLQYYEENPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITALGYGTDNDEKFRKYWPAD----VHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVMIIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLHRTVAMIEKYFGGAIPPYRGPKTPFDRDLSETAREVVRQYEEAMERMEFSVALSAVWQLIGRTNKYIDETQPWVLAKEESKREELASVMAHLAESLRYTAVLLQPFLTRTPERIFTQLGISDRSLKEWDSLYDFGLIPEGTNVQKGEPLFPRLD 512
>gi|172056076|ref|YP_001812536.1| methionyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] >gi|171988597|gb|ACB59519.1| methionyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] (651 aa)
Score = 1061, Expect = 5.3e-113, Identities = 206/519 (39%), Positives = 308/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPS   HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKI+EKAKE  +  QE VD   +    LW  L I Y  +IRTT   HK VV+  F  LL+K  IYLG ++G Y V  E  YT++  V  ++ D       HP+    EE YF +I Q+  + +  +  +P+ + P +R +E+ N+F+      DL++SR+ F WG+++  NPKHVVYVW+DAL NY+S LGY   D  NF K+W +     V L+ KEI RFH I WP +L  L L  P +  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D +F+ +  +   N DLAN++GNL NR+I MI KY DG+IP Y+     F+       K+  +++   +E +     LS +  LI+  N +I++ +PW L K+ ++ D L   +  ++ A++ V   L+P +    KE  +Q  ++    D   +  F++++   K+   EPI+ R + +++
  S:     3 KTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLQGFDVRYLTGTDEHGQKIQEKAKEAGVSEQEFVDGVVEQIKVLWDRLDISYDDYIRTTEPRHKEVVERVFETLLEKGDIYLGEYEGWYSVPDETYYTESQLVDGKSPD-----SGHPVELVREECYFFRISQYADRLVEYYEANPSFILPESRKHEMINNFIK-PGLQDLAVSRTTFDWGVKVPSNPKHVVYVWVDALTNYISSLGYGTDDQGNFDKYWPAD----VHLVGKEIVRFHTIVWPALLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVPMIDRYGLDALRYYLLREVPFGSDGMFTPEAFVERMNFDLANDLGNLLNRTIAMITKYFDGVIPTYAGNVTPFDETLSTLAKETVEKVEAAMEHMEFSVALSHIWQLISRANKYIDETQPWVLAKDESKTDELASSMVHLVGALRHVAIMLQPFMTRSPKEMFRQLGLEGQPMDWTALEQFAAIEEGTKVGAAEPIFPRRDMKEE 514
>gi|89101166|ref|ZP_01173999.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp. NRRL B-14911] >gi|89084134|gb|EAR63302.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp. NRRL B-14911] (653 aa)
Score = 1060, Expect = 6.2e-113, Identities = 214/520 (41%), Positives = 325/520 (62%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITT----IIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-------DNQKINTPEPIYLRIESEDK 1087
           +K FY+TTPIYYPSGN HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI++KA+E  + PQE VD+      +LW  L I Y  FIRTT + HK VV++ F+ LL++  IYLG ++G YC  CE  +T+   V     D   C +  P+ + +EESYF K+ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WG+++ +NPKHVVYVW+DAL NY++ LGY  +DDS +  +W +     V L+ KEI RFH IYWPIML  L L  P K  +HGW++ + GKMSKS GNV+DP+  I+ YG D+ RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI KY DG IP Y   +     EF+KQL   + E        +EK+     LS V  L++  N +I++ +PW L K E  +++L   +  +  +++R    L+P L         Q N+++ +     +T + SL       +N K+   +PI+ R++ +++
  S:     5 LKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQQKAEEKGVTPQEYVDEIVDGIKDLWSKLDISYDDFIRTTQDRHKQVVEKIFARLLEQGDIYLGEYEGWYCTPCESYFTERQLVDGNCPD---CGR--PVNKVKEESYFFKVSKYADRLLKYYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGVKVPDNPKHVVYVWIDALSNYITALGYGTEDDSKYLNYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDSLRYYLLREVPFGADGVFTPEGFVERVNFDLANDLGNLLNRTVAMIEKYFDGTIPAYQGSEG----EFDKQLLDMNKETVAKYEEAMEKMEFSVALSSVWQLVSRTNKYIDETQPWVLAKDEARKEELGNVMFHLAESLRRTGVLLKPFLTRTPDGIFNQLNVNTEE-----LTSWESLETFGLIPENTKVVKGDPIFPRLDMKEE 518
>gi|182683707|ref|YP_001835454.1| methionine--tRNA ligase [Streptococcus pneumoniae CGSP14] >gi|182629041|gb|ACB89989.1| methionine--tRNA ligase [Streptococcus pneumoniae CGSP14] (679 aa)
Score = 1056, Expect = 2.1e-112, Identities = 214/524 (40%), Positives = 321/524 (61%)
  Q:   564 KGEVM--KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KG++M  K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  +D  +  +   + DF + D   +    PI+ R++ E++
  S:    11 KGKIMSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKSHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDNALAEVAEQSIADYHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASLRVVAHLIEPFMMETSRAVLTQLGLDEVASLENLSLADFPA-DVTVVAKGTPIFPRLDMEEE 539
>gi|192813437|ref|ZP_03042099.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC10] >gi|192797702|gb|EDV74220.1| methionyl-tRNA synthetase [Geobacillus sp. Y412MC10] (662 aa)
Score = 1055, Expect = 2.8e-112, Identities = 204/517 (39%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSS-------LDNQKINTPEPIYLRIESE 1085
           K FYITTPIYYPS   HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKIE KA E    PQ+ VD       +LWK L I    FIRTT + H  VVQ+ F  LLK+D IY G ++G YC  CE  + +   V     D   C +  P+   +EESYF ++ ++  + +  + ++P+ + P++R NE+ N+F+     +DL++SR+ + WG+++K +PKHV+YVW+DALLNY++ LGY  +D S + K+W +     V LMSKEI RFH IYWPI+L  L +  P K  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D  F+ +  +   N DLAN++GNL NR++ M++KY DG +P +S     F+   E+  K   D++ T +E +     L+ +   ++  N +I++ +PW L K+ +++ +L   +S ++ A++     L+P L    K+  +Q  +   +     +T + S           K+   EPI+ R+++E
  S:     5 KTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIERKAAEAGKTPQQFVDDIVAGIKDLWKKLDISNEDFIRTTEKRHTTVVQDVFERLLKQDDIYKGEYEGWYCTPCESFFLERQLVNGNCPD---CGR--PVELVKEESYFFRMSKYVDRLLQYYEENPDFIQPVSRKNEMINNFIK-PGLEDLAVSRTTYEWGVKVKSDPKHVIYVWIDALLNYITALGYGTEDTSLYDKYWPAD----VHLMSKEIVRFHTIYWPIILMALDVPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTMIDRYGLDALRYYLLREVPFGADGTFTPESFVERVNSDLANDLGNLLNRTVAMVDKYFDGEVPAFSAGVTPFDAAIEEAAKSVYDKVETAMENMEFSVALTAISQFVSRSNKYIDETQPWTLAKDESKRHELASVMSHLVEALRIASILLQPFLTRTPKKMWEQLGLAEGE-----LTTWESGRQLGAIPAGTKLQKGEPIFPRLDAE 515
>gi|15458285|gb|AAK99500.1| Methionyl-tRNA synthetase [Streptococcus pneumoniae R6] (679 aa)
Score = 1053, Expect = 4.5e-112, Identities = 214/524 (40%), Positives = 320/524 (61%)
  Q:   564 KGEVM--KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KG++M  K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:    11 KGKIMSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 539
>gi|15674551|ref|NP_268725.1| methionyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|13621657|gb|AAK33446.1| putative methionyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] (666 aa)
Score = 1052, Expect = 5.8e-112, Identities = 209/519 (40%), Positives = 322/519 (62%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGYRQ + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  ++  S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYDDRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYRQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRLVAHVIQPFMMETSAAIMAQLGLEPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|71902998|ref|YP_279801.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] >gi|71802093|gb|AAX71446.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] (666 aa)
Score = 1052, Expect = 5.8e-112, Identities = 209/519 (40%), Positives = 321/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D K+        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +F + +     +    +E ++  + L  +  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDEDGKVIGGIAPSGHQVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADFSQLIDAQLADYHKHMEAVDYPRALEAIWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|71910158|ref|YP_281708.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] >gi|25009390|sp|Q9A178|SYM_STRP1 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|71852940|gb|AAZ50963.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] (665 aa)
Score = 1051, Expect = 6.4e-112, Identities = 207/517 (40%), Positives = 319/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGYRQ + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  ++  S      + DF + + + +    PI+ R++ E
  S:     3 KPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYDDRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYRQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRLVAHVIQPFMMETSAAIMAQLGLEPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 522
>gi|148992454|ref|ZP_01822149.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|147928771|gb|EDK79784.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] (665 aa)
Score = 1048, Expect = 1.5e-111, Identities = 211/519 (40%), Positives = 316/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD+ A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQVYVDRMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|149021655|ref|ZP_01835686.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|147930116|gb|EDK81102.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] (665 aa)
Score = 1048, Expect = 1.5e-111, Identities = 211/519 (40%), Positives = 316/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD+ A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQVYVDRMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWILAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|168488458|ref|ZP_02712657.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP195] >gi|183573094|gb|EDT93622.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP195] (665 aa)
Score = 1048, Expect = 1.6e-111, Identities = 211/519 (40%), Positives = 316/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD+ A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQVYVDRMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDCLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|110004172|emb|CAK98510.1| probable methionyl-trna synthetase transmembrane protein [Spiroplasma citri] (526 aa)
Score = 1048, Expect = 1.6e-111, Identities = 222/519 (42%), Positives = 326/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FY+TTPIYYPS   HIGHA+TT +AD+L RYKK  GYETFF+TG DEHG+KIE+KAK   + P + +      F  LW  LGIEYS FIRTT + H+  VQ+ FS+L     IYLG ++GLYCVSCEE  T+   + K  +  L C      ++  EE+YF K+ ++ +++ ++  + P  + P  R NE+ N+F+      DLS++R+ FSWGI+  EN KH++YVW+DAL NYL+ LGY   DD+ F KFWN+ D EI+QL+ KEI RFH IYWP MLE LGLR+P K +SHGWI+ +  KMSKS+GNV+DP+Y I+ YGRD  R+YL  E+  + D  FS ++ + ++N  L NN+GNL +R   MI+KY +G + K  +     N+  E  ++   +     ++   I + LS +++L N+ N +IE+ KPW+L+K  N + L   L+ +   +    + L+PVL+D +++    FN++ +    K +     + N+ I   E ++ R+  E +
  S:     6 KLFYVTTPIYYPSAQLHIGHAYTTTLADILNRYKKMAGYETFFLTGSDEHGEKIEKKAKTAGITPYQFITMIVDNFKLLWNKLGIEYSKFIRTTDKEHEVGVQKIFSKLYNNGDIYLGEYEGLYCVSCEEFLTE-AQIDKITNQCLVCGNKPQKVK--EETYFFKVSKYSQFLINYYNNHPGFIEPEARKNEMLNNFIL-PGLTDLSVTRTTFSWGIKTLENDKHIIYVWIDALSNYLTALGYLSNDDALFNKFWNNPDVEILQLLGKEIARFHTIYWPSMLESLGLRQPNKLLSHGWILFKDTKMSKSIGNVVDPLYLIDKYGRDTLRFYLGYEIPTENDGKFSYEMFLESYNAHLVNNIGNLVSRVSNMISKYFNGQLVKQQQLD---NVLIESCVQAVQN-YQQAMDAYQISEGLSMILELCNKANKYIEENKPWELEKNKNMEQLHETLASLAYTIIVSAFLLQPVLVDNAQKIADYFNVNLTNLTFKTILMQEIIYNKTIEKKENLFNRVNVEQE 517
>gi|169832629|ref|YP_001694248.1| methionyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] >gi|168995131|gb|ACA35743.1| methionyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] (665 aa)
Score = 1047, Expect = 2.2e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPIGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|148997133|ref|ZP_01824787.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|149007671|ref|ZP_01831288.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|168575450|ref|ZP_02721386.1| methionyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] >gi|147756833|gb|EDK63873.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|147760826|gb|EDK67797.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|183578466|gb|EDT98994.1| methionyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] (665 aa)
Score = 1047, Expect = 2.2e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|149010582|ref|ZP_01831953.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|168490882|ref|ZP_02715025.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|168492944|ref|ZP_02717087.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] >gi|147765063|gb|EDK71992.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|183574634|gb|EDT95162.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|183577043|gb|EDT97571.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] (665 aa)
Score = 1046, Expect = 2.7e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|50913716|ref|YP_059688.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] >gi|50902790|gb|AAT86505.1| Methionyl-tRNA synthetase; Protein secretion chaperonin CsaA [Streptococcus pyogenes MGAS10394] (666 aa)
Score = 1046, Expect = 2.7e-111, Identities = 208/519 (40%), Positives = 320/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|15900681|ref|NP_345285.1| methionyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|116516229|ref|YP_816183.1| methionyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|148989872|ref|ZP_01821166.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] >gi|161410751|ref|NP_358290.2| methionyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|168484447|ref|ZP_02709399.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|194397413|ref|YP_002037433.1| methionyl-tRNA synthetase [Streptococcus pneumoniae G54] >gi|54039688|sp|P67581|SYM_STRR6 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|54042048|sp|P67580|SYM_STRPN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|14972263|gb|AAK74925.1| methionyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|116076805|gb|ABJ54525.1| methionyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|147924814|gb|EDK75898.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] >gi|172042338|gb|EDT50384.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|194357080|gb|ACF55528.1| methionyl-tRNA synthetase [Streptococcus pneumoniae G54] (665 aa)
Score = 1046, Expect = 2.7e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|149003418|ref|ZP_01828307.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] >gi|147758601|gb|EDK65599.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] (665 aa)
Score = 1046, Expect = 2.8e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPEGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|139474323|ref|YP_001129039.1| methionyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] >gi|73919759|sp|Q5XDK8|SYM_STRP6 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|134272570|emb|CAM30836.1| methionyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] (665 aa)
Score = 1046, Expect = 3.1e-111, Identities = 206/517 (39%), Positives = 317/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     3 KPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 522
>gi|168486199|ref|ZP_02710707.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] >gi|183570793|gb|EDT91321.1| methionyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] (665 aa)
Score = 1045, Expect = 4.1e-111, Identities = 211/519 (40%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY  F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D+ RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     4 KNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYYVFYLTGLDEHGQKIQQKAEEAGITPQTYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDSLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 525
>gi|28896469|ref|NP_802819.1| methionyl-tRNA synthetase [Streptococcus pyogenes SSI-1] >gi|28811720|dbj|BAC64652.1| putative methionyl-tRNA synthetase [Streptococcus pyogenes SSI-1] (666 aa)
Score = 1045, Expect = 4.1e-111, Identities = 208/519 (40%), Positives = 320/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQVIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|21909836|ref|NP_664104.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS315] >gi|25009347|sp|P59080|SYM_STRP3 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|21904022|gb|AAM78907.1| putative methionyl-tRNA synthetase [Streptococcus pyogenes MGAS315] (665 aa)
Score = 1044, Expect = 4.8e-111, Identities = 206/517 (39%), Positives = 317/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     3 KPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQVIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 522
>gi|94987979|ref|YP_596080.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94991861|ref|YP_599960.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] >gi|94541487|gb|ABF31536.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94545369|gb|ABF35416.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA [Streptococcus pyogenes MGAS2096] (666 aa)
Score = 1042, Expect = 7.3e-111, Identities = 208/519 (40%), Positives = 321/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D+ RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDDRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDSLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|94993743|ref|YP_601841.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] >gi|94547251|gb|ABF37297.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA [Streptococcus pyogenes MGAS10750] (666 aa)
Score = 1042, Expect = 7.7e-111, Identities = 207/519 (39%), Positives = 320/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  +  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAIWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|19745562|ref|NP_606698.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] >gi|25009357|sp|Q8P298|SYM_STRP8 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|19747684|gb|AAL97197.1| putative methionyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] (665 aa)
Score = 1042, Expect = 9.0e-111, Identities = 206/517 (39%), Positives = 317/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     3 KPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGISPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 522
>gi|69248667|ref|ZP_00604797.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Enterococcus faecium DO] >gi|68194356|gb|EAN08866.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Enterococcus faecium DO] (669 aa)
Score = 1041, Expect = 1.1e-110, Identities = 209/519 (40%), Positives = 324/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK--FVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           + FYITTPIYYPSG  HIG+++TT+  D + RYK+ +G++ F++TG+DEHGQKIE KA+EL +KPQE VDK A     LWK L I Y  FIRTT +YHK  VQ+ F  LL++  IYLG ++G Y VS EE +T+     V K+++  +   +    H +   +EESYF ++ ++   +  + ++ P  + P +R NE+ N+F+     +DL++SR+ F+WG+ +K +PKHVVYVW+DAL NY++ LGY  +D+S F+K+W +     VQ++ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+ P   +  YG DA RYYLL+ +    D VF+ +  ++  N DLAN++GNL NR+I MINKY DG++P Y+     F+ E               +EK+     L+ +  LI+  N +I++ +PW L K+  +K +L+  +  +  +++     L+P++ +  ++   Q  +DS   +++     +F S   + +    PI+ R++ E++
  S:     5 ETFYITTPIYYPSGKLHIGNSYTTIACDAIARYKRLMGFDVFYLTGVDEHGQKIETKAEELGVKPQEYVDKMAADVKKLWKTLDISYDKFIRTTDDYHKAAVQKIFDRLLEQGDIYLGEYEGWYSVSDEEFFTETQLAEVYKDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYADRLLEYYEEHPEFIQPESRKNEMINNFI-KPGLEDLAVSRTTFTWGVPVKSDPKHVVYVWIDALSNYITALGYGSEDESLFEKYWPAD----VQMVGKEIVRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAVPFGSDGVFTPEDFVSRVNYDLANDLGNLLNRTIAMINKYCDGLVPDYASLVTPFDSELSTTAANVVGRYHDAMEKMEFNTALAEIWVLISRANKYIDETEPWVLAKDEEKKAELNSVMIHLAESLRIAAILLQPIMTETPEKIFNQLGLDSETMNLEGLHFGEFPS-GTKVVAKGTPIFPRLDMEEE 526
>gi|29375514|ref|NP_814668.1| methionyl-tRNA synthetase [Enterococcus faecalis V583] >gi|38258306|sp|Q837B3|SYM_ENTFA Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|29342974|gb|AAO80738.1| methionyl-tRNA synthetase [Enterococcus faecalis V583] (669 aa)
Score = 1039, Expect = 1.6e-110, Identities = 210/517 (40%), Positives = 317/517 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL-----YCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV--TDFSSLDNQKINTPEPIYLRIESE 1085
           + FYITTPIYYPSG  HIG+++TT+  D + RYK+ +G++ F++TG+DEHGQKIE+KA ELN+ P+E VDK A     LWK L I Y  FIRTT +YH   VQ+ F  L+++  IYLG ++G Y VS EE +T+        DD+           H +   +EESYF ++ ++  + +  + + P  + P +R NE+ N+F+     +DL++SR+ FSWGI +K +PKHVVYVW+DAL NY++ LGY  +DDS FQK+W +     VQ++ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+ P   +  YG DA RYYLL+ +    D VF+ +  ++  N DLAN++GNL NR+I MINKY DG +P Y+     F+ E          +    +EK+     ++ +  L++  N +I++  PW L KE  ++ +L+  +  +  +++ V   L+PV+ +   +  +Q  +D    +++ +   +F + D    +   PI+ R+E E
  S:     5 ETFYITTPIYYPSGKLHIGNSYTTIACDAMARYKRLMGFDVFYLTGVDEHGQKIEKKAAELNVTPKEYVDKMAADVQKLWKTLDISYDKFIRTTDDYHMAAVQQIFDRLVEQGDIYLGEYEGWYSVSDEEFFTETQLAEVYRDDEGNVIGGKAPSGHEVELVKEESYFFRMSKYADRLVQYYEEHPEFIQPESRKNEMLNNFIK-PGLEDLAVSRTTFSWGIPLKNDPKHVVYVWIDALSNYITALGYGSEDDSLFQKYWPAN----VQMVGKEIVRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLLRAIPFGSDGVFTPEDFVSRLNYDLANDLGNLLNRTIAMINKYCDGKVPAYASKVTPFDSELSTTAANVIGKYHEAMEKMEFNTAIAEIWTLVSRANKYIDETAPWVLAKEEEKRNELESVMIHLAESLRIVAILLQPVMTETPGKIFEQLGLDPETMNMENIHFGEFPT-DVTVTSKGTPIFPRLEIE 524
>gi|94989852|ref|YP_597952.1| methionyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] >gi|94543360|gb|ABF33408.1| Methionyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] (666 aa)
Score = 1038, Expect = 2.1e-110, Identities = 208/519 (40%), Positives = 320/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  +KPQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYL  + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+ P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGIKPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLDEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERPDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|52078533|ref|YP_077324.1| methionyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52783895|ref|YP_089724.1| methionyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52001744|gb|AAU21686.1| methionyl-tRNA synthetase MetS [Bacillus licheniformis ATCC 14580] >gi|52346397|gb|AAU39031.1| MetS [Bacillus licheniformis DSM 13] (662 aa)
Score = 1034, Expect = 6.4e-110, Identities = 207/517 (40%), Positives = 314/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKI++ A++ N+ PQELVD+ A+    LWK L I    FIRTT E HK V+++ F +LL    IYL  ++G Y +  E  YT+   V  E ++K            HP+   +EESYF ++ ++   + +F ++ P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHV+YVW+DAL NY++ LG+  ++D N+QK+W +     V L+ KEI RFH IYWPIML  L L  P K  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ M+NKY DG I  Y  P  +F+       ++  +     IE +     LS +   ++  N +I++  PW L K+ + EK+L   +  +  +++     L+P L    ++   Q  + D+S      +  F  L +  +   EP++ R+E+ED+
  S:     8 FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIQQTAEKENITPQELVDRAAEDIQQLWKKLDISNDDFIRTTEERHKKVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDVERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYADRLLAFYEENPEFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALFNYITALGFNTENDENYQKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMVNKYFDGRIQSYEGPVTAFDEPLSSFSQKTIEAYEQAIENMEFSVALSSLWQFVSRTNKYIDETAPWVLAKDKDKEKELQSVMYHLAESLRITAVLLQPFLTQTPEKIFAQLGVTDASLKTWDSIQSFGQLKSVTVQKGEPLFPRLEAEDE 528
>gi|157149888|ref|YP_001450809.1| methionyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|157074682|gb|ABV09365.1| methionine-tRNA ligase [Streptococcus gordonii str. Challis substr. CH1] (666 aa)
Score = 1034, Expect = 7.7e-110, Identities = 206/519 (39%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           + FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LWKLL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++    V ++ + K+        H +    EESYFL++ +++  +  F K  P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q D +N+ KFWN     + Q++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y +    F+    +   +   +    ++ ++  + L  V  LI+  N +I++  PW L K+   ++ L   +S +  +++ V + +EP +++ SK  L Q  +  +        D        +    PI+ R++ E++
  S:     5 QSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGISPQAYVDGMAVGVKELWKLLDISYDKFIRTTDDYHEKVVADVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDENGKVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKSHPDFITPDGRLNEMLRNFI-EPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQDDHANYDKFWN---GTVFQMVGKDILRFHSIYWPILLMMLDIKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQVPTYEENVTDFDGALAQVAAKSIADYYKHMDAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRNQLASVMSHLAASLRVVAHMIEPFMMETSKAVLSQLGLPQAASLENLAIDQLPAGLTVVEKGTPIFPRLDMEEE 526
>gi|116333117|ref|YP_794644.1| methyonyl-tRNA synthetase [Lactobacillus brevis ATCC 367] >gi|116098464|gb|ABJ63613.1| methionyl-tRNA synthetase [Lactobacillus brevis ATCC 367] (677 aa)
Score = 1032, Expect = 1.2e-109, Identities = 205/517 (39%), Positives = 310/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNE-KDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD----NQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIG+++TT+  D + RYK+  GY+ FF+TG DEHG KIE+KAK  N  PQE VD  A     LWK L I    FIRTT   H   VQ  F  LLK+  IYLG ++G Y    EE +T+     V ++ D K+   Q    H +   +E+SYF K+ ++  ++  F    P+ + P +R+ E+ N+F+     +DL++SR+ FSWG+ +K +PKHVVYVW+DALLNY++ LGY   DD  F+KFW +     VQ++ KEI RFH IYWPI+L  LGL  P +  +HGW++ + GKMSKS GNV+ P   ++ YG DA RYYL++ +    D VFS +  ++  N DLAN++GNL NR++ MINKY  G +P+Y      F+ + E            ++ +++    L+ +  L+   N +I++ +PW L K++++  +L   ++ +  +++ +   + PV+    KE   Q  +D +   +   TD +  D     Q +    PI+ RI+ +++
  S:     7 FYITTPIYYPSGRLHIGNSYTTIACDTVARYKRSNGYDVFFLTGTDEHGLKIEDKAKAQNQTPQEYVDGMATGIKQLWKTLEISNDKFIRTTDHEHVAAVQAIFDRLLKQGDIYLGEYEGWYSEDDEEYFTETQLAKVYRDADGKMIGGQAPSGHDVSLVKEQSYFFKMSKYADWLLDFYHSHPHFIQPESRMTEMINNFIK-PGLEDLAVSRTTFSWGVPVKSDPKHVVYVWIDALLNYITALGYTSDDDGLFKKFWPAD----VQMVGKEIVRFHSIYWPIVLHALGLEMPKELFAHGWLLMKDGKMSKSKGNVIYPETLVDRYGLDALRYYLMRAMPYGNDGVFSPEDFVDRLNYDLANDLGNLLNRTVAMINKYEGGQLPQYQAGVTEFDADLEATAAAVITNYHDLMNQMHFADALAEIWKLVARSNKYIDETEPWKLAKDDSKATELAAVMAHLAASLRVIATLISPVMTHAPKEIFDQLGLDVATLTM---TDLALADLPAGKQVVAKGTPIFPRIDVQEE 526
>gi|125718503|ref|YP_001035636.1| methionyl-tRNA synthetase [Streptococcus sanguinis SK36] >gi|125498420|gb|ABN45086.1| Methionyl-tRNA synthetase, putative [Streptococcus sanguinis SK36] (666 aa)
Score = 1031, Expect = 1.6e-109, Identities = 207/519 (39%), Positives = 315/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           + FYITTPIYYPSG  HIG+A TT+  DVL RYK+ +GY+ F++TG+DEHGQKI+ KA+E  + PQ  VD  A     LWKLL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++    V ++ + K+        H +    EESYFL++ +++  +  F K  P+ + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHV+YVW+DALLNY + LGY Q D +N+ KFWN  +  +  +++K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG DA RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y +    F+    +   +   +    ++ ++  + L  V  LI+  N +I++  PW L K E   K+L   +S +  ++  V + +EP +++ SK  L Q  +  +        D        +    PI+ R++ E++
  S:     5 QSFYITTPIYYPSGKLHIGNATTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQAKAEEAGISPQAYVDGMAVGVKELWKLLDISYDKFIRTTDDYHEKVVADVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDENGKVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKSHPDFITPNGRLNEMLKNFI-EPGLEDLAVSRTTFTWGVAVPSNPKHVIYVWIDALLNYATALGYGQDDHANYDKFWN--NGTVYHMVAKDILRFHSIYWPILLMMLDIKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQVPTYEENVTDFDGALAQVASESIADYYKHMDAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEAKVKELAAVMSHLAASLCVVAHMIEPFMMETSKAVLSQLGLPQATSLENLAIDQLPAGLTVVEKGTPIFPRLDMEEE 527
>gi|49482717|ref|YP_039941.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|60390704|sp|Q6GJI1|SYM_STAAR Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|49240846|emb|CAG39513.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] (657 aa)
Score = 1030, Expect = 1.8e-109, Identities = 220/517 (42%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT--------PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I MINKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+   + T        P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLTEPIMVTGQPKPIFPRLDSE 525
>gi|171780192|ref|ZP_02921096.1| hypothetical protein STRINF_01980 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281540|gb|EDT46975.1| hypothetical protein STRINF_01980 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (667 aa)
Score = 1030, Expect = 2.1e-109, Identities = 205/517 (39%), Positives = 321/517 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP-EPIYLRIESE 1085
           + FYITTPIYYPSG  HIG A+TT+  DVL RYK+ + Y+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LWK+L I Y  FIRTT +YH+ VV E F +LL +D IYLG + G Y VS EE +T++      R EN   +       H +    EESYFL++ ++  + +  F   P+ + P  R+NE+  +F+     +DL++SR++F+WG+++  NPKHVVYVW+DALLNY + LGY Q++ +NF  FWN  +  +  ++ K+I RFH IYWPIML ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY  G +P Y K   +F+ +    +++   E    +  ++  + L  V  +I+  N +I++  PW L K++ ++D L   ++ +  +++ V + ++P ++  S   ++Q  +  S FD++ +T     +  K+     PI+ R++ E
  S:     5 QPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAADVKKLWKMLDISYDKFIRTTDDYHEKVVAEVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGKVIGGIAPSGHEVEWVSEESYFLRLGKYADRLVEFFHAHPDFIQPDGRMNEIIKNFI-EPGLEDLAVSRTSFTWGVKVPSNPKHVVYVWIDALLNYATALGYGQEEHANFDNFWN--EGTVFHMVGKDILRFHSIYWPIMLMMLDMKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFGGDVPAYVKNVTAFDADLADVVEEKLAEYHKQMNAVDYPRALDAVWSIISRTNKYIDETAPWVLAKDDAKRDELAAVMAHLAASLRVVAHLIQPFMMTTSNTIMEQLGL-GSDFDLENLTLAGFPEGVKVVAKGTPIFPRLDME 525
>gi|28377354|ref|NP_784246.1| methionine--tRNA ligase [Lactobacillus plantarum WCFS1] >gi|38258344|sp|Q88Z97|SYM_LACPL Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|28270186|emb|CAD63085.1| methionine--tRNA ligase [Lactobacillus plantarum WCFS1] (683 aa)
Score = 1029, Expect = 2.4e-109, Identities = 212/521 (40%), Positives = 312/521 (59%)
  Q:   565 GEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN-FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLI--LNAVKRVIYYL-EPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD----NQKINTPEPIYLRIESE 1085
            E    +YITTPIYYPSG  HIG+++TT+  D L RYK+ +GY+ +F+TG DEHG KIEEKA++LN  P+  VD  AK   +LW+LL I    FIRTT +YH+  VQE F  LLK   IYLG ++G Y V  EE +T+     V ++++ K+   +    H +   +E+SYF K+ ++  ++  + +  P+ + P  R+ E+ N+F+     +DL++SR++F+WG+ +K +PKHVVYVW+DAL NY++ LGY   D  + F KFW +     VQ++ KEI RFH IYWPI+L  LGL  P K   HGW++ + GKMSKS GNV+ P   +  YG DA RYYL+K +    D +F+ +  +   N DLAN++GNL NR+I MINKY DG +P +      F+ + E             ++ L++   L+ V  L++  N +I++  PW L K ++  D D   S++  L A  RVI  L  PV+    KE   Q  +D +   I    D    D     Q +    PI+ R++ +
  S:     2 AETKPTYYITTPIYYPSGKLHIGNSYTTIACDTLARYKRAMGYDVYFLTGTDEHGLKIEEKAEKLNTDPKSYVDGMAKQIKDLWQLLEISNDKFIRTTDDYHERAVQEIFDRLLKNGDIYLGEYEGWYSVDDEEYFTETQLAEVFRDDNGKVIGGKAPSGHEVELVKEQSYFFKMSKYADWLLDYYQSHPDFIEPANRMTEMINNFIK-PGLEDLAVSRTSFTWGVPVKSDPKHVVYVWIDALTNYITALGYATGDSEDLFNKFWPAD----VQMVGKEIVRFHTIYWPIILHALGLPLPKKVFGHGWLLMKDGKMSKSKGNVIYPETLVERYGLDALRYYLVKAMPYGNDGLFTPEDFVARVNYDLANDLGNLLNRTIAMINKYEDGQLPAFKAGVTEFDADLEATAATTIKNFNACMDSLHLSDALAEVWKLVSRTNKYIDETAPWQLAKSDDANDADKLASVMAHLAASLRVIASLISPVMTHAPKEIFTQLGLDPATLAI---ADLQLADLPAGAQVVAKGTPIFPRVDMD 528
>gi|146321108|ref|YP_001200819.1| methionyl-tRNA synthetase [Streptococcus suis 98HAH33] >gi|145691914|gb|ABP92419.1| Methionyl-tRNA synthetase [Streptococcus suis 98HAH33] (667 aa)
Score = 1029, Expect = 2.5e-109, Identities = 206/517 (39%), Positives = 317/517 (61%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKIEEKAKE  L PQ  VD  A     LW LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++      R EN           H +    EESYFL++ +++ K +  F   P+ + P  R+NE+  +F+     +DL++SR++F+WG+ +  NPKHVVYVW+DALLNY + LGY Q++  N+ KFWN     +  ++ K+I RFH IYWPIML ML ++ P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  ++  N +LAN++GNL NR++ MINKY  G +P +      F+ +    +          +E ++  + L  V ++I+  N +I++  PW L K+  ++D L   ++ +   ++ V + ++P ++  S   ++Q  + ++ FD++ + DF+ L      +    PI+ R++ E++
  S:     6 FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIEEKAKEAGLTPQAYVDGMAVGVKELWNLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGKVTGGIAPSGHEVAWVSEESYFLRLSKYQDKLVEFFNAHPDFIQPAGRLNEIMKNFI-EPGLEDLAVSRTSFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQEETVNYDKFWN---GTVYHMVGKDILRFHSIYWPIMLMMLDMKLPDRLVAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVDRINYELANDLGNLLNRTVAMINKYFGGQVPTFVANVTDFDADLAAVVADNLASYHKYMEAVDYPRALEAVWNIISRTNKYIDETAPWVLAKDEADRDKLAAVMAHLTAGLRVVAHLIQPFMMTTSNAIMEQLGLGTA-FDLENL-DFAGLPAGLTVVAKGTPIFPRLDMEEE 525
>gi|15923480|ref|NP_371014.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926167|ref|NP_373700.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|156978818|ref|YP_001441077.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|54039687|sp|P67579|SYM_STAAN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|54042047|sp|P67578|SYM_STAAM Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|13700380|dbj|BAB41678.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|14246258|dbj|BAB56652.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|156720953|dbj|BAF77370.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] (657 aa)
Score = 1029, Expect = 2.7e-109, Identities = 219/517 (42%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT--------PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+   + T        P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSE 525
>gi|56807711|ref|ZP_00365584.1| COG0143: Methionyl-tRNA synthetase [Streptococcus pyogenes M49 591] (666 aa)
Score = 1029, Expect = 2.9e-109, Identities = 206/519 (39%), Positives = 318/519 (61%)
  Q:   567 VMKK-FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +MKK F ITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKI+ KAKE  + PQ  VD  AK    LW+LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++    V ++ D ++        H +    EESYFL++ ++   + +F K+  + + P  R+NE+  +F+     +DL++SR+ F+WG+ +  +PKHVVYVW+DALLNY + LGY Q + +NF KFWN     +  ++ K+I RFH IYWPI+L ML L  P + I+HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y     +F+ +  + +     +    +E ++  + L  V  +I   N +I++  PW L KE+ +K  L   ++ +  +++ V + ++P +++ S   + Q  +   S      + DF + + + +    PI+ R++ E
  S:     1 MMKKPFTITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGISPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYADRLVAFFKERSDFIQPDGRMNEMVKNFI-EPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDALLNYATALGYGQANHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRVVAHVIQPFMMETSAAIMAQLGLAPVSDLSTLALADFPA-NTKVVAKGTPIFPRLDME 523
>gi|21282174|ref|NP_645262.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49485354|ref|YP_042575.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|25009356|sp|Q8NY00|SYM_STAAW Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|60390700|sp|Q6GBZ8|SYM_STAAS Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|21203610|dbj|BAB94310.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49243797|emb|CAG42222.1| putative methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] (657 aa)
Score = 1028, Expect = 3.2e-109, Identities = 219/517 (42%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT--------PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+   + T        P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSE 525
>gi|148266948|ref|YP_001245891.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150392994|ref|YP_001315669.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|147740017|gb|ABQ48315.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149945446|gb|ABR51382.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] (657 aa)
Score = 1027, Expect = 3.9e-109, Identities = 218/517 (42%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT--------PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F ++W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+   + T        P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNRYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSE 525
>gi|82750197|ref|YP_415938.1| methionyl-tRNA synthetase [Staphylococcus aureus RF122] >gi|82655728|emb|CAI80127.1| ethionyl-tRNA synthetase [Staphylococcus aureus RF122] (657 aa)
Score = 1027, Expect = 4.5e-109, Identities = 220/517 (42%), Positives = 314/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT--------PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I MINKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+   + T        P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISSLGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLTESIMVTGQPKPIFPRLDSE 525
>gi|56961843|ref|YP_173565.1| methionyl-tRNA synthetase [Bacillus clausii KSM-K16] >gi|56908077|dbj|BAD62604.1| methionyl-tRNA synthetase [Bacillus clausii KSM-K16] (655 aa)
Score = 1027, Expect = 4.5e-109, Identities = 209/519 (40%), Positives = 314/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENY------------TKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYL-EPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIGH +TT+  D + RYK+  GY+  ++TG DEHGQKIE+KAKE  + P E  ++  K    LWK L I +  FIRTT + H N+V++ F +L+++  IYLG ++G YCVS E  Y            + NI   K  D        HP+ +  E+SYF ++ ++   + +F ++ P+ + P +R NE+ N+F+      DL++SR++F+WG+++  NPKHVVYVW+DAL NY++ LGY   DD+ +QK+W +     V L+ K+I RFH IYWPIML  L L  P K   HGW +T+ GKMSKS GNV+DP   I+ +G DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MINKY +G IP Y K    F+ +    ++    ++   +E++     L+ +  L++  N +I++ +PW L KE + ++L   +   L    R+I  L  P +     +   Q  ID S    + +  F  L    K++  EP++ R++ E +
  S:     4 KTFYITTPIYYPSGKLHIGHTYTTVAGDAMARYKRLRGYDVRYLTGTDEHGQKIEQKAKEKGISPLEYTNEMVKPIKELWKKLDISHDDFIRTTEKRHTNMVEKIFEQLVEQGDIYLGEYEGWYCVSDETFYGERELVDPIKDESGNIIGGKSPDSG------HPVEKVREKSYFFRMSKYADRLLAFYEENPDFIQPASRKNEMINNFIK-PGLQDLAVSRTSFTWGVKVPSNPKHVVYVWIDALTNYITALGYGTADDTLYQKYWPAD----VHLVGKDILRFHTIYWPIMLMALDLPLPKKVFGHGWFLTKDGKMSKSKGNVVDPAPLIDHFGLDAIRYYLLREVPFGADGVFTPEAFVERVNYDLANDLGNLLNRTVAMINKYFNGEIPAYVKSASPFDEDLLDLVQATITKVEDAMEEMEFSIALAAIWQLVSRTNKYIDETQPWMLAKEEDNRELLGSVMYHLAESLRIISVLIRPFMTRTPAKIWAQLGIDESLAGWESIRVFGQLPAGTKVSKGEPVFPRLDVEKE 526
>gi|57651372|ref|YP_185421.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|88194248|ref|YP_499040.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220665|ref|YP_001331487.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|81695187|sp|Q5HII6|SYM_STAAC Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|57285558|gb|AAW37652.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87201806|gb|ABD29616.1| methionyl-tRNA synthetase, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373465|dbj|BAF66725.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] (657 aa)
Score = 1024, Expect = 9.5e-109, Identities = 220/517 (42%), Positives = 315/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-----NQKI---NTPEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+     N+ I     P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLNESIMVTGQPKPIFPRLDSE 525
>gi|78044237|ref|YP_361414.1| methionyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996352|gb|ABB15251.1| methionyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] (653 aa)
Score = 1024, Expect = 1.0e-108, Identities = 212/517 (41%), Positives = 310/517 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           K FYITTPIYYPS N HIGHA+TT+ AD + R+K+  GY+ +F+TG DEHGQKIE KAK   L P+E VD     F +LWKLL I Y  FIRTT E HK VVQ  F +L  +  IY   ++G YC  CE  +T+   +  +  D   C +  P+    EESYF K+ ++  + +    ++P  + P +R NE+ N F+     +DL +SR+ F+WGI +  + KHVVYVW+DAL NY+S LGY   DD  FQK+W +     V L+ K+I RFH + WPI+L  LG+  P K + HGW + E GKMSKS GNV+DP+  +  YG DA RY+L++E+ L  D+V+SE+ LIN  N DLAN++GNL NR++ M+ K+  G IP  S+ +   + E  +       E   +++K ++   L+ +  L+   N +I++V PW L KE   + L   L ++L   + +   L+PV+ +   +   Q  + D S F  + ++++  L    KI   EP++ R++ E
  S:     3 KSFYITTPIYYPSDNLHIGHAYTTVAADTMARFKRMTGYDVWFLTGSDEHGQKIERKAKSQGLSPKEYVDPIVDSFKHLWKLLDISYDDFIRTTEERHKKVVQAIFQKLYDQGDIYKSAYEGWYCTPCEAFWTEGKLIDGKCPD---CGR--PVEWTREESYFFKMSKYADRLLKHIEENPEFIVPESRRNEMIN-FIKQ-GLEDLCVSRTTFNWGIPVPFDKKHVVYVWVDALTNYISALGYGTDDDHLFQKYWPAD----VHLVGKDIVRFHTVIWPIILLALGIELPKKVVGHGWFVLEGGKMSKSKGNVVDPVKLVEKYGVDAVRYFLVREMPLGLDAVYSEEALINRINVDLANDLGNLLNRTLSMLEKFLGGEIPLPSEYE-EIDREVIELALALPAETEKLMDKFDLAGALANIWRLVTRLNKYIDEVAPWSLNKEGKIERLKTVLYVVLEGYRFITVLLKPVMPNFPAKVSAQLGVNDESLFTWESLSNWGRLPAGVKIKKGEPLFPRLDPE 510
>gi|194467624|ref|ZP_03073611.1| methionyl-tRNA synthetase [Lactobacillus reuteri 100-23] >gi|194454660|gb|EDX43557.1| methionyl-tRNA synthetase [Lactobacillus reuteri 100-23] (675 aa)
Score = 1023, Expect = 1.2e-108, Identities = 205/513 (39%), Positives = 326/513 (63%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI---DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYYPSG  HIG+++TT+  D   R+K+ +GY+ F++TG DEHG KIE+KA++L +KPQE VD+ A     LWK L I    FIRTT +YH+  VQ+ F +LL +  IY G + G Y V  EE +T++    V ++ D  +   +    H +   EEESYF K+ ++  ++ ++ K+ P+ + P +R+NE+ N+FL     +DL+++R++F+WG+++  +PKHVVYVW+DAL NY++ LGY   DDS F+K+W +     V ++ KEI RFH IYWPIML  LGL  P   I HGW+    GKMSKS GNV+ P   ++ YG DA RYYLL+ +    D VFS +  ++  N DLAN++GNL NR++ MINKY++G +   +     F+ + E+       E   +++K    + L+ V  L++  N +I++ +PW L K++++KD L   ++ +  +++ +   ++P++ +  K+ ++Q  I   D S  D++F  DF + + Q +    PI+ R++
  S:     8 YYITTPIYYPSGKLHIGNSYTTIACDAEARFKRLMGYDVFYLTGTDEHGLKIEQKAEKLGMKPQEYVDQMAAQIKELWKKLEITNDKFIRTTDDYHEKAVQKIFQQLLDQGDIYKGKYTGWYSVDDEEYFTESQLAEVYRDEDGNVIGGKAPSGHEVQLVEEESYFFKMSKYADWLMNYYKEHPDFIEPQSRMNEMINNFLK-PGLEDLAVTRTSFTWGVKVPSDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPAD----VHMVGKEIVRFHTIYWPIMLHALGLPLPKHIIGHGWLTMRDGKMSKSKGNVIYPETLVDRYGLDATRYYLLRAMPFGNDGVFSPEDFVDKVNYDLANDLGNLLNRTVAMINKYQNGKLLGTNDATTDFDADLEQTASDVIAEYKELMDKTRFAEALAAVWKLVSRANKYIDETEPWVLAKDDSKKDVLSDVMTHLAKSLRIIAALIQPIMPNAPKQIVEQLGIEGTDLSLTDLQF-NDFPA-EAQVVAKGTPIFPRLD 523
>gi|87162044|ref|YP_493176.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|161508736|ref|YP_001574395.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728132|ref|ZP_02760409.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87128018|gb|ABD22532.1| methionyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|160367545|gb|ABX28516.1| methionine--tRNA ligase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (657 aa)
Score = 1023, Expect = 1.2e-108, Identities = 220/517 (42%), Positives = 315/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-----NQKI---NTPEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+       LW  L I    FIRTT E HK+VV++ F  LLK+  IYLG ++G Y V  E  YT++  V  + ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+      DL++SR++F+WG+ +  NPKHVVYVW+DAL+NY+S LGY   D+S F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  P    + E E    +     T  +E L     LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  +Q NI++ +F      +FSSL+     N+ I     P+PI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKSGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIK-PGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQF-----MEFSSLEQYGVLNESIMVTGQPKPIFPRLDSE 525
>gi|116627343|ref|YP_819962.1| methionyl-tRNA synthetase [Streptococcus thermophilus LMD-9] >gi|116100620|gb|ABJ65766.1| methionyl-tRNA synthetase [Streptococcus thermophilus LMD-9] (667 aa)
Score = 1018, Expect = 4.6e-108, Identities = 195/485 (40%), Positives = 307/485 (63%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFW-NSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKEN-NEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           + K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ + Y+ F++TG+DEHGQKI+++A+E  + PQE VD  A    +LW+LL I Y  FIRTT +YH+ VV + F  LL+K  IYLG + G Y VS EE +T++       D++           H +    EESYF K+  +   +++F K+ P  + P  R+NE+  +F+     +DL++SR+ F+WG+++  +PKHVVYVW+DAL+NY++ LGY Q +  NF  FW N ++ EI+ ++ K+I RFH IYWPI+L  L L  PT+ ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y +    F+ +  K + +  +E    +  ++  + L  V ++I+  N +I++  PW L KE+ +E+ L   ++ +  +++ V + ++P ++  S   ++Q  +
  S:     1 MTKTFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQRAEEAGITPQEYVDSMAVDVKDLWQLLDISYDKFIRTTDDYHEKVVAQVFERLLEKGDIYLGEYSGWYSVSDEEFFTESQLAEVYRDEEGNVIGGVAPSGHEVELVSEESYFFKLSNYADRLTAFYKEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTFTWGVKVPSDPKHVVYVWIDALINYITALGYGQNEHGNFDLFWQNDKNHEIIHMIGKDILRFHSIYWPIILMALDLPLPTRLVAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYLARINYELANDLGNLLNRTVAMINKYFDGQVPAYIENVTDFDADLAKVVAENIEEFHKQMNAVDFPRALDAVWNIISRTNKYIDETAPWVLAKEDGDEEQLRAVMAHLAASLRVVAHLIQPFMMSTSNAIMEQLGL 492
>gi|55822425|ref|YP_140866.1| methionyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] >gi|55738410|gb|AAV62051.1| methionyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] (667 aa)
Score = 1018, Expect = 4.8e-108, Identities = 195/485 (40%), Positives = 307/485 (63%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFW-NSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKEN-NEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           + K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ + Y+ F++TG+DEHGQKI+++A+E  + PQE VD  A    +LW+LL I Y  FIRTT +YH+ VV + F  LL+K  IYLG + G Y VS EE +T++       D++           H +    EESYF K+  +   +++F K+ P  + P  R+NE+  +F+     +DL++SR+ FSWG+++  +PKHVVYVW+DAL+NY++ LGY Q +  NF  FW N ++ EI+ ++ K+I RFH IYWPI+L  L L  PT+ ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y +    ++ +  K + +  +E    +  ++  + L  V ++I+  N +I++  PW L KE+ +E+ L   ++ +  +++ V + ++P ++  S   ++Q  +
  S:     1 MTKTFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQRAEEAGITPQEYVDSMAVGVKDLWQLLDISYDKFIRTTDDYHEKVVAQVFERLLEKGDIYLGEYSGWYSVSDEEFFTESQLAEVYRDEEGNVIGGVAPSGHEVELVSEESYFFKLSNYADRLTAFYKEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTFSWGVKVPSDPKHVVYVWIDALINYITALGYGQNEHGNFDLFWQNDKNHEIIHMIGKDILRFHSIYWPIILMALDLPLPTRLVAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYLARINYELANDLGNLLNRTVAMINKYFDGQVPAYIENVTDYDADLAKVVAENIEEFHKQMNAVDFPRALDAVWNIISRTNKYIDETAPWVLAKEDGDEEQLRAVMAHLAASLRVVAHLIQPFMMSTSNAIMEQLGL 492
>gi|163764881|ref|ZP_02171933.1| recombination protein RecR [Bacillus selenitireducens MLS10] >gi|160354658|gb|EDP81319.1| recombination protein RecR [Bacillus selenitireducens MLS10] (675 aa)
Score = 1018, Expect = 5.1e-108, Identities = 208/517 (40%), Positives = 311/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQK--INTPEPIYLRIESEDK 1087
           FYITTPIYYPS   HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKIE+KA+E    PQ+ VD  +     LWK L I Y  FIRTT + HK VVQ  F   L++  IYL  ++G Y VS E  YT+     KE DD             HP+ +  E+SYF K+ ++   + ++ +D P  + P +R NE+ N+F+     +DL++SR++F WG+ +K +P+HVVYVW+DAL NY++ LGY   ++  FQ  W +     V L+ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+DP+  I  YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NRS+ MINKY DG +P Y K   S++      ++   +++   +E +     L+ +  LI+  N +I++ +PW L K+   ++ L   L  ++ ++++V   L+P + +  K+  +Q +I  S      +  F  +   K  +   EPI+ R+++E++
  S:    21 FYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIEQKAEENGKSPQQFVDDISSDIQELWKKLDISYDDFIRTTEDRHKQVVQHIFERFLEQGDIYLDEYEGWYSVSDETFYTELQLEDKEYDDNGNVTGGKSPDSGHPVEKVREKSYFFKMSKYADRLLAYYEDNPEFIQPESRKNEMINNFIK-PGLEDLAVSRTSFRWGVPVKSDPEHVVYVWIDALSNYITALGYSTDENGLFQSHWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIERYGLDALRYYLLREVPFGSDGVFTPEGFVERVNYDLANDLGNLLNRSVAMINKYFDGEVPAYVKDATSYDETLTDLVEATVNKVEESMENMQFSVALTAIGQLISRTNKYIDETQPWILAKDETAREQLGSVLHHLVESLRQVSIMLQPFMTETPKKIQEQLSIPDSLMGWDTLVTFGQIPAGKKVVAKGEPIFPRLDTEEE 542
>gi|81096866|ref|ZP_00875193.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Streptococcus suis 89/1591] >gi|80977088|gb|EAP40644.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Streptococcus suis 89/1591] (667 aa)
Score = 1018, Expect = 5.2e-108, Identities = 206/517 (39%), Positives = 315/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G+E F++TG+DEHGQKIEEKAKE  L PQ  VD  A     LW LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++      R EN           H +    EESYFL++ +++ K +  F   P+ + P  R+NE+  +F+     +DL++SR++F+WG+ +  NPKHVVYVW+DALLNY + LGY Q++  N+ KFWN     +  ++ K+I RFH IYWPIML ML ++ P   ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY  G +P +      F+ +    +          +E ++  + L  V ++I+  N +I++  PW L K+  ++D L   ++ +   ++ V + ++P ++  S   ++Q  + ++ FD++ + DF+ L      +    PI+ R++ E++
  S:     6 FYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIEEKAKEAGLTPQAYVDGMAVGVKELWNLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGKVTGGIAPSGHEVAWVSEESYFLRLSKYQDKLVEFFNAHPDFIQPDGRMNEIMKNFI-EPGLEDLAVSRTSFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQEETINYDKFWN---GTVYHMVGKDILRFHSIYWPIMLMMLDMKLPDLLVAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFSGQVPTFVANVTDFDADLAAVVADNLASYHKYMEAVDYPRALEAVWNIISRTNKYIDETAPWVLAKDEADRDKLAAVMAHLTAGLRVVAHLIQPFMMTTSNAIMEQLGLGTA-FDLENL-DFAGLPAGLTVVAKGTPIFPRLDMEEE 525
>gi|148543447|ref|YP_001270817.1| methionyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|184152856|ref|YP_001841197.1| methionyl-tRNA synthase [Lactobacillus reuteri F275] >gi|148530481|gb|ABQ82480.1| methionyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|183224200|dbj|BAG24717.1| methionyl-tRNA synthase [Lactobacillus reuteri F275] (675 aa)
Score = 1016, Expect = 7.7e-108, Identities = 206/513 (40%), Positives = 326/513 (63%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIY----YLEPVLIDGSKEALKQFNI---DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYYPSG  HIG+++TT+  D   R+K+ +GY+ F++TG DEHG KIE+KA++L +KPQE VD+ A     LWK L I    FIRTT +YH+  VQ+ F +LL +  IY G + G Y V  EE +T++    V ++ D  +   +    H +   EEESYF K+ ++  ++ ++ K+ P+ + P +R+NE+ N+FL     +DL+++R++F+WG+++  +PKHVVYVW+DAL NY++ LGY   DDS F+K+W +     V ++ KEI RFH IYWPIML  LGL  P   I HGW+    GKMSKS GNV+ P   ++ YG DA RYYLL+ +    D VFS +  ++  N DLAN++GNL NR++ MINKY++G +   +     F+ + E+       E   +++K    + L+ V  L++  N +I++ +PW L K++++KD+   LS ++  + + ++     ++P++    K+ ++Q  I   D S  D++F  DF + + Q +    PI+ R++
  S:     8 YYITTPIYYPSGKLHIGNSYTTIACDAEARFKRLMGYDVFYLTGTDEHGLKIEQKAEKLGMKPQEYVDQMAAQIKELWKKLEITNDKFIRTTDDYHEKAVQKIFQQLLDQGDIYKGKYTGWYSVDDEEYFTESQLAEVYRDEDGNVIGGKAPSGHEVQLVEEESYFFKMSKYANWLMNYYKEHPDFIEPQSRMNEMINNFLK-PGLEDLAVTRTSFNWGVKVPSDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPAD----VHMVGKEIVRFHTIYWPIMLHALGLPLPKHIIGHGWLTMRDGKMSKSKGNVIYPETLVDRYGLDATRYYLLRAMPFGNDGVFSPEDFVDKVNYDLANDLGNLLNRTVAMINKYQNGKLVGTNDATTDFDADLEQTASDVIAEYKELMDKTRFAEALATVWKLVSRANKYIDETEPWVLAKDDSKKDV---LSDVMTHLAKSLWIIAALIQPIMPHAPKQIVEQLGIEGTDLSLTDLQF-NDFPA-EAQVVAKGTPIFPRLD 523
>gi|15612616|ref|NP_240919.1| methionyl-tRNA synthetase [Bacillus halodurans C-125] >gi|25009402|sp|Q9KGK8|SYM_BACHD Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|10172665|dbj|BAB03772.1| methionyl-tRNA synthetase [Bacillus halodurans C-125] (660 aa)
Score = 1016, Expect = 7.9e-108, Identities = 203/519 (39%), Positives = 313/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKE--NDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESEDK 1087
           K FY+TTPIYYPS   HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKIE+KA+   L P++ VD+      +LWK L I Y  FIRTT E H  VVQ+ F +LL +  IYLG ++G Y +  E  YT+   V KE   D  L   +     HP+ +  E+SYF ++ ++   +  F ++ P  + P +R NE+ N+F+     +DL++SR++F+WG+ +  +PKHVVYVW+DAL NY++ LGY       ++ +W +     V L+ KEI RFH IYWPIML  L L  P K   HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI KY DG IP Y K    F+ +  + +     ++   +E++     L+ +  LI+  N +I++ +PW L K+ ++++ L   +  +  +++ V   L+P +    ++  +Q  IDSS    + +  F  +  N  +   +P++ R++ E++
  S:     6 KTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYNVMYLTGTDEHGQKIEQKAEAKGLTPKQFVDEIVSGIQDLWKKLDISYDDFIRTTEERHIKVVQQIFEQLLDQGDIYLGDYEGWYSIPDETFYTETQLVDKEYDADGNLIGGKSPDSGHPVEKVREQSYFFRMSKYADRLLQFYEENPQFIQPESRKNEMINNFIK-PGLEDLAVSRTSFTWGVPVPRDPKHVVYVWIDALSNYITALGYGSDQQEKYENYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIDRYGLDALRYYLLREVPFGSDGVFTPEAFVERVNYDLANDLGNLLNRTVAMIEKYFDGKIPSYVKDGTPFDADLVELVYSTVKKVEDAMEEMEFSIALTAIGQLISRTNKYIDETQPWVLAKDESKREQLGAAMYHLAESIRYVSVLLQPFMTKAPQKIWEQLGIDSSLTTWESLETFGQIPGNTNVQKGQPLFPRLDVEEE 528
>gi|55820534|ref|YP_138976.1| methionyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] >gi|55736519|gb|AAV60161.1| methionyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] (667 aa)
Score = 1016, Expect = 9.4e-108, Identities = 194/485 (40%), Positives = 307/485 (63%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFW-NSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKEN-NEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           + K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ + Y+ F++TG+DEHGQKI+++A+E  + PQE VD  A    +LW+LL I Y  FIRTT +YH+ VV + F  LL+K  IYLG + G Y VS EE +T++       D++           H +    EESYF K+  +   +++F K+ P  + P  R+NE+  +F+     +DL++SR+ F+WG+++  +PKHVVYVW+DAL+NY++ LGY Q +  NF  FW N ++ EI+ ++ K+I RFH IYWPI+L  L L  PT+ ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG +P Y +    ++ +  K + +  +E    +  ++  + L  V ++I+  N +I++  PW L KE+ +E+ L   ++ +  +++ V + ++P ++  S   ++Q  +
  S:     1 MTKTFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQRAEEAGITPQEYVDSMAVGVKDLWQLLDISYDKFIRTTDDYHEKVVAQVFERLLEKGDIYLGEYSGWYSVSDEEFFTESQLAEVYRDEEGNVIGGVAPSGHEVELVSEESYFFKLSNYADRLTAFYKEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTFTWGVKVPSDPKHVVYVWIDALINYITALGYGQNEHGNFDLFWQNDKNHEIIHMIGKDILRFHSIYWPIILMALDLPLPTRLVAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYLARINYELANDLGNLLNRTVAMINKYFDGQVPAYIENVTDYDADLAKVVAENIEEFHKQMNAVDFPRALDAVWNIISRTNKYIDETAPWVLAKEDGDEEQLRAVMAHLAASLRVVAHLIQPFMMSTSNAIMEQLGL 492
>gi|187605633|ref|ZP_02991824.1| methionyl-tRNA synthetase [Exiguobacterium sp. AT1b] >gi|187482330|gb|EDU20343.1| methionyl-tRNA synthetase [Exiguobacterium sp. AT1b] (653 aa)
Score = 1015, Expect = 1.1e-107, Identities = 199/511 (38%), Positives = 298/511 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR 1081
           FYITTPIYYPS   HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKI+EKAKE  + PQ  VD+  +    LW  L I Y  +IRTT + HK VV+  F  LLK   IYLG ++G Y V  E  YT++  V  ++ D       HP+    EE YF ++ ++  + I  F   P+ + P +R  E+ N+FL      DL++SR+ F WG+Q+  NPKHVVYVW+DAL NY+S LGY   +D  F ++W +     V L+ KEI RFH I WP +L  L L  P +  +HGW++ + GKMSKS GNV+DPI  I+ YG D+ RYYLL+E+    D  F+ +  ++  N DLAN++GNL NR+I MI KY DG IP Y+    +F+ E    +K+   +    +E +     L+ +  L++  N +I++ +PW L K+E+  ++L   ++ +   ++ V   ++P +    KE  +Q  ++      + +  F+   +  +    PI+ R
  S:     6 FYITTPIYYPSAKLHIGHAYTTVAGDAIARYKRLKGFDVRYLTGTDEHGQKIQEKAKEAGVTPQAFVDEVVEEIKVLWDRLEISYDDYIRTTEDRHKKVVEHVFETLLKNGDIYLGEYEGWYSVPDETYYTESQLVDGKSPD-----SGHPVELVREECYFFRLSKYADRLIEYFESHPDFILPESRKTEMINNFLK-PGLQDLAVSRTTFDWGVQVPSNPKHVVYVWVDALTNYISSLGYGTDNDELFNRYWPAD----VHLVGKEIVRFHTIIWPALLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPIPLIDRYGLDSVRYYLLREVPFGADGTFTPEAFVDRLNFDLANDLGNLLNRTIAMIKKYFDGNIPAYNGNVTAFDAELLNVVKETTRKTEEAMEHMEFSVALTNIWQLVSRANKYIDETQPWVLVKEESKREELASVMTHLAGVLRHVAIMIQPFMTRAPKEMFRQLGLEGEDMSWEALDTFADFSDAVVTDGTPIFPR 508
>gi|70727520|ref|YP_254436.1| methionyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] >gi|82582279|sp|Q4L3E7|SYM_STAHJ Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|68448246|dbj|BAE05830.1| methionyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] (659 aa)
Score = 1012, Expect = 2.4e-107, Identities = 215/517 (41%), Positives = 311/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK-FDIKFVTDFSSLDNQKINT--PEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA++T+  DV++RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+      +LW  L I    FIRTT + HK VV++ F  LLK+  IYLG ++G Y V  E  YT++  V    ++        P    E     EESYF  I ++   +  F   +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHVVYVW+DAL+NY+S LGY   DD  FQK+W +     V LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I MINKY  G +P Y  PK   + + E    +        +E       LS V   I+  N +I++  PW L K++++KD L   ++ ++  ++     L P L    KE  KQ NI+  + F+++ +  + +L    + T  P PI+ R+++E
  S:     4 ETFYITTPIYYPSGNLHIGHAYSTVAGDVISRYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTELEYLDEMISGIKSLWSKLEISNDDFIRTTEDRHKQVVEKVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPIYENGKIVGGKSPDSGHEVELVKEESYFFNINKYTDRLLEFYDANPDFIQPPSRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDALVNYISALGYLSDDDELFQKYWPAD----VHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLANDLGNLVNRTISMINKYFQGELPAYEGPKHELDEDMEALAHETVKHFNESMESFQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRFAAVLLRPFLTHAPKEIFKQLNINEPELFELESLEQYGALKQPIMVTEKPTPIFPRLDTE 525
>gi|90961208|ref|YP_535124.1| methionyl-tRNA synthetase / protein secretion chaperonin CsaA [Lactobacillus salivarius UCC118] >gi|90820402|gb|ABD99041.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA [Lactobacillus salivarius UCC118] (675 aa)
Score = 1012, Expect = 2.7e-107, Identities = 213/517 (41%), Positives = 319/517 (61%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQ-KDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFE----KQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIG+++TT+  DVL RYK+  GY+ FF+TG DEHG KIE+KA+ L ++PQE VDK A     LWK L I    FIRTT +YH+  VQ  F +LL K  IYLG ++G Y VS EE +T++    V ++ D  +   +    H +   EE+ YF K+ ++  + +  + + P+ + P TR NE+ N+F+     +DL+++R++F+WG+++  NP+HVVYVW+DAL NY++ LGY    DDS F+K+W +     V ++ KEI RFH IYWPI+L  L L  P   I HGW++   GKMSKS GNV+ P   +  YG DA RYYL+  +    D VF+ +  I   N DLAN++GNL NR++ MINKYR G IP+      +F+ + E      +K F++++ ++    +    L  V  L+   N +I++ +PW L K+  +KD LD  L+ +  +++ V   ++PV+    KE   Q  ++S    I+ V+ F      Q +    PI+ R++ E++
  S:     7 FYITTPIYYPSGKLHIGNSYTTIACDVLARYKRLQGYDVFFLTGTDEHGLKIEQKAQALGMQPQEYVDKMAADIKELWKKLEITNDKFIRTTDDYHEKAVQNIFEKLLAKGDIYLGKYRGWYSVSDEEYFTESQLAEVYRDEDGNMIGGKAPSGHEVQLVEEDCYFFKMSKYADRLVKYYEEHPDFIIPDTRKNEMLNNFI-KPGLEDLALTRTSFNWGVKVPSNPEHVVYVWIDALCNYITALGYETGDDDSLFKKYWPAD----VHMVGKEIVRFHTIYWPIILMALDLPLPKHIIGHGWLLMRDGKMSKSKGNVVYPEMIVERYGLDALRYYLMIAVPFGNDGVFTPEDFIGKINFDLANDLGNLLNRTVAMINKYRGGQIPELKSGVTAFDKDLEDVAANTIKNFEEQMDSV----HFSNALDEVWKLVARSNKYIDETEPWILAKDETKKDELDSVLAHLAASLRLVAILIQPVMTHTPKEIFAQLGLNSDDMAIQGVSYFDLPAGAQVVAKGTPIFPRLDVEEE 527
>gi|77411392|ref|ZP_00787739.1| methionyl-tRNA synthetase [Streptococcus agalactiae CJB111] >gi|77162565|gb|EAO73529.1| methionyl-tRNA synthetase [Streptococcus agalactiae CJB111] (665 aa)
Score = 1011, Expect = 2.9e-107, Identities = 200/519 (38%), Positives = 323/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G++  ++TG+DEHGQKI++KA+E  + PQE VD  A+    LW+LL I Y  FIRTT  YH+  V + F +LL +  IYLG + G Y VS EE +T++      R EN + +       H + +  EESYF ++ ++   + ++  + P  + P  R+NE+  +F+     +DL++SR+ ++WG+Q+  NPKHV+YVW+DAL+NY+S LGY   DD S + KFW +     + ++ K+I RFH IYWPIML  L L  P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR+I M+NKY DG +P+++     F+ +         +     +E ++  + L  V +LI+  N +I++  PW L K+  ++D L+  +S +  +++ V + ++P +++ S   ++Q  + ++ FD++ +T F+ L    + +    PI+ R++ ED+
  S:     5 KSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIYLGEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPAD----IHMIGKDILRFHSIYWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVAT-DFDADLASVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLEAVMSHLAASLRVVAHLIQPFMMETSDAIMEQLGLGTT-FDLEKLT-FAGLPEGVRVVAKGSPIFPRLDMEDE 525
>gi|81429270|ref|YP_396271.1| methionyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|78610913|emb|CAI55965.1| Methionyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] (681 aa)
Score = 1011, Expect = 3.1e-107, Identities = 200/482 (41%), Positives = 301/482 (62%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID 1052
           FY+TTPIYYPSG   IG+++TT+ ADV+ RYK+ +G++ FF+TG DEHG K+E+KA E NL PQ  VD  A+    LWK L I    FIRTT +YH   VQ+ F  L+++  IYLG ++G Y VS EE +T++    V K+ + K+   +    H + +  EE+Y  K+ ++   + ++ ++  + + P +R NE+ N+F+     +DLS+SR +F WGI +  NPKHVVYVWLDAL NY++ LGY   DD  F K+W +     V L+ KEI RFH IYWPI L  LGL  P +   HGW++ + GKMSKS GNV+ P   +  YG DA RYYL++ +    D VF+ +  ++  N DLAN++GNL NR++ MINKY DG +P Y     +F+ + +    Q   + +T++++L     L  +  LI+  N +I++ +PW L K+++ K +LD  L+ +  +++ V   L+PV+    +E   Q  +D
  S:     8 FYVTTPIYYPSGKLTIGNSYTTIAADVIARYKRLMGFDVFFLTGTDEHGLKLEQKAAEKNLAPQAYVDGMAEEIQALWKTLEISNDKFIRTTDDYHVKAVQKIFDRLVEQGDIYLGQYEGWYSVSDEEYFTESQLTEVYKDENGKVIGGKAPSGHEVQRVAEETYKFKMSKYADRLLAYYEEHADFIEPSSRKNEMINNFIK-PGLEDLSVSRISFDWGIHVTGNPKHVVYVWLDALSNYITALGYGSDDDQLFNKYWPAD----VHLVGKEIVRFHAIYWPIFLMALGLPLPKQIFGHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLMRAIPFGNDGVFTPEDFVSRINYDLANDLGNLLNRTVAMINKYDDGHVPSYQADVTAFDADLQATATQTIAQYSTLMDQLKFSDALDTIWQLISRANKYIDETEPWVLAKDDSRKAELDSVLAHLAESLRIVALLLQPVMTHAPREMFAQLGLD 491
>gi|22537699|ref|NP_688550.1| methionyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|25011651|ref|NP_736046.1| methionyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|76788328|ref|YP_330181.1| methionyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|77413421|ref|ZP_00789613.1| methionyl-tRNA synthetase [Streptococcus agalactiae 515] >gi|22534588|gb|AAN00423.1|AE014263_2 methionyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|24413191|emb|CAD47270.1| methionyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|76563385|gb|ABA45969.1| methionyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|77160515|gb|EAO71634.1| methionyl-tRNA synthetase [Streptococcus agalactiae 515] (665 aa)
Score = 1010, Expect = 4.2e-107, Identities = 200/519 (38%), Positives = 323/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G++  ++TG+DEHGQKI++KA+E  + PQE VD  A+    LW+LL I Y  FIRTT  YH+  V + F +LL +  IYLG + G Y VS EE +T++      R EN + +       H + +  EESYF ++ ++   + ++  + P  + P  R+NE+  +F+     +DL++SR+ ++WG+Q+  NPKHV+YVW+DAL+NY+S LGY   DD S + KFW +     + ++ K+I RFH IYWPIML  L L  P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR+I M+NKY DG +P+++     F+ +         +     +E ++  + L  V +LI+  N +I++  PW L K+  ++D L   +S ++ +++ V + ++P +++ S   ++Q  + ++ FD++ +T F+ L    + +    PI+ R++ ED+
  S:     5 KSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIYLGEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPAD----IHMIGKDILRFHSIYWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVAT-DFDADLASVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLAAVMSHLVASLRVVAHLIQPFMMETSDAIMEQLGLGAT-FDLEKLT-FADLPEGVRVVAKGSPIFPRLDMEDE 525
>gi|77406524|ref|ZP_00783576.1| methionyl-tRNA synthetase [Streptococcus agalactiae H36B] >gi|77174863|gb|EAO77680.1| methionyl-tRNA synthetase [Streptococcus agalactiae H36B] (665 aa)
Score = 1008, Expect = 7.1e-107, Identities = 200/519 (38%), Positives = 322/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G++  ++TG+DEHGQKI++KA+E  + PQE VD  A+    LW+LL I Y  FIRTT  YH+  V + F +LL +  IYLG + G Y VS EE +T++      R EN + +       H + +  EESYF ++ ++   + ++  + P  + P  R+NE+  +F+     +DL++SR+ ++WG+Q+  NPKHV+YVW+DAL+NY+S LGY   DD S + KFW +     + ++ K+I RFH IYWPIML  L L  P + ++HGW + + GKMSKS GNV+ P   +   G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR+I M+NKY DG +P+++     F+ +         +     +E ++  + L  V +LI+  N +I++  PW L K+  ++D L+  +S +  +++ V + ++P +++ S   ++Q  + ++ FD++ +T F+ L    + +    PI+ R++ ED+
  S:     5 KSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIYLGEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPAD----IHMIGKDILRFHSIYWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVEXXGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVAT-DFDADLASVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLEAVMSHLAASLRVVAHLIQPFMMETSDAIMEQLGLGTT-FDLEKLT-FAGLPEGVRVVAKGSPIFPRLDMEDE 525
>gi|15672774|ref|NP_266948.1| methyonyl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|25009394|sp|Q9CHE0|SYM_LACLA Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|12723712|gb|AAK04890.1|AE006312_10 methyonyl-tRNA synthetase (EC 6.1.1.10) [Lactococcus lactis subsp. lactis Il1403] (662 aa)
Score = 1008, Expect = 7.2e-107, Identities = 205/519 (39%), Positives = 317/519 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  H+G ++TT+  DVL RYK+ +G++TF++TG+DEHG KI+ KA+EL + P+E +D  A     LWK L I Y  FIRTT  YH+  V + F +LL++D IYLG + G Y VS EE +T+       R E+ +         H +   EEE+YF ++ ++  ++  +  + P+ + P  R NE+ N+F+     +DL+++R++F+WGI +  NPKHVVYVW DALLNY++ LGY   +DSNF+K+W       + ++ KEI RFH IYWPIML  LGL  P K  +HGW++ + GKMSKS GNV+ P   I  YG DA RYYL++ +S  +D +F+ +  +   N DLAN++GNL NR++ MINKY DG I + +     F+   E+ +++        ++K      L+ V  LI+  N +I++  PW L K E+++  L+  L  +   ++     L+P +   S +  +Q  +D   F ++ ++   S  +  +   +PI+ R++ E++
  S:     5 KTFYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFYLTGLDEHGMKIQRKAEELGMTPKEYLDPMAADVQELWKKLDISYDKFIRTTDTYHEEAVAKAFEQLLEQDDIYLGKYAGWYSVSDEEFFTETQLEEIFRDESGNITGGIAPSGHEVEWVEEETYFFRMGKYADWLLQYYDEHPDFIQPEVRKNEMVNNFI-KPGLEDLALTRTSFTWGIPVPSNPKHVVYVWFDALLNYITALGYNSDNDSNFKKYWPG-----INMVGKEIVRFHTIYWPIMLHALGLPAPKKIFAHGWLLMKDGKMSKSKGNVVYPEMLIERYGLDAVRYYLMRAISFGQDGIFTPEDFVGRINFDLANDLGNLLNRTVSMINKYNDGKI-EATGVSTEFDASLEEVVEETISHFHKAMDKFEFNVALADVWTLISRTNKYIDETAPWVLAKSEDDKAKLNNVLYHLAENLRIAGALLQPFMRATSGKIFEQLGMDERSFSLENLSFGYSFTHPVVAKGQPIFPRLDVEEE 523
>gi|16077106|ref|NP_387919.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|586060|sp|P37465|SYM_BACSU Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|467427|dbj|BAA05273.1| methionyl-tRNA synthetase [Bacillus subtilis] >gi|2632305|emb|CAB11814.1| methionyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] (664 aa)
Score = 1007, Expect = 8.5e-107, Identities = 207/517 (40%), Positives = 310/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKI++KA++ N+ PQE VD+ A     LWK L I    FIRTT + HK V+++ F +LL    IYL  ++G Y +  E  YT+   V  E ++K            HP+   +EESYF ++ ++  + +  + ++P  + P +R NE+ N+F+     +DL++SR+ F WG+++ ENPKHVVYVW+DAL NYL+ LGY  ++D  +QK+W +     V L+ KEI RFH IYWPIML  L L  P +  +HGW++ + GKMSKS GNV+DP+  I  YG D  RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MINKY DG I  Y      F+       ++        +E +     LS +  LI+  N +I++  PW L K+   E++L   +  +  +++     L+P L    ++  +Q  I D S      +T F  L + K+   EP++ R+E+E++
  S:     8 FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFI-KPGLEDLAVSRTTFDWGVKVPENPKHVVYVWIDALFNYLTALGYDTENDELYQKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHTLTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGEPLFPRLEAEEE 528
>gi|194017985|ref|ZP_03056592.1| methionyl-tRNA synthetase [Bacillus pumilus ATCC 7061] >gi|194010322|gb|EDW19897.1| methionyl-tRNA synthetase [Bacillus pumilus ATCC 7061] (666 aa)
Score = 1007, Expect = 9.2e-107, Identities = 204/522 (39%), Positives = 305/522 (58%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           E  K FY+TTPIYYPSG  HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI++KA+E N+ P E +D       +LWK L I    FIRTT + H  ++++ F +LL +  IYL  ++G Y +  E  YT+   V  E ++K            HP+   +EESYF ++ ++  + +  + K+P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHV+YVW+DAL NYL+ +GY    D  ++K+W +     V L+ KEI RFH IYWPIML  L L  P +  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ M+ KY DG +  Y  P   F+ E +   +Q        +E L     LS V  LI+  N +I+Q  PW L K E   K+L   +  +  +++     L P L    ++   Q  I+  K      +  F ++    +   EP++ R+E E++
  S:     3 EKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQQKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHTKIIEQVFQKLLDQGDIYLDQYEGWYSIPDETFYTETQLVDVERNEKGEVTGGKSPDSGHPVELIKEESYFFRMSKYADRLLDYYEKNPTFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPNNPKHVIYVWIDALFNYLTAIGYGTDQDEKYKKYWPAN----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVNYDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLEFSVALSNVWTLISRTNKYIDQTAPWVLAKDETKRKELHSVMYHLAESLRITAVLLTPFLTKTPEKIFFQLGIEEEKLKSWDSILSFGAIQQATVQKGEPLFPRLEVEEE 528
>gi|125624554|ref|YP_001033037.1| MetS protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124493362|emb|CAL98336.1| MetS protein [Lactococcus lactis subsp. cremoris MG1363] (662 aa)
Score = 1007, Expect = 9.8e-107, Identities = 205/519 (39%), Positives = 316/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  H+G ++TT+  DVL RYK+ +G++TF++TG+DEHG KI+ KA+EL + P+E +D  A     LWK L I Y  FIRTT  YH+  V + F +LL++D IYLG + G Y VS EE +T+       R E+ +         H +   EEE+YF ++ ++  ++  +  + P+ + P  R NE+ N+F+     +DL+++R++F+WGI +  NPKHVVYVW DALLNY++ LGY   +DSNF+K+W       + ++ KEI RFH IYWPIML  LGL  P K   HGW++ + GKMSKS GNV+ P   I  YG DA RYYL++ +S  +D +F+ +  +   N DLAN++GNL NR++ MINKY DG I + +     F+   E+ +++        ++K      L+ V  LI+  N +I++  PW L K E+++  L+  L  +   ++     L+P +   S +  +Q  +D   F ++ ++   S  +  +   +PI+ R++ E++
  S:     5 KTFYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFYLTGLDEHGMKIQRKAEELGMTPKEYLDPMAADVQELWKKLDISYDKFIRTTDTYHEEAVAKAFEQLLEQDDIYLGKYAGWYSVSDEEFFTETQLEEIFRDESGNITGGIAPSGHEVEWVEEETYFFRMGKYADWLLQYYDEHPDFIQPEVRKNEMVNNFI-KPGLEDLALTRTSFTWGIPVPSNPKHVVYVWFDALLNYITALGYNSDNDSNFKKYWPG-----INMVGKEIVRFHTIYWPIMLHALGLPAPKKIFGHGWLLMKDGKMSKSKGNVVYPEMLIERYGLDAVRYYLMRAISFGQDGIFTPEDFVGRINFDLANDLGNLLNRTVSMINKYNDGKI-EATGVSTEFDASLEEVVEETISHFHKAMDKFEFNVALADVWTLISRTNKYIDETAPWVLAKSEDDKAKLNNVLYHLAENLRIAGALLQPFMRATSGKIFEQLGMDERSFSLENLSFGYSFTHPVVAKGQPIFPRLDVEEE 523
>gi|163791030|ref|ZP_02185451.1| methionyl-tRNA synthetase [Carnobacterium sp. AT7] >gi|159873675|gb|EDP67758.1| methionyl-tRNA synthetase [Carnobacterium sp. AT7] (675 aa)
Score = 1007, Expect = 9.9e-107, Identities = 214/515 (41%), Positives = 316/515 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITT----IIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-------DNQKINTPEPIYLRIE 1083
           K FYITTPIYYPSG  HIG+A++T+  DV+ RYK+   ++ F++TG DEHGQKIE KA+ELN+ PQE VD+ AK   NLW+LL I    FIRTT   H+ VV + F   L +  IYL  ++G Y V  E  YT+   V  E D +            HP+   +EESYF ++ ++  + ++ + + P+ + P +R NE+ N+F+     +DL++SR+ F+WG+++  NPKHV+YVW+DAL NY++ LGY   D S F KFW +     V ++ KEI RFH IYWPIML  L L  P K   HGW++ ++GKMSKS GNV+ P   +  YG DA RYYL++E++   D VF+ +  ++  N DLAN++GNL NR+I MINKY DG +P Y+      N+ EF+  LK+  +++ T     +E +     LS V  LI+  N +I++  PW L KE ++K +L   +  +   ++     L+P L    KE   Q  ++      +F  D+S++       +   I    PI+ R++
  S:     5 KTFYITTPIYYPSGKLHIGNAYSTIACDVMARYKRMQDFDVFYLTGSDEHGQKIENKAQELNITPQEYVDEMAKGMQNLWELLEISNDKFIRTTDPIHEKVVADIFERFLAQGDIYLDEYEGWYSVPDETFYTETQLVDVERDAEGTIIGGKSPDSGHPVELIKEESYFFRMSKYADRLLAYYNEHPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFTWGVKVPSNPKHVIYVWIDALANYITALGYGTDDTSLFDKFWPAD----VHMVGKEIVRFHTIYWPIMLMALDLPLPKKIFGHGWLLMKEGKMSKSKGNVVYPEMLVEQYGLDALRYYLMREVTFGSDGVFTPEDFVSRVNYDLANDLGNLLNRTIAMINKYFDGKVPDYTG-----NVTEFDAVLKETAEKVCTNYQEEMENMQFSSALSHVWVLISRANKYIDETAPWKLAKEEDQKNELASVMVHLAETLRISAILLQPFLTHAPKEVFAQLGVEG-----EFAGDWSTIQFGSFPTNTTVIKKGTPIFPRLD 524
>gi|83588921|ref|YP_428930.1| methionyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] >gi|83571835|gb|ABC18387.1| methionyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] (651 aa)
Score = 1006, Expect = 1.3e-106, Identities = 194/470 (41%), Positives = 279/470 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVL 1038
           K FY+TTPIYYPS   HIGHA TT +AD L RYK+  GY+ +F+TG DEHGQKI+ KA+E NL+P + VD+    F  LW+ L I Y+ FIRTT   H  VVQ    ++  +  IY   ++G YC  CE  +T+   V     D   C +  P+   +EESYF ++ ++   +  ++KD P+ + P+TR NE+  SF+     +DL ISR+ F WGI +  +PKHV+YVW DAL NY+S LGY   DD  F+K+W +     V L+ K+I RFH I WPI+L   G+  P +   HGW++ + GKMSKS GNV+DP+  I+ YG DA RY+LL+E+    D  +SE+ LIN +N DLAN+ GNL +R+  MI K+  G+I   S P+   + E +       DE+   +      + L+ +  L+N  N +IE+  PW L ++  +K  L   L  +  AV++    + P +
  S:     4 KVFYVTTPIYYPSDKLHIGHALTTTMADTLARYKRLRGYDVYFLTGSDEHGQKIQRKAREANLEPIQYVDRIVATFQELWRRLNISYNDFIRTTEPRHARVVQALLQKIYDQGDIYKSTYEGWYCTPCETFWTERQLVDGNCPD---CGR--PVELVKEESYFFRMSKYADRLLQYIKDHPDFIQPVTRRNEMI-SFIEG-GLEDLCISRTTFDWGIPVPMDPKHVIYVWFDALTNYISALGYGTADDHLFRKYWPAA----VHLVGKDIVRFHTIIWPIILMAAGIEPPRQVFGHGWLLVDGGKMSKSRGNVVDPMILIDRYGSDAIRYFLLREMPYGADGYYSEEALINRYNTDLANDFGNLLSRTTAMIEKFNGGVIDPPSAPE-PLDEELKNLAAGIPDEVDNALNHYEFARALAAIWRLVNRANKYIEETAPWALARDPGQKQRLQTVLYNLAEAVRQATIMVGPFM 463
>gi|188584685|ref|YP_001916230.1| methionyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349372|gb|ACB83642.1| methionyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] (655 aa)
Score = 1002, Expect = 3.3e-106, Identities = 217/517 (41%), Positives = 313/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFE--KQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-------DNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPS   HIGH++TT+ AD + RYKK  GY+  F+TG DEHGQKIE KAKE    PQ+ VD+       LW LL IEY  FIRTT E HK+VVQ+ F    ++  IY   ++G YC  CE  +     + ++ D+   C      ++  +EESYF K+ ++  + +     +P  + P +R NE+ N+FL N   +DL +SR+ F WGI++  +  HVVYVWLDAL NYLS LGY  +DD+ FQK+W       V LM+KEI RFH IYWPI L  L L  P +   HGW++ E+GKMSKS GNV+DP   +N YG DA RYYLL+E+S   D VF+ + LI   N DLAN++GNL NR++ MI+KY DG IP   +P +S  ++ +     ++   E    +E ++  + L  + +LI   N +I++ +PW L K+ N+KD L   L  +  +++ +   L P +    K+   Q  ID++    K +  + SL          +++  +P++ R+E E++
  S:     7 FYITTPIYYPSDKLHIGHSYTTVAADCMARYKKLTGYDVMFLTGTDEHGQKIERKAKENGKNPQQFVDEIVASIKELWTLLDIEYDDFIRTTEERHKSVVQKIFERFYEQGDIYKDQYEGWYCTPCESFW-----LERQLDEAKTCPDCAREVEWVKEESYFFKMSKYADRLLEHIENNPEFIQPESRKNEMINNFL-NPGLEDLCVSRTTFKWGIEVPMDKDHVVYVWLDALTNYLSALGYLSEDDTKFQKYWPCD----VHLMAKEIVRFHSIYWPIFLMALDLPLPKQVFGHGWLLLEEGKMSKSKGNVVDPEVLVNKYGSDAIRYYLLREISFGSDGVFTLEALIRRINYDLANDLGNLLNRTVAMIDKYFDGQIP---EPVVSEQVDNDLINHAQETVTETEKHMEGMDFSEALKALWELIGRTNKYIDETQPWILGKDPNKKDRLATVLYNLSESLRYISVLLSPFMPRTPKQIRSQLGIDNN----KEIQTYKSLYEWGQIPSGVRVSKDKPLFPRLEIEEE 518
>gi|116511600|ref|YP_808816.1| methionyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|116107254|gb|ABJ72394.1| methionyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] (666 aa)
Score = 1002, Expect = 3.6e-106, Identities = 205/519 (39%), Positives = 313/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  H+G ++TT+  DVL RYK+ +G++TF++TG+DEHG KI+ KA+EL + P+E +D  A     LWK L I Y  FIRTT  YH+  VQ+ F +LL++D IYLG + G Y VS EE +T+        D+            H +   EEESYF ++ ++  ++  F + +P  + P  R NE+ N+F+     +DL++SR+ F+WGI +K NPKHVVYVWLDAL NY++ LG+   DDS ++KFW       V ++ KEI RFH IYWPI  + LG+  P +  +HGW++ + GKMSKS GNV+ P   I  YG DA RYYL++ +S  +D +F+ +  +   N DLAN++GNL NR++ MINKY DG I + +     F+   E+ +++        ++K      L+ V  LI+  N +I++  PW L K E+++  L+  L  +   ++     L+P +   S +  +Q  +D   F ++ +    S  +  +   +PI+ R++ E++
  S:     5 KTFYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFYLTGLDEHGMKIQRKAEELGMTPKEYLDPMAADVQELWKKLDISYDKFIRTTDTYHEEAVQKIFEKLLEQDDIYLGKYAGWYSVSDEEFFTETQLEEVFKDEAGNVTGGIAPSGHEVEWVEEESYFFRMGKYADWLLDFYEANPTFIEPAIRKNEMINNFI-KPGLEDLAVSRTTFTWGIPVKSNPKHVVYVWLDALFNYVTALGFYGDDDSLYKKFWPG-----VNMVGKEIVRFHTIYWPIFCKALGIEPPKQVFAHGWLLMKDGKMSKSKGNVVYPEMLIERYGLDAVRYYLMRAISFGQDGIFTPEDFVGRINFDLANDLGNLLNRTVSMINKYNDGKI-EATGVSTEFDASLEEVVEETISHFHKAMDKFEFNVALADVWTLISRTNKYIDETAPWVLAKSEDDKAKLNNVLYHLAENLRIAGSLLQPFMRATSGKIFEQLGMDEESFSLENLAFGYSFTHPVVAKGQPIFPRLDVEEE 523
>gi|157690820|ref|YP_001485282.1| methionyl-tRNA synthetase [Bacillus pumilus SAFR-032] >gi|157679578|gb|ABV60722.1| methionine--tRNA ligase [Bacillus pumilus SAFR-032] (666 aa)
Score = 1002, Expect = 3.7e-106, Identities = 204/522 (39%), Positives = 306/522 (58%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           E  K FY+TTPIYYPSG  HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI++KA+E N+ P E +D       +LWK L I    FIRTT + H  ++ + F +LL +  IYL  ++G Y +  E  YT+   V  E+++K            HP+   +EESYF ++ ++  + +  + K+P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHV+YVW+DAL NYL+ +GY    D  ++K+W +     V L+ KEI RFH IYWPIML  L L  P +  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ M+ KY DG +  Y  P   F+ E +   +Q        +E L     LS V  LI+  N +I+Q  PW L K E+  K+L   +  +  +++     L P L    ++   Q  I+  K      +  F ++    +   EP++ R+E E++
  S:     3 EKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQQKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHTIIIGQVFQKLLDQGDIYLDQYEGWYSIPDETFYTETQLVDVEHNEKGEVTGGKSPDSGHPVELIKEESYFFRMSKYADRLLDYYEKNPTFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPNNPKHVIYVWIDALFNYLTAIGYGTDQDEKYKKYWPAN----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVNYDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLEFSVALSNVWTLISRTNKYIDQTAPWVLAKDESKRKELHSVMYHLAESLRITAVLLTPFLTKTPEKIFFQLGIEEEKLKSWDSILSFGAIQQATVQKGEPLFPRLEVEEE 528
>gi|77408311|ref|ZP_00785053.1| methionyl-tRNA synthetase [Streptococcus agalactiae COH1] >gi|77173074|gb|EAO76201.1| methionyl-tRNA synthetase [Streptococcus agalactiae COH1] (665 aa)
Score = 1002, Expect = 3.7e-106, Identities = 199/519 (38%), Positives = 322/519 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G++  ++TG+DEHGQKI++KA+E  + PQE VD  A+    LW+LL I Y  FIRTT  YH+  V + F +LL +  IYL  + G Y VS EE +T++      R EN + +       H + +  EESYF ++ ++   + ++  + P  + P  R+NE+  +F+     +DL++SR+ ++WG+Q+  NPKHV+YVW+DAL+NY+S LGY   DD S + KFW +     + ++ K+I RFH IYWPIML  L L  P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR+I M+NKY DG +P+++     F+ +         +     +E ++  + L  V +LI+  N +I++  PW L K+  ++D L   +S ++ +++ V + ++P +++ S   ++Q  + ++ FD++ +T F+ L    + +    PI+ R++ ED+
  S:     5 KSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIYLDEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPAD----IHMIGKDILRFHSIYWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVAT-DFDADLASVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLAAVMSHLVASLRVVAHLIQPFMMETSDAIMEQLGLGAT-FDLEKLT-FADLPEGVRVVAKGSPIFPRLDMEDE 525
>gi|73663575|ref|YP_302356.1| methionyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82582280|sp|Q49UZ9|SYM_STAS1 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|72496090|dbj|BAE19411.1| methionyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (658 aa)
Score = 1002, Expect = 3.8e-106, Identities = 211/517 (40%), Positives = 311/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK-FDIKFVTDFSSLDNQKI--NTPEPIYLRIESE 1085
           + FYITTPIYYPSGN HIGHA+TT   DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+      +LW  L I    FIRTT   HK VVQ+ F  LL +  IYLG ++G Y V  E  YT+   V    ++ +      P    E     EESYF  + ++   +  F  ++P  + P +R NE+ N+F+     +DL++SR++F WGI+++ NPKHVVYVW+DAL+NY+S LGY   DDS F+K+W +     + +M+KEI RFH I WPI+L  L +  P K  +HGWI+ + GKMSKS GNV+DP   IN YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I M+NKY DG +P Y  PK   + + E+            ++ L     LS +   I+  N +I++  PW L K+ ++K+ L   ++ ++  ++ +   L P L    K+   Q NI++ + F+++ +  + +L    +    PEPI+ R++SE
  S:     4 ETFYITTPIYYPSGNLHIGHAYTTTAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKSEIEYLDEMIAGIKDLWGKLEISNDDFIRTTEIRHKEVVQQIFERLLAQGDIYLGEYEGWYSVPDETYYTETQLVDPIMENGVIVGGKSPDSGHEVELVKEESYFFNLSKYTDRLLEFYDENPEFIQPPSRKNEMINNFIK-PGLEDLAVSRTSFDWGIRVQSNPKHVVYVWIDALVNYISSLGYLSDDDSLFKKYWPAD----IHIMAKEIVRFHSIIWPILLMALDIPLPKKVFAHGWILMKDGKMSKSKGNVVDPNVLINRYGLDATRYYLMRELPFGSDGVFTPEGFVERTNYDLANDLGNLVNRTISMVNKYFDGELPAYQGPKHELDKDMEQMALDTVKTFHENMDDLQFSVALSTIWKFISRTNKYIDETSPWVLAKDEDQKEMLGNVMAHLVENIRIIAVLLRPFLTHAPKQIFSQLNINAPELFELESIEQYGALTEPIMVSGKPEPIFPRLDSE 525
>gi|116496032|ref|YP_807766.1| methyonyl-tRNA synthetase [Lactobacillus casei ATCC 334] >gi|116106182|gb|ABJ71324.1| methionyl-tRNA synthetase [Lactobacillus casei ATCC 334] (660 aa)
Score = 1001, Expect = 5.1e-106, Identities = 203/517 (39%), Positives = 315/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIG+A+TT+ ADVL RYK+ +GY+ FF+TG DEHG KIE+KA +L + PQ  VD  A     LWK+L I    FIRTT + H   VQ     L+K+  +YLG + G Y V  EE +T++    V ++ D  +   +    H +    E SYF K+ ++  + +  + + P+ V P +R  E+ N+F+     +DL++SR++F+WG+QI  +PKHVVYVW+DALLNY++ LGY   D + F K+W +     VQL+ KEI RFH IYWPI+L  LGL  P K  +HGW++ + GKMSKS GN + P   +  YG DA RYYL++ +    D +F+ +  I+  N DLAN++GNL NR+I MINKY DGI+P +      F+ +     +    +   ++++L     L +V  +++  N +I++ +PW+L K+  +KD LD  ++ +  +++ +   ++PV+     +   Q  +D    D K V  + +L    + +    PI+ R+++E++
  S:     7 FYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQKADKLGVTPQAYVDGMATQIKQLWKMLEITNDKFIRTTDKEHVEAVQTIVERLIKQGDVYLGEYTGWYSVEDEEYFTESQLSEVYRDQDGNVTGGKAPSGHEVQLVHEPSYFFKMSKYTDRLLKYYDEHPDFVQPASRKTEMINNFI-KPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVDALLNYITALGYGSNDHALFDKYWPAN----VQLIGKEIVRFHIIYWPIILMALGLPLPKKIYAHGWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYDLANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSDALDQVWKIVSRANKYIDETEPWNLAKDPAKKDQLDAVMAHLAESLRLIALLIQPVMTHAPLQIFGQLGLDHENDDHKLV-QWGALPAGVKVVEQGTPIFPRLDTEEE 526
>gi|191639512|ref|YP_001988678.1| Methionyl-tRNA synthetase [Lactobacillus casei] >gi|190713814|emb|CAQ67820.1| Methionyl-tRNA synthetase [Lactobacillus casei BL23] (660 aa)
Score = 1000, Expect = 6.3e-106, Identities = 203/517 (39%), Positives = 315/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIG+A+TT+ ADVL RYK+ +GY+ FF+TG DEHG KIE+KA +L + PQ  VD  A     LWK+L I    FIRTT + H   VQ     L+K+  +YLG + G Y V  EE +T++    V ++ D  +   +    H +    E SYF K+ ++  + +  + + P+ V P +R  E+ N+F+     +DL++SR++F+WG+QI  +PKHVVYVW+DALLNY++ LGY   D + F K+W +     VQL+ KEI RFH IYWPI+L  LGL  P K  +HGW++ + GKMSKS GN + P   +  YG DA RYYL++ +    D +F+ +  I+  N DLAN++GNL NR+I MINKY DGI+P +      F+ +     +    +   ++++L     L +V  +++  N +I++ +PW+L K+  +KD LD  ++ +  +++ +   ++PV+     +   Q  +D    D K V  + +L    + +    PI+ R+++E++
  S:     7 FYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQKADKLGVTPQAYVDGMATQIKQLWKMLEITNDKFIRTTDKEHVEAVQTIVERLIKQGDVYLGEYTGWYSVEDEEYFTESQLSEVYRDQDGNVTGGKAPSGHEVQLVHEPSYFFKMSKYTDRLLKYYDEHPDFVQPASRKTEMINNFI-KPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVDALLNYITALGYGSNDHALFDKYWPAN----VQLIGKEIVRFHIIYWPIILMALGLPLPKKIYAHGWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYDLANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSDALDQVWKIVSRANKYIDETEPWNLAKDPAKKDQLDAVMAHLAESLRLIALLIQPVMTHAPLQIFGQLGLDHENDDHKLV-QWGALPAGVKVVEQGTPIFPRLDTEEE 526
>gi|169188706|ref|ZP_02848750.1| methionyl-tRNA synthetase [Paenibacillus sp. JDR-2] >gi|169004429|gb|EDS51287.1| methionyl-tRNA synthetase [Paenibacillus sp. JDR-2] (663 aa)
Score = 998, Expect = 1.0e-105, Identities = 197/523 (37%), Positives = 311/523 (59%)
  Q:   565 GEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN-FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDI-KFVTDFSSL-DNQKINTPEPIYLRIESEDK 1087
           G   K FYITTPIYYPS   HIGHA+TT+  D + RYK+  GY+ +++TG DEHGQKIE  AK+ N  PQ+ VD        LW  L I    FIRTT   HK  V++ F++LLK+D IY G ++G YC  CE  + +   V     D   C +  P+   +EESYF ++ ++  + +  + ++P+ + P +R NE+ N+F+     +DL++SR+ F WGI++  +PKHV+YVW+DAL NY++ LGY ++  S+ + +FW +     V L+ KEI RFH IYWPIML  LGL  P K  +HGW++ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D  F+ +  ++  N DLAN++GNL NR++ MI+KY DG IP Y     +F+   +    +   ++ + +E +     LS +   ++  N +I++  PW L K+  +K +L   +  +  +++ +   L+P L    +E  +Q  ++  +    +    F  L    +++   P++ R+++ ++
  S:     2 GNDKKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVWYLTGTDEHGQKIERNAKDKNKSPQQFVDDIVVGIKELWSKLEISNDDFIRTTEPRHKEAVEKIFAQLLKQDDIYKGEYEGWYCTPCESFFLERQLVNGNCPD---CGR--PVELVKEESYFFRMSKYADRLLKHYEENPDFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALSNYITALGYGKEGSSDLYDRFWPAD----VHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDAVRYYLLREVPFGSDGTFTPENFVDRINFDLANDLGNLLNRTVAMIDKYFDGEIPAYGGNVTAFDESLQVLAVETVRQVESSMETMEFSVALSAIWQFVSRTNKYIDETSPWALAKDEAKKGELASVMYHLAESLRIISILLQPYLTHAPRELWRQLGLEEGELTAWESTKRFGQLPGGTRVSKGAPVFPRLDAAEE 519
>gi|154684557|ref|YP_001419718.1| methionyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42] >gi|154350408|gb|ABS72487.1| MetS [Bacillus amyloliquefaciens FZB42] (663 aa)
Score = 997, Expect = 1.5e-105, Identities = 203/517 (39%), Positives = 304/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA------QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG  HIGHA+TT+  D + RYK+  G++  ++TG DEHGQKI++KA+E N+ PQ  VD+       LWK L I +  FIRTT   HK ++++ F +LL    IYL  ++G Y +  E  YT+   V  E ++K            HP+   +EESYF ++ ++   +  F ++ P+ + P +R NE+ N+F+     +DL++SR+ F WG+++  NPKHVVYVW+DAL NY++ LGY  ++D  ++K+W +     V L+ KEI RFH IYWPIML  L L  P +  +HGW++ + GKMSKS GNV+DP+  I  YG D  RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI KY DG I  Y      F+ E      +        +E +     LS +  LI+  N +I++  PW L K +  EK+L   +  +  +++     L+P L    ++   Q  + D S      +  F  L N K+   EP++ R+E+E++
  S:     8 FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQKAEEENITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKYADRLLKFYEENPSFIQPESRKNEMINNFIK-PGLEDLAVSRTTFDWGVKVPGNPKHVVYVWIDALFNYITALGYDTENDELYKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMIQKYFDGEIGSYEGNVTDFDSELSSVAGETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDQEKEKELRSVMYHLAESLRISAVLLQPFLTQTPEKMFAQLGVEDQSLKAWDSIQTFGQLKNAKVKKGEPLFPRLEAEEE 528
>gi|42518288|ref|NP_964218.1| methionyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] >gi|41582572|gb|AAS08184.1| methionyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] (658 aa)
Score = 996, Expect = 1.6e-105, Identities = 206/517 (39%), Positives = 311/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKIN-TPEPIYLRIESE 1085
           K FYITTPIYYPSG   IG+A+TT+ AD +TRYKK  G++TFF+TG DEHG KIE+KA+   +KPQE VDK A  + +LWK+L + Y  FIRTT E H   VQ+ F  LLK+  IYLG + G Y V  EE +T++    V K++D  +   +    H +   +E SYF ++ ++   +  + KD P+ + P +R  E+ N+F+     +DLS++R+   WGI +  +PKHVVYVW+DAL NY++ LGY   +D+ F+K+W +     V L+ KEI RFH IYWPIML  L L  P +   HGW++   GKMSKS GN + P   +  YG DA RYYL++ +    D +F+ +  +   N DLAN++GNL NR++ MIN+Y+DG +   +  +  F  +  K   +   E    ++ L+  + L  V  LI+  N +I++  PW L KE   ++L   ++ +  +++ +   + PV+     +  +Q  +D    D K + DF   D N K+   P PI+ R++++
  S:     5 KTFYITTPIYYPSGKLTIGNAYTTIAADTMTRYKKSRGFDTFFLTGTDEHGLKIEQKAEAQGIKPQEFVDKMADSYKDLWKMLDVSYDRFIRTTDEDHVKAVQKIFERLLKQGDIYLGEYTGWYSVEDEEYFTESQLAEVYKDDDGNVIGGKAPSGHEVRLVKEPSYFFRMSKYADRLLQYYKDHPDFILPHSREKEMVNNFI-KPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWIDALSNYITALGYGSDNDALFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFGHGWVLMRDGKMSKSKGNAVYPEMIVKRYGLDALRYYLMRAIPFGSDGIFTPEDFVERVNFDLANDLGNLLNRTVSMINQYQDGQVAPVASEQDEFAKDLIKTANETIAEYQKQMDALHFSQALDSVWKLISRANKYIDETTPWTLNKEGKSEELSKVMTNLAESLRLIAILIAPVMTQSPVKMFEQLGLDWKNDDQKKL-DFGGFDWNIKVTEKPTPIFPRLKND 523
>gi|24380018|ref|NP_721973.1| methionyl-tRNA synthetase [Streptococcus mutans UA159] >gi|24378007|gb|AAN59279.1|AE014994_9 putative methionyl-tRNA synthetase [Streptococcus mutans UA159] (669 aa)
Score = 994, Expect = 2.7e-105, Identities = 196/491 (39%), Positives = 307/491 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEF----EKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK 1059
           + FYITTPIYYPSG  HIG A+TT+  DVL RYK+ + ++ F++TG+DEHGQKI++K++E  + PQ  VD  A     LWKLL I Y  FIRTT +YH+ VV + F +LL +  IYLG + G Y VS EE +T++    + ++ D K+        H +    EESYFL++  +  + +  F   P+ + P  R+NE+  +F+     +DL++SR++F+WG+++  NPKHVVYVW+DALLNY + LGY Q   +NF KFWN     +  ++ K+I RFH IYWPI+L ML L+ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY  G IP Y +    F+ +        L Q+  ++  +    +  + L  V ++I+  N +I++  PW L K+  ++ DL   ++ +  +++ V + ++P ++  S   ++Q  + + +FD++
  S:     5 QPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNHDVFYLTGLDEHGQKIQQKSEEAGITPQAYVDGMAVGVKELWKLLDISYDKFIRTTDDYHEKVVADVFEKLLAQGDIYLGEYSGWYSVSDEEFFTESQLEEIFRDEDGKVIGGIAPSGHEVEWVSEESYFLRLSNYADRLVDFFHAHPDFIQPDGRMNEIIKNFI-EPGLEDLAVSRTSFTWGVKVPSNPKHVVYVWIDALLNYATALGYGQDAHANFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDLKMPERLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFGGEIPAYVENVTDFDADLAAVVADNLAQYHKQMNAV----DYPRALETVWNIISRTNKYIDETTPWVLAKDKAKRDDLAAVMAHLAASLRVVAHLIQPFMMTTSNAIMEQLGL-AGQFDLE 497
>gi|27469211|ref|NP_765848.1| methionyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57866027|ref|YP_187724.1| methionyl-tRNA synthetase [Staphylococcus epidermidis RP62A] >gi|38258352|sp|Q8CQU3|SYM_STAES Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|81675420|sp|Q5HRR5|SYM_STAEQ Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|27316760|gb|AAO05935.1|AE016751_230 methionyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57636685|gb|AAW53473.1| methionyl-tRNA synthetase [Staphylococcus epidermidis RP62A] (656 aa)
Score = 994, Expect = 3.2e-105, Identities = 215/515 (41%), Positives = 312/515 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFE----KQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINT--PEPIYLRIESE 1085
           FYITTPIYYPSGN HIGHA++T+  DV+ RYK+  GY+  ++TG DEHGQKI+EKA++      E +D+      NLW  L I    FIRTT E HK VV++ F  LLK+  IYLG ++G Y V  E  YT++  V    ++        P    E     EESYF  I ++   +  F  ++P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHVVYVW+DAL+NY+S LGY   D++ F K+W +     + LM+KEI RFH I WPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYL++EL    D VF+ +  +   N DLAN++GNL NR+I MINKY  G +P Y  PK   + + E    + +K F+D     +E L     LS V   I+  N +I++ +PW L K+ N+++ L   ++ ++  ++     L+P L    +E  KQ NI++     +  +  +  L      T  P PI+ R+++E
  S:     6 FYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTELEYLDEMISGIKNLWSKLEISNDDFIRTTEERHKQVVEKVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPVYENGKIVGGKSPDSGHEVELVKEESYFFNINKYTDRLLEFYDENPDFIQPPSRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPSNPKHVVYVWIDALVNYISSLGYLSDDETLFNKYWPAD----IHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNYDLANDLGNLVNRTISMINKYFHGELPAYQGPKHELDEKMEAMALETVKSFNDN----MESLQFSVALSTVWKFISRTNKYIDETQPWVLAKDENQREMLGNVMAHLVENIRFATILLQPFLTHAPREIFKQLNINNPDLHQLDSLQQYGMLSEAITVTEKPTPIFPRLDTE 525
>gi|116628880|ref|YP_814052.1| methionyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] >gi|116094462|gb|ABJ59614.1| methionyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] (681 aa)
Score = 993, Expect = 4.1e-105, Identities = 205/517 (39%), Positives = 311/517 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKIN-TPEPIYLRIESE 1085
           K FYITTPI+YPSG   IG+A+T + AD +TRYKK  G++TFF+TG DEHG KIE+KA+   +KPQE VDK A  +  LWK+L + Y  FIRTT E H   VQ+ F +LLK+  IYLG + G Y V  EE +T++    V +++D  +   +    H +   +E SYF ++ ++   +  + KD P+ + P +R  E+ N+F+     +DLS++R+   WGI +  +PKHVVYVW+DAL NY++ LGY   DDS F+K+W +     V L+ KEI RFH IYWPIML  L L  P +   HGW++   GKMSKS GN + P      YG DA RYYL++ +    D +F+ +  +   N DLAN++GNL NR++ MIN+Y+DG +   +  +  F  +  K  K+   E    ++ L+  + L  V  LI+  N +I++  PW L KE   ++L   +S +  +++ V   + PV+     +   Q  +D +K + +   +F + D + K+   P PI+ R++++
  S:    28 KTFYITTPIFYPSGKLTIGNAYTAIAADAMTRYKKSRGFDTFFLTGTDEHGLKIEQKAEAQGIKPQEFVDKMAASYKELWKMLDVSYDRFIRTTDEDHVKAVQKIFEKLLKQGDIYLGEYTGWYSVEDEEYFTESQLAEVYRDDDGNVIGGKAPSGHEVRLVKEPSYFFRMSKYADRLLQYYKDHPDFILPHSREKEMVNNFIK-PGLEDLSVTRTTVDWGIPVPSDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFGHGWVLMRDGKMSKSKGNAVYPEMIAKRYGLDALRYYLMRAIPFGSDGIFTPEDFVERVNFDLANDLGNLLNRTVSMINQYQDGYVAPVAADQDEFAQDLIKTAKETIAEYQKQMDALHFSQALDSVWKLISRANKYIDETTPWTLNKEGKSEELSKVMSNLAESLRLVAILIAPVMTQSPVKMFNQLGLDWNK-EAQKKLEFGAFDWDIKVTEKPTPIFPRLKND 546
>gi|23097501|ref|NP_690967.1| methionyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] >gi|25009346|sp|P59079|SYM_OCEIH Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|22775724|dbj|BAC12002.1| methionine-tRNA ligase [Oceanobacillus iheyensis HTE831] (673 aa)
Score = 992, Expect = 5.2e-105, Identities = 201/481 (41%), Positives = 293/481 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIA--VRKENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           FYITTPIYYPSG  HIG+A+TT+  DV+ RYK+  G++ F++TG DEHGQKIE+KAKE+N+ P+  VD  A+    LW  L I    FIRTT E HK VV + F   L++  IYL  ++G Y V  E  YT+     V +++D  +   +     HP+   +EESYF ++ ++   +  F +D P  + P +R NE+ N+F+     +DL++SR+ FSWG+Q+  NPKHVVYVW+DAL NY++ LGY  +D S + KFW +     V ++ KEI RFH IYWPIML  L L  P K  +HGW++ + GKMSKS GNV+ P   +  YG DA RYYL++E++   D VF+ +  I+  N DLAN++GNL NR++ MINKY DG +P++     SF+ E +        E    +E +     L +V  LI+  N +I++ +PW + K E    +L   +  +  ++      L+P L    K+  +Q  +
  S:     7 FYITTPIYYPSGKLHIGNAYTTIACDVMARYKRMRGFDVFYLTGSDEHGQKIEQKAKEMNISPKAYVDDMAEGMKKLWNTLEISNDKFIRTTEEQHKKVVADIFERFLEQGDIYLDEYEGWYSVPDETFYTETQLEDVERDDDGNVIGGKSPDSGHPVELIKEESYFFRMSKYADRLLKFYEDNPEFIQPESRKNEMINNFIK-PGLEDLAVSRTTFSWGVQVPSNPKHVVYVWIDALTNYITALGYGSEDTSLYDKFWPAD----VHMVGKEIVRFHTIYWPIMLMALDLPLPKKVFAHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLMREVAFGSDGVFTPEDFISRVNYDLANDLGNLLNRTVAMINKYFDGKVPEFKGEVTSFDGELQTTANNAVKEYEKHMEGMQFSDALKQVWILISRANKYIDETEPWIVAKDEGRRNELASVMVHLAESLHAAALMLQPFLTHAPKKIAEQLGL 490
>gi|116871573|ref|YP_848354.1| methionyl-tRNA synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740451|emb|CAK19571.1| metS [Listeria welshimeri serovar 6b str. SLCC5334] (665 aa)
Score = 988, Expect = 1.4e-104, Identities = 210/520 (40%), Positives = 307/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL +  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I  YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y      F+           +E    +E +     L+++  LI+  N +I++  PW L KE +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+++E
  S:     4 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLAQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIERYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTDFDQTLVDFKNNVVEEYEKSMEHMQFSVALNQLWSLISRTNKYIDETAPWTLAKEEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAE 528
>gi|168267173|ref|ZP_02689138.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J2-071] (681 aa)
Score = 988, Expect = 1.7e-104, Identities = 213/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDD----EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F +    E    +E +     L+++  L++  N +I++  PW L KE  ++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+++E
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEASMEHMQFSVALNQLWSLVSRTNKYIDETAPWALAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAE 527
>gi|16799293|ref|NP_469561.1| methionyl-tRNA synthetase [Listeria innocua Clip11262] >gi|25009380|sp|Q92F90|SYM_LISIN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|16412635|emb|CAC95449.1| methionyl-tRNA synthetase [Listeria innocua] (664 aa)
Score = 987, Expect = 1.9e-104, Identities = 213/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L KE +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+++E
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNYDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWALAKEEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPEGTTVVKKGTPIFPRLDAE 527
>gi|153200615|ref|ZP_01942722.1| methionyl-tRNA synthetase [Listeria monocytogenes HPB2262] >gi|133736563|gb|EBA38261.1| methionyl-tRNA synthetase [Listeria monocytogenes HPB2262] (664 aa)
Score = 986, Expect = 2.7e-104, Identities = 213/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+E+E
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAE 527
>gi|46906409|ref|YP_012798.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|67461803|sp|Q724N6|SYM_LISMF Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|46879673|gb|AAT02975.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] (665 aa)
Score = 986, Expect = 2.7e-104, Identities = 213/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+E+E
  S:     4 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAE 528
>gi|153165143|ref|ZP_01926161.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] >gi|167013640|ref|ZP_02276173.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL J1-194] >gi|133728462|gb|EBA30160.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] (664 aa)
Score = 986, Expect = 2.8e-104, Identities = 213/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+E+E
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAE 527
>gi|126654257|ref|ZP_01726045.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp. B14905] >gi|126589290|gb|EAZ83448.1| methionyl-tRNA synthetase (methionine--tRNA ligase) [Bacillus sp. B14905] (658 aa)
Score = 980, Expect = 1.2e-103, Identities = 207/520 (39%), Positives = 308/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPE---PIYLRIESE 1085
           E  K FYITTPIYYPSG  HIG A+TT+ +D + RYK+  GY+  F+TGMDEHGQKI+EKA E    PQ+ V++ A+    LW L+ I Y  FI+TT E H   V++ F + L    IY G ++G YC  CE  +T+   V     D   C +  P+ + +EESYF  +K++  + +S + ++   + P +R NE+ N+F+     +DLS+SR++F WGI++  +PKHV+YVW+DAL NY++ LGY   D++ F K+W +     V ++ K+I RFH IYWPI L  L L  P K  +HG+I+ + GKMSKS GNV+ P   I  YG DA RY+LL+EL    D VFS +  I   N DLAN++GNL NR+I MINKY DGIIP  +     F+   ++Q +    +    +EK+    +L+ +  L++  N +I++ +PW L KE  +K  L   +  +  ++ ++   L+P +    K  ++Q  +D        +  F +     I   E   PI+ R+E+E
  S:     3 EQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGYDVRFLTGMDEHGQKIQEKAAEAGKHPQDYVNEIAEAAKKLWALMDISYDDFIQTTQERHTKAVEKIFQKFLDNGDIYKGEYEGWYCTPCESFFTETQLVDGNCPD---CGR--PVHKVKEESYFFNMKKYADRLLSYYEENLGFIEPESRKNEMINNFIK-PGLEDLSVSRTSFDWGIKVPGDPKHVIYVWVDALTNYITSLGYLSDDETLFNKYWPAD----VHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDLGNLLNRTISMINKYYDGIIPSENLQSTEFDAALKEQAESVRIKYEESMEKMQFSVVLADLWTLVSRTNKYIDETQPWVLAKEEADKPKLGSVMRNLAESLHQIAVMLQPFMTTIPKRMMEQLGLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRLENE 517
>gi|16802223|ref|NP_463708.1| methionyl-tRNA synthetase [Listeria monocytogenes EGD-e] >gi|153172823|ref|ZP_01928797.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] >gi|153177834|ref|ZP_01931599.1| methionyl-tRNA synthetase [Listeria monocytogenes F6900] >gi|153186201|ref|ZP_01936585.1| methionyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|153189345|ref|ZP_01937020.1| methionyl-tRNA synthetase [Listeria monocytogenes J2818] >gi|153198396|ref|ZP_01942446.1| methionyl-tRNA synthetase [Listeria monocytogenes 10403S] >gi|167211226|ref|ZP_02281533.1| methionyl-tRNA synthetase [Listeria monocytogenes LO28] >gi|25009372|sp|Q8YAF2|SYM_LISMO Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|16409534|emb|CAC98392.1| methionyl-tRNA synthetase [Listeria monocytogenes] >gi|126941340|gb|EBA19229.1| methionyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|127631998|gb|EBA21715.1| methionyl-tRNA synthetase [Listeria monocytogenes 10403S] >gi|127766781|gb|EBA27106.1| methionyl-tRNA synthetase [Listeria monocytogenes J2818] >gi|133731347|gb|EBA33045.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] >gi|133733909|gb|EBA35607.1| methionyl-tRNA synthetase [Listeria monocytogenes F6900] (664 aa)
Score = 979, Expect = 1.6e-103, Identities = 212/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+++E
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQILVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAE 527
>gi|47096170|ref|ZP_00233769.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|47015418|gb|EAL06352.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] (665 aa)
Score = 979, Expect = 1.6e-103, Identities = 212/520 (40%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+++E
  S:     4 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQILVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAE 528
>gi|76799721|ref|ZP_00781816.1| methionyl-tRNA synthetase [Streptococcus agalactiae 18RS21] >gi|76584925|gb|EAO61588.1| methionyl-tRNA synthetase [Streptococcus agalactiae 18RS21] (475 aa)
Score = 977, Expect = 2.8e-103, Identities = 188/468 (40%), Positives = 293/468 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEP 1036
           K FYITTPIYYPSG  HIG A+TT+  DVL RYK+ +G++  ++TG+DEHGQKI++KA+E  + PQE VD  A+    LW+LL I Y  FIRTT  YH+  V + F +LL +  IYLG + G Y VS EE +T++      R EN + +       H + +  EESYF ++ ++   + ++  + P  + P  R+NE+  +F+     +DL++SR+ ++WG+Q+  NPKHV+YVW+DAL+NY+S LGY   DD S + KFW +     + ++ K+I RFH IYWPIML  L L  P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR+I M+NKY DG +P+++     F+ +         +     +E ++  + L  V +LI+  N +I++  PW L K+  ++D L   +S ++ +++ V + ++P
  S:     5 KSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIYLGEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFI-EPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPAD----IHMIGKDILRFHSIYWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVAT-DFDADLASVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLAAVMSHLVASLRVVAHLIQP 474
>gi|116617428|ref|YP_817799.1| methionyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096275|gb|ABJ61426.1| methionyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (702 aa)
Score = 976, Expect = 3.4e-103, Identities = 204/519 (39%), Positives = 307/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDD--KLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSSLDN--QKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG   +G+ +TT++AD   RY + LG + +F+TG DEHG KI++KA+   +   + +D  AK   +LWKL+ I Y  FIRTT + H+  V + F++LL+   IY G ++G Y VS EE +T++       DD  K+   +    H +   +EE+YF K+ ++  ++  + K  P  + P  R+NE+ N+F+     +DL+++R++F WGI +  + KHV+YVW+DAL NY++ LGY   D + F KFW +     VQL+ KEI RFH IYWPIML  LGL  P   + HGW++ + GKMSKS GNV+ P      YG DA RYYLL+ +    D VF+ +  +   N DLAN++GNL NR++ MINKY DG+IP+    K SF+ +  + ++    E     ++L     L  V  +I   N +I++ +PW L K+ NEK+ L   ++ +  A++     L+PVL    K+   Q  +D S   +      FS L      +   EPI+ R + E++
  S:    37 KTFYITTPIYYPSGKLQLGNTYTTVLADAAARYHRLLGEDVYFLTGTDEHGLKIQQKAEAAGISEIDFLDGMAKQIKDLWKLMDISYDDFIRTTEDRHEKAVAKIFTQLLENGDIYKGEYEGWYSVSDEEYFTESQLAEVYRDDAGKVIGGKAPSGHEVELVKEEAYFFKMSKYADWLLDYYKTHPEFIQPEARMNEMINNFIA-PGLEDLAVTRTSFDWGISVPGDEKHVIYVWIDALANYITALGYNSDDTTLFDKFWPAN----VQLVGKEIVRFHTIYWPIMLHALGLELPKSVVGHGWLVMKDGKMSKSKGNVIYPEVLEERYGLDAVRYYLLRSMPFGNDGVFTPEDFVARVNYDLANDLGNLLNRTVAMINKYVDGVIPELLTGKTSFDEDLVRTVEDAIVEYNKNFKELRTADALESVWKIIRRANKYIDETQPWVLAKDENEKEVLSSVMAHLAGALRVTAVLLQPVLTQAPKKIFDQLGLDYSDKGVAIAGLTFSKLPTGGHVVKKGEPIFPRQDVEEE 560
>gi|168209762|ref|ZP_02635387.1| methionyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] >gi|168217641|ref|ZP_02643266.1| methionyl-tRNA synthetase [Clostridium perfringens NCTC 8239] >gi|170712109|gb|EDT24291.1| methionyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] >gi|182380303|gb|EDT77782.1| methionyl-tRNA synthetase [Clostridium perfringens NCTC 8239] (645 aa)
Score = 975, Expect = 4.7e-103, Identities = 202/519 (38%), Positives = 312/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q+D   ++KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY DG+I +    K + + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQEDQELYKKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFDGVI-QAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKIDAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|146295253|ref|YP_001179024.1| methionyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408829|gb|ABP65833.1| methionyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (655 aa)
Score = 975, Expect = 5.0e-103, Identities = 204/513 (39%), Positives = 302/513 (58%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-------DNQKINTPEPIYLRI 1082
           KFYITTPIYYPS   HIGH + T+ AD L RYK+  GY+ FF+TG DEHGQKIE KA+E+   PQ+ VD+      +LWKL+ I Y  FIRTT E HK VVQ+ F++L ++  IY   ++G YC  CE  +     V  +  D   C +  P+ +  EESYF ++ +++  +  ++++ P+ + P +R NE+ N+F+     +D+ +SR+   WGI +  +PKHV+YVW+DAL NY++ LGY  +DDS F+K+W +     V L+ KEI RFH I WP ML  LGL  P     HGW++ E GKMSKS GNV+DP+     YG D+ RY+LL+E+    D  FSE  L    N DLAN++GNL +R++ MI KY DGII    + K   + E     K+  +++   +++L     L  +  LI   N +I++  PW L ++ ++   L   L  +   ++ V   +EP +   + + L Q  I  SK +   +T + S        D  K+   +P++ RI
  S:     5 KFYITTPIYYPSDKLHIGHTYCTVAADTLARYKRLQGYDVFFLTGTDEHGQKIERKAQEVGKTPQKYVDEIVASIKDLWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYKSEYEGWYCTPCESFWLDRQLVDGKCPD---CGR--PVERAREESYFFRLSKYQDALVKYIEEHPDFIVPQSRANEMINNFI-KPGLEDVCVSRTTLKWGIPVPFDPKHVIYVWIDALSNYITALGYMSEDDSKFKKYWPAD----VHLVGKEIVRFHTIIWPAMLMALGLPLPKMVFGHGWLLLEGGKMSKSKGNVVDPVVLAQKYGVDSLRYFLLREIPFGADGYFSEDALKTRHNSDLANDLGNLLSRTVAMIEKYFDGII-HLPEVKEDLDNELITLAKEVYEKVCKCLDELQFSNALIEIWKLIARANKYIDETMPWVLGRDKSKHPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKMLAQLGI--SKDENPDITSWESAATFGLIRDGTKVKRDQPLFPRI 513
>gi|110801166|ref|YP_697211.1| methionyl-tRNA synthetase [Clostridium perfringens ATCC 13124] >gi|110675813|gb|ABG84800.1| methionyl-tRNA synthetase [Clostridium perfringens ATCC 13124] (645 aa)
Score = 975, Expect = 5.4e-103, Identities = 202/519 (38%), Positives = 312/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q+D   ++KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY DG+I +    K + + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQEDQELYKKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFDGVI-QAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKIDAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|169825668|ref|YP_001695826.1| methionyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] >gi|168990156|gb|ACA37696.1| Methionyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] (663 aa)
Score = 973, Expect = 9.1e-103, Identities = 206/520 (39%), Positives = 307/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPE---PIYLRIESE 1085
           E  K FYITTPIYYPSG  HIG A+TT+ +D + RYK+  GY+  F+TGMDEHGQKI+EKA E    PQ+ V++ A+    LW L+ I Y  FI+TT E H   V++ F + L    IY G ++G YC  CE  +T+   V     D   C +  P+ + +EESYF  +K++  + ++ + ++   + P +R NE+ N+F+     +DLS+SR++F WGI++  + KHV+YVW+DAL NY++ LGY   D++ F K+W +     V ++ K+I RFH IYWPI L  L L  P K  +HG+I+ + GKMSKS GNV+ P   I  YG DA RY+LL+EL    D VFS +  I   N DLAN++GNL NR+I MINKY DGIIP  +     F+   ++Q +    +    +EK+    +L+ +  L++  N +I++ +PW L KE  +K  L   +  +  ++ ++   L+P +    K  ++Q  +D        +  F +     I   E   PI+ R+ESE
  S:     8 EQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKRLRGYDVRFLTGMDEHGQKIQEKAAEAGKHPQDYVNEIAESAKKLWALMDITYDDFIQTTQERHTKAVEKIFQKFLDNGDIYKGEYEGWYCTPCESFFTETQLVDGNCPD---CGR--PVHKVKEESYFFNMKKYADRLLAYYEENLEFIEPESRKNEMINNFIK-PGLEDLSVSRTSFDWGIKVPGDAKHVIYVWVDALTNYITSLGYLSDDETLFNKYWPAD----VHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGSDGVFSPESFIERTNFDLANDLGNLLNRTISMINKYFDGIIPSENLQSTEFDAALKEQAESVRIKYEESMEKMQFSVVLADLWTLVSRTNKYIDETQPWVLAKEEADKPKLGTVMRNLAESLHQIAVMLQPFMTTTPKRMMEQLGLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFPRLESE 522
>gi|15828961|ref|NP_326321.1| methionyl-tRNA synthetase [Mycoplasma pulmonis UAB CTIP] >gi|14424467|sp|Q50319|SYM_MYCPU Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|14089904|emb|CAC13663.1| METHIONYL-TRNA SYNTHETASE (METHIONINE--TRNA LIGASE) (METRS) [Mycoplasma pulmonis] (509 aa)
Score = 972, Expect = 1.1e-102, Identities = 226/515 (43%), Positives = 324/515 (62%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSF-------NIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           K  YITTPIYYPSG+ H+GH ++T IA VL  YKK  GYETFF TG DEHGQKI  KA+EL L+ Q+ VD+ A  F + WK   I+Y  F RTT + HK VV+E F +L +K+ IYL  + GLY VS EE  T+  A++K+N    +    H LI+ EEESYF  +  F  +I  FL D +++     +NEL ++F+N    ++LS++R    WGI+I ++ KHV+YVWLDAL  YL+ LGY  K+ S ++KFW + D E V ++ KEITRFHCIYWPI L+ L ++ PTK ISHGWI+T +GKMSKS GNV+DP+  I  YG +  +Y+L+ +LS+K+D VFSE+LL++ +N DL N   NL +R++ M       I+  Y +P LSF       ++E EK +K   +   +  E+    K     I+L  + N +I++ +PW L KE  ++ L+  L+ +LN +  + + L  V+   S++  K    +S  F+   + DF   DN KI   E ++ RI+
  S:     3 KTIYITTPIYYPSGDLHLGHIYSTNIAWVLRNYKKIQGYETFFSTGSDEHGQKIFNKAQELKLETQDYVDRQANKFIDFWKKANIDYDFFARTTNKEHKEVVREIFHKLKEKNIIYLDKYVGLYSVSDEEFLTETQALKKDN-KFFHPVSNHELIKIEEESYFFNLNLFIDWIKEFL-DQDIISSKAIVNELKSNFINK-GLENLSVTRIKLDWGIKIDQSSKHVIYVWLDALFQYLTNLGYGSKNQSLYEKFWKNGD-ERVHVVGKEITRFHCIYWPIFLKSLNVKMPTKIISHGWIVTPEGKMSKSKGNVVDPVVLIEKYGSEVLKYFLIAKLSIKKDGVFSEELLVSAYNNDLVNTFSNLISRTVKM-------ILNNYDRP-LSFILSKDQEDLEIEKDIKNSFETFCSFAEEYEFDKAFESTINLGKKLNLYIDKTRPWLLTKE--DQKLEIVLNRLLNGIYAMAFELSIVMPQTSQKLAKALGFES--FEKSKLEDFKKFDNIKIEKIENLFNRIK 508
>gi|118475810|ref|YP_892961.1| methionyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] >gi|118415035|gb|ABK83454.1| methionyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] (669 aa)
Score = 971, Expect = 1.6e-102, Identities = 203/520 (39%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:    12 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWESLSTIGCIPAGTKVEKGQPIFPRLEMD 535
>gi|118445100|ref|YP_879163.1| methionyl-tRNA synthetase [Clostridium novyi NT] >gi|118135556|gb|ABK62600.1| methionyl-tRNA synthetase [Clostridium novyi NT] (646 aa)
Score = 970, Expect = 1.7e-102, Identities = 203/517 (39%), Positives = 312/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFE--KQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD----NQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPS   HIG+ +TT+ AD + R+K+  GY+T+F+TG DEHGQKI+  A+   + P++ VD+      +LWK++ I Y  FIRTT +YH   VQ+ F +L  K  IY G ++GLYC  CE  +T+   V  +  D   C +  P+ + +EE+YF K+ ++   +  +++  P+ + P +R NE+ N+FL      DL ISR++F WGI +  + KHV+YVW+DAL NY++ LGY Q++D  +QK+W +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL E+   +D +++ +  I   N DLAN++GNL NR+I MINKY DG+IP    PK   +I+ +  +   +   ++   ++ L I + L  +  L+   N +I++  PW L KE ++++ L   L  ++ +++ V   L   L + SK+   Q N+  + +D       +S D      K+     I+ RI+ E K
  S:     6 FYITTPIYYPSAKLHIGNTYTTVAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEGKGITPKKYVDEIVAGIQDLWKVMNISYDKFIRTTDDYHVETVQKIFEKLYDKGDIYKGEYEGLYCTPCESFWTETQLVDGKCPD---CGR--PVEKTKEEAYFFKMSKYADRLIEYIESHPDFIQPESRKNEMLNNFL-RPGLQDLCISRTSFDWGIPVSFDEKHVIYVWIDALSNYITALGYDQENDELYQKYWPAN----VHLVGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVTLVNEFGTDPVRYYLLHEIPFGQDGMYTGETFIKKTNSDLANDLGNLVNRTIAMINKYFDGVIP---APKAEEDIDNDLIRVALEAPKKVEGKMDALKIPEALDEIWTLVRRSNKYIDETMPWALAKEEDKRERLGTVLYNLVESLRIVSVMLSAFLPETSKKINSQLNVQLATWD-----SIASFDGTRAGTKVGEAVAIFPRIDVEKK 512
>gi|169343256|ref|ZP_02864267.1| methionyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|182624314|ref|ZP_02952099.1| methionyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|169298554|gb|EDS80635.1| methionyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|177910532|gb|EDT72905.1| methionyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] (645 aa)
Score = 970, Expect = 1.8e-102, Identities = 201/519 (38%), Positives = 312/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q++   ++KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY DG+I +    K + + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYKKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFDGVI-QAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKIDAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|52145179|ref|YP_081651.1| methionyl-tRNA synthetase [Bacillus cereus E33L] >gi|51978648|gb|AAU20198.1| methionine--tRNA ligase (methionyl-tRNA synthetase) [Bacillus cereus E33L] (660 aa)
Score = 969, Expect = 2.1e-102, Identities = 203/520 (39%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|196041780|ref|ZP_03109070.1| methionyl-tRNA synthetase [Bacillus cereus NVH0597-99] >gi|196027400|gb|EDX66017.1| methionyl-tRNA synthetase [Bacillus cereus NVH0597-99] (660 aa)
Score = 969, Expect = 2.1e-102, Identities = 203/520 (39%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKIVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWESLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|196047404|ref|ZP_03114617.1| methionyl-tRNA synthetase [Bacillus cereus 03BB108] >gi|196021806|gb|EDX60500.1| methionyl-tRNA synthetase [Bacillus cereus 03BB108] (660 aa)
Score = 969, Expect = 2.5e-102, Identities = 203/520 (39%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWESLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|168205784|ref|ZP_02631789.1| methionyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] >gi|170662741|gb|EDT15424.1| methionyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] (645 aa)
Score = 968, Expect = 2.9e-102, Identities = 201/519 (38%), Positives = 311/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q++   + KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY DG+I +    K + + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYNKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFDGVI-QAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|110803560|ref|YP_699780.1| methionyl-tRNA synthetase [Clostridium perfringens SM101] >gi|110684061|gb|ABG87431.1| methionyl-tRNA synthetase [Clostridium perfringens SM101] (645 aa)
Score = 968, Expect = 3.3e-102, Identities = 201/519 (38%), Positives = 312/519 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q++   ++KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY DG+I +    K + + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYKKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFDGVI-QAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINDQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|163938046|ref|YP_001642930.1| methionyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] >gi|163860243|gb|ABY41302.1| methionyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] (660 aa)
Score = 967, Expect = 4.4e-102, Identities = 203/520 (39%), Positives = 307/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD----NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT +  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +       K     S++       K+    PI+ R+E E
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVSGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHAVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTEEAH--KSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|49477589|ref|YP_034392.1| methionyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166997037|ref|ZP_02263496.1| methionyl-tRNA synthetase [Bacillus cereus AH820] >gi|196036355|ref|ZP_03103752.1| methionyl-tRNA synthetase [Bacillus cereus W] >gi|49329145|gb|AAT59791.1| methionine--tRNA ligase (methionyl-tRNA synthetase) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195990985|gb|EDX54956.1| methionyl-tRNA synthetase [Bacillus cereus W] (660 aa)
Score = 967, Expect = 4.5e-102, Identities = 202/520 (38%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ ++++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|166985347|ref|ZP_02256631.1| methionyl-tRNA synthetase [Bacillus cereus AH187] (660 aa)
Score = 966, Expect = 5.3e-102, Identities = 202/517 (39%), Positives = 310/517 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +      ++    +    K+   +PI+ R+E +
  S:     6 KSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPSNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHISWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|168163590|ref|ZP_02598823.1| methionyl-tRNA synthetase [Bacillus cereus H3081.97] (660 aa)
Score = 965, Expect = 7.7e-102, Identities = 202/517 (39%), Positives = 310/517 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +      ++    +    K+   +PI+ R+E +
  S:     6 KSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHISWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|168144511|ref|ZP_02587740.1| methionyl-tRNA synthetase [Bacillus cereus G9842] (660 aa)
Score = 964, Expect = 8.5e-102, Identities = 201/520 (38%), Positives = 310/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     L  +  L++  N +I++ +PW L K+ N+++ L   ++ +   ++++   L P L     +   Q  + D +    + ++    +    K+    PI+ R+E E
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQIGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|42779117|ref|NP_976364.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 10987] >gi|42735032|gb|AAS38972.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 10987] (660 aa)
Score = 964, Expect = 9.4e-102, Identities = 205/517 (39%), Positives = 307/517 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       +    ++   +E +     LS +  LI+  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+    PI+ R+E E
  S:     6 KSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRM---GKYVDRLLKFYEENPHFIQPESRKNEMINNFI-KPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDGTLVTFAQDTLKKVEEAMENMEFSVALSSIWQLISRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTEEAH-----TSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|18311506|ref|NP_563440.1| methionyl-tRNA synthetase [Clostridium perfringens str. 13] >gi|25009370|sp|Q8XHG1|SYM_CLOPE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|18146190|dbj|BAB82230.1| methionine-tRNA ligase [Clostridium perfringens str. 13] (645 aa)
Score = 963, Expect = 1.2e-101, Identities = 201/519 (38%), Positives = 311/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q++   ++KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY  G+I  P   +P    + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYKKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFGGVIQAPTCKEP---IDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|75759600|ref|ZP_00739686.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492891|gb|EAO56021.1| Methionyl-tRNA synthetase / Protein secretion chaperonin CsaA [Bacillus thuringiensis serovar israelensis ATCC 35646] (669 aa)
Score = 963, Expect = 1.3e-101, Identities = 201/520 (38%), Positives = 309/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     L  +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +    + ++    +    K+    PI+ R+E E
  S:    12 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGNPIFPRLEME 535
>gi|168187465|ref|ZP_02622100.1| methionyl-tRNA synthetase [Clostridium botulinum C str. Eklund] >gi|169294617|gb|EDS76750.1| methionyl-tRNA synthetase [Clostridium botulinum C str. Eklund] (646 aa)
Score = 962, Expect = 1.4e-101, Identities = 201/517 (38%), Positives = 310/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFE--KQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD----NQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPS   HIG+ +TT+ AD + R+K+  GY+T+F+TG DEHGQKI+  A+   + P+  VD+      +LWK++ + Y  FIRTT +YH   VQ+ F +L  +  IY G ++GLYC  CE  +T+   V  +  D   C +  P+ + +EE+YF K+ ++   +  +++  P+ + P +R NE+ N+FL      DL ISR++F WGI +  + KHV+YVW+DAL NY++ LGY Q++D  +QK+W +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL E+   +D +++ +  I   N DLAN++GNL NR+I MINKY DG+IP    PK   +I+ +  +   +   ++   ++ L I + L  +  L+   N +I++  PW L KE ++++ L   L  ++  ++ V   L   L + SK+   Q N+  + +D       +S D      K+     I+ RI+ E K
  S:     6 FYITTPIYYPSAKLHIGNTYTTIAADAIARFKRLTGYDTYFLTGTDEHGQKIQRLAEGKGITPKAYVDEIVADIKDLWKIMNVSYDKFIRTTDDYHIETVQKIFKKLYDQGDIYKGEYEGLYCTPCESFWTETQLVDGKCPD---CGR--PVEKTKEEAYFFKMSKYADRLIEYIESHPDFIQPESRKNEMLNNFL-RPGLQDLCISRTSFDWGIPVSFDEKHVIYVWIDALSNYITALGYDQENDELYQKYWPAN----VHLVGKDILRFHTIYWPIMLIALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVTLVNEFGTDPVRYYLLHEIPFGQDGMYTGETFIKKTNSDLANDLGNLVNRTIAMINKYFDGVIP---APKAEEDIDNDLIRVALEAPKKVEGKMDALKIPEALDEIWTLVRRSNKYIDETMPWALAKEEDKRERLGTVLYNLVEGLRIVSVMLSAFLPETSKKINSQLNVQLATWD-----SIASFDGTRAGTKVGEAVAIFPRIDVEKK 512
>gi|161506812|ref|YP_001576766.1| methionyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] >gi|160347801|gb|ABX26475.1| Methionyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] (658 aa)
Score = 962, Expect = 1.5e-101, Identities = 200/517 (38%), Positives = 306/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV--TDFSSLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG   IG+A+TT+ AD + RYK+  GY+TFF+TG DEHG KIE+KA+   +KPQE VDK A  +  LWK L I Y  FIRTT E H   VQ+ F +LLKK  IYLG + G Y V  EE +T++    V K+++  +   +    H +   +E SYF K+ ++   +  + K+ P  + P +R  E+ N+F+     +DLS++R+  +WGI +  +PKHVVYVW+DAL NY++ LGY    D  F+K+W +     V L+ KEI RFH IYWPIML  L L  P   I HGW++ + GKMSKS GN + P    + YG D  RYYL++ L    D +F+ +  I   N DLAN++GNL NR++ MIN+Y+DG +      +     + +        +    ++ L+  + L  +  L+   N +I++  PW L KE  + +L   +S +  +++ +   + PV+ + + +  +Q  ++    D K +   DF   + + +  P+PI+ R+++E++
  S:     7 FYITTPIYYPSGRLTIGNAYTTIAADTMARYKRSQGYDTFFLTGTDEHGLKIEQKAEAQGIKPQEFVDKMAASYKKLWKSLDISYDKFIRTTDEEHVKAVQKIFEKLLKKGDIYLGEYTGWYSVEDEEYFTESQLAEVYKDDNGNVIGGKAPSGHEVRLVKEPSYFFKMSKYADRLVEYYKEHPEFILPHSREKEMLNNFI-KPGLEDLSVTRTTVNWGIPVPSDPKHVVYVWIDALSNYITALGYGSDHDELFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKHIIGHGWVLMKNGKMSKSKGNAVYPESLTSRYGIDPLRYYLMRALPFGADGIFTPEDFIERINYDLANDLGNLLNRTVSMINQYQDGQVAPVPVAQDKLGKDLQDTAASVIADYREQMDSLHFSQALDSIWKLVARANKYIDETTPWVLNKEGKKDELSHVMSNLAESLRLIAIMIYPVMTETAPKMFEQLGLNWDDEDQKNLAFNDF-GWNTKVVEKPKPIFPRLKAEEE 525
>gi|58336554|ref|YP_193139.1| methionyl-tRNA synthetase [Lactobacillus acidophilus NCFM] >gi|58253871|gb|AAV42108.1| met-tRNA synthetase [Lactobacillus acidophilus NCFM] (658 aa)
Score = 962, Expect = 1.5e-101, Identities = 198/517 (38%), Positives = 311/517 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV--TDFSSLDNQKINTPEPIYLRIESEDK 1087
           FYITTPIYYPSG   IG+A+TT+ AD + RYK+  G++TFF+TG DEHG KIE+KA+   +KP+E VDK A  +  LWK L I Y  FIRTT E H   VQ+ F +LLKK  IYLG + G Y V  EE +T++    V K+++  +   +    H +   +E SYF K+ ++   +  + K+ P+ + P +R  E+ N+F+     +DLS++R+  +WGI +  +PKHVVYVW+DAL NY++ LGY   +D+ F+K+W +     V L+ KEI RFH IYWPIML  L L  P   I HGW++ + GKMSKS GN + P    + YG D  RYYL++ L    D +F+ +  +   N DLAN++GNL NR++ MIN+Y++G +      +  F  E +        +    ++ L+  + L  +  L+   N +I++  PW L KE   ++L   +S +  +++ +   +EPV+ + + +  +Q  ++ +  D + +   DF   + + +  P PI+ R+++E++
  S:     7 FYITTPIYYPSGRLTIGNAYTTIAADTMARYKRSQGFDTFFLTGTDEHGLKIEQKAEAQGIKPKEFVDKMADSYKKLWKSLNISYDKFIRTTDEEHVKAVQKIFEKLLKKGDIYLGEYTGWYSVEDEEYFTESQLAEVYKDDNGNVIGGKAPSGHEVRLVKEPSYFFKMSKYADRLVEYYKEHPDFILPHSREKEMLNNFI-KPGLEDLSVTRTTVNWGIPVPSDPKHVVYVWIDALSNYITALGYGSDNDALFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKHIIGHGWVLMKNGKMSKSKGNAVYPESLTSRYGVDPLRYYLMRALPFGADGIFTPEDFVERINYDLANDLGNLLNRTVSMINQYQNGQVAPVPVAQDKFGKELQDTAASVIADYREYMDSLHFSQALDSIWKLVARANKYIDETTPWVLNKEGKIEELSHVMSNLAESLRLIAVMIEPVMTETAPKMFEQLGLNWNDEDERKLAFNDF-GWNTKVVEKPTPIFPRLKAEEE 525
>gi|30260228|ref|NP_842605.1| methionyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47777767|ref|YP_016640.2| methionyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183072|ref|YP_026324.1| methionyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|65317498|ref|ZP_00390457.1| COG0143: Methionyl-tRNA synthetase [Bacillus anthracis str. A2012] >gi|167635109|ref|ZP_02393426.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|167641535|ref|ZP_02399783.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|170688925|ref|ZP_02880127.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|170707587|ref|ZP_02898040.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|177655324|ref|ZP_02936853.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190569007|ref|ZP_03021908.1| methionyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] >gi|38258301|sp|Q81W03|SYM1_BACAN Methionyl-tRNA synthetase 1 (Methionine--tRNA ligase 1) (MetRS 1) >gi|30253549|gb|AAP24091.1| methionyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47551472|gb|AAT29115.2| methionyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49176999|gb|AAT52375.1| methionyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|167510520|gb|EDR85918.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|167529583|gb|EDR92333.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|170127583|gb|EDS96457.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|170667149|gb|EDT17910.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|172080165|gb|EDT65258.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190559931|gb|EDV13915.1| methionyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] (660 aa)
Score = 962, Expect = 1.6e-101, Identities = 202/520 (38%), Positives = 308/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK   GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ ++++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|20806639|ref|NP_621810.1| methionyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] >gi|25009362|sp|Q8RDD1|SYM_THETN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|20515086|gb|AAM23414.1| Methionyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] (638 aa)
Score = 962, Expect = 1.7e-101, Identities = 193/483 (39%), Positives = 291/483 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           K FYITTPIYYPS   HIGH++TT+ AD + R+K+  GY+  F+TG DEHGQKI+  A+E  + P+E VD   +   +LWK + I Y HFIRTT  YH+ +VQ+ F +L ++  IY G ++G YC  CE  +T++  V  +  D   C +  P+ +  EE YF ++  +  K +  + + P+ + P +R NE+ N        +DL +SRS F WGI++  +PKHV+YVW+DAL NY++ LGY  ++D  F+K+W +     V L+ KEI RFH I WP ML  LGL  P K   HGW+I E GKMSKS GNV+DP   ++ YG DA RY+LL+E+    D VFS + LIN  N DLAN++GNL +R++ MI KY DG++PK S  +   + +     +    ++   ++KL     L  +  L++  N +I++  PW L K+ +++  L   L  +  +++ +   + P + +  K+  +Q  I
  S:     3 KTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRIAREKGMSPKEYVDGIVEWIKDLWKTMDISYDHFIRTTDAYHEEIVQKIFMKLYEQGDIYKGEYEGWYCTPCESFWTESQLVDGKCPD---CGR--PVERVTEEGYFFRLSAYGDKLLKYYEEHPDFIQPESRRNEMINFI--KAGLEDLFVSRSTFDWGIKVPFDPKHVIYVWIDALSNYITALGYMTENDEKFKKYWPAD----VHLVGKEIVRFHTIIWPAMLMALGLPLPKKVFGHGWLILEGGKMSKSKGNVVDPKELVDRYGVDAIRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLSRTVTMIEKYFDGVLPKPSSQE-EIDEDLINVAQNLPQKVEEYMDKLQFSNALIEIWKLVSRANKYIDETMPWVLAKDESKRGRLGTVLYNLAESLRFIGILISPFMPNTPKKMFEQLGI 475
>gi|168138193|ref|ZP_02581422.1| methionyl-tRNA synthetase [Bacillus cereus B4264] (660 aa)
Score = 962, Expect = 1.7e-101, Identities = 204/520 (39%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + K  ++   EF++ L  F  +    +   +E +     L  +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +    + ++    +    K+    PI+ R+E E
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFI-KPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAF-KANVT---EFDETLVAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|13507762|ref|NP_109711.1| methionyl-tRNA synthetase [Mycoplasma pneumoniae M129] >gi|2501031|sp|P75091|SYM_MYCPN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|1673790|gb|AAB95779.1| methionyl-tRNA synthetase [Mycoplasma pneumoniae M129] (512 aa)
Score = 962, Expect = 1.7e-101, Identities = 211/516 (40%), Positives = 298/516 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNL-VYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDA--EIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDD-------EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP---EPIYLRIE 1083
           MK+ YITTPIYY SG PHIGHAFTT++ADV+ RYK++ GYE +F+TG DEHG KIE KAK L L PQ  VD+    F  +WK L I + HFIRTT   HK  VQ  F  L  K  IY   W+G YCV CE+NY         +   + C   H L   +E S F+  K  K +I   +    L + P +R  EL N+FL+    +DL+++R N +WGI +  + K  +YVW DAL NY++ LG+   +D  F K+WN+ D   E++ L+S+EITRFHCIYWPI L  LG + PT+++SHGWI+   G KMSKSLGNV+ P   +  +G D  RY LLKE+ L +D+  S  +  + +N DLAN+ GN  +R+ GMI KY  G        +L F    + Q+KQ  D       +  T        K ++ ++ L+ + +  I+Q+KPW+L K+ +   L   L   +   +     L P+L+  S +    FN  +       + D   L  QKI+     +P++ R++
  S:     1 MKRCYITTPIYYASGKPHIGHAFTTILADVIKRYKQQNGYEAYFLTGTDEHGNKIESKAKSLGLDPQTFVDQNVAYFQQMWKQLDINFDHFIRTTDLSHKAQVQHAFQLLYDKGLIYQSNWEGAYCVECEQNYF------TYDKQTMLCEIGHQLTLVQEPSLFIAFKDSKDWIGEMIATNKLNITPESRAAELKNNFLDG-GLNDLALTRQNVTWGIPVPFDNKQTIYVWFDALFNYITNLGFAH-NDPKFNKWWNNNDEEHEVIHLISREITRFHCIYWPIFLHQLGFKLPTQFLSHGWIVDGNGHKMSKSLGNVISPEELLAQFGVDGTRYCLLKEMRLDKDNRCSMAIFKDIYNADLANSFGNHASRTFGMIKKYLGG--------QLDFIEVQDPQVKQLMDQANQAMVQFDTAWNNFQFYKGINGLLQLVFQASKLIDQLKPWELVKQTDYTLLKQLLFACVRCTQVCFVLLAPILVHTSTQIFDLFNFSAQARSKTHLADPQQL--QKISLAPVIQPLFKRLD 512
>gi|168213448|ref|ZP_02639073.1| methionyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] >gi|170715012|gb|EDT27194.1| methionyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] (645 aa)
Score = 961, Expect = 1.8e-101, Identities = 201/519 (38%), Positives = 310/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS-SLDNQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS N HIG+ +TT+ AD + R+K+  G+E  F+TG DEHGQKIE  A E  + P+E VD+      +LWK++ I Y  FIRTT +YH   VQE F +L  +  IY   ++GLYC  CE  +T+   V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F+WGI +  + KHV+YVW+DAL NY++ LGY Q++   + KFW +     V L+ K+I RFH IYWPIML  LGL  P +   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+I M+ KY  G+I  P   +P    + E          ++   I+ L I + L  +  LI+  N +I++  PW L K+  +K+ L   L  +L  ++ V   + P L + S +   Q N   + ++   + +F+ ++   K+   + I+ RI+ E+K
  S:     4 KPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPD---CGR--PVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYNKFWPAD----VHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFGGVIQAPTCKEP---IDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINAQLNTKVTTWES--LKEFNGTVAGDKVVKGDVIFPRIDVEEK 512
>gi|167938134|ref|ZP_02525209.1| methionyl-tRNA synthetase [Bacillus cereus AH1134] (660 aa)
Score = 961, Expect = 2.1e-101, Identities = 204/520 (39%), Positives = 314/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +     N+ EF++ L  F  +    +   +E +     L  +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +    + ++    +    K+    PI+ R+E E
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFI-KPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKE-----NVTEFDETLVAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|125974586|ref|YP_001038496.1| methionyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] >gi|125714811|gb|ABN53303.1| methionyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] (654 aa)
Score = 961, Expect = 2.2e-101, Identities = 201/515 (39%), Positives = 307/515 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS---SLDNQKINTPEPIYLRIE 1083
           K FYITTPIYYPS   HIGH++TT+ AD + RYK+  GY+  F+TG DEHGQKIE KAKE  + P++ VD+       LWKLL I    FIRTT  +H+  VQ+ F +L  +  IY   ++G YC  CE  +TK   V  +  D   C +   L +  EESYF ++ +++ + I    ++P+ + P++R NE+ N+FL     +DL +SR+ F WGI +  + KHVVYVW+DAL NY++ L Y  +DDS+++K+W +     V L+ KEI RFH I WP ML  LG   P +   HGW++ E GKMSKS GNV+DP+  +  YG DA RY+LL+E+    D VFS + LIN  N DLAN++GNL +R++ MI+KY  G +P+  +    F+ +  K +     ++  ++++L     L+ +   I+  N +I++  PW L K E N+  L   L  +  +++ V   ++P + +  ++   Q  I+  K+ +++ T        +   +N  EP++ RI+
  S:     4 KTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHGQKIERKAKEKGVTPKQYVDEIVAGIKELWKLLKITNDRFIRTTDPHHEKTVQKIFKKLYDQGDIYKSEYEGWYCTPCESFWTKTQLVDGKCPD---CGREVELTK--EESYFFRLSKYQDRLIKHIEENPDFIQPVSRQNEMLNNFL-RPGLEDLCVSRTTFDWGIPVSFDDKHVVYVWIDALSNYITALNYMSEDDSDYRKYWPAD----VHLVGKEIVRFHTIIWPAMLMALGEPLPKQVFGHGWLLLEGGKMSKSKGNVVDPVVLVEKYGVDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDLGNLVSRTVAMIDKYFGGKLPQ-ERQAGEFDDDLIKTVTDTPQKVEELLDRLQFSTALTEIWKAISRTNKYIDETMPWALAKSEENKARLAAVLYNLAESIRIVSILIQPFMPETPEKIWHQLGINDKKY-VEWETAKKWGVYPEGAAVNKGEPLFPRID 511
>gi|30018309|ref|NP_829940.1| methionyl-tRNA synthetase [Bacillus cereus ATCC 14579] >gi|38258299|sp|Q81JA8|SYM1_BACCR Methionyl-tRNA synthetase 1 (Methionine--tRNA ligase 1) (MetRS 1) >gi|29893849|gb|AAP07141.1| Methionyl-tRNA synthetase [Bacillus cereus ATCC 14579] (660 aa)
Score = 960, Expect = 2.3e-101, Identities = 204/520 (39%), Positives = 313/520 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY  G IP + K  ++   EF++ L  F  +    +   +E +     L  +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  + D +    + ++    +    K+    PI+ R+E E
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMNISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFI-KPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFSGEIPAF-KANVT---EFDETLVAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGNPIFPRLEME 526
>gi|196251951|ref|ZP_03150616.1| methionyl-tRNA synthetase [Clostridium thermocellum DSM 4150] >gi|196198709|gb|EDX93541.1| methionyl-tRNA synthetase [Clostridium thermocellum DSM 4150] (654 aa)
Score = 959, Expect = 3.2e-101, Identities = 201/515 (39%), Positives = 307/515 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFS---SLDNQKINTPEPIYLRIE 1083
           K FYITTPIYYPS   HIGH++TT+ AD + RYK+  GY+  F+TG DEHGQKIE KAKE  + P++ VD+       LWKLL I    FIRTT  +H+  VQ+ F +L  +  IY   ++G YC  CE  +TK   V  +  D   C +   L +  EESYF ++ +++ + I    ++P+ + P++R NE+ N+FL     +DL +SR+ F WGI +  + KHVVYVW+DAL NY++ L Y  +DDS+++K+W +     V L+ KEI RFH I WP ML  LG   P +   HGW++ E GKMSKS GNV+DP+  +  YG DA RY+LL+E+    D VFS + LIN  N DLAN++GNL +R++ MI+KY  G +P+  +    F+ +  K +     ++  ++++L     L+ +   I+  N +I++  PW L K E N+  L   L  +  +++ V   ++P + +  ++   Q  I+  K+ +++ T        +   +N  EP++ RI+
  S:     4 KTFYITTPIYYPSDKLHIGHSYTTVAADAVARYKRLKGYDVMFLTGTDEHGQKIERKAKEKGVTPKQYVDEIVAGIKELWKLLKITNDRFIRTTDPHHEKTVQKIFKKLYDQGDIYKSEYEGWYCTPCESFWTKTQLVDGKCPD---CGREVELTK--EESYFFRLSKYQDRLIKHIEENPDFIQPVSRQNEMLNNFL-RPGLEDLCVSRTTFDWGIPVSFDDKHVVYVWIDALSNYITALNYMSEDDSDYRKYWPAD----VHLVGKEIVRFHTIIWPAMLMALGEPLPKQVFGHGWLLLEGGKMSKSKGNVVDPVVLVEKYGVDAIRYFLLREVPFGSDGVFSNEALINRINSDLANDLGNLVSRTVAMIDKYFGGKLPQ-ERQAGEFDDDLIKTVTDTPQKVEELLDRLQFSTALTEIWKAISRTNKYIDETMPWALAKSEENKARLAAVLYNLAESIRIVSILIQPFMPETPEKIWHQLGINDKKY-VEWETAKKWGVYPEGAAVNKGEPLFPRID 511
>gi|169830260|ref|YP_001716242.1| methionyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] >gi|169637104|gb|ACA58610.1| methionyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] (516 aa)
Score = 959, Expect = 3.3e-101, Identities = 186/444 (41%), Positives = 267/444 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK 1014
           FYITTPIYYPS N HIGHA+TT+ AD + R+K+  GY+ +F+TG DEHGQKIE  A      PQE VD+    F  LW  L I+YS FIRTT + HK VV + F  L ++  IY   ++GLYC  CE  +T    V     D   C +  P+    EESYF +  ++ ++ ++   ++P+ + P++R NE+  SF+     +DL +SR+ F+WGI +  +P+HV+YVW+DAL NY+S L Y  +DDS ++++W       V L+ K+I RFHCI WPI+L   G+  P + + HGW++ E GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D  +SE  LI   N DLAN++GNL +R+  MI+KY DG I          + E          E+  ++ +L++   L  ++ L+   N +IE+  PW L K+  +K
  S:     8 FYITTPIYYPSDNLHIGHAYTTVAADTVARFKRLTGYDVYFLTGSDEHGQKIERTAAARGKNPQEYVDEIVAGFKRLWSRLEIDYSDFIRTTEDRHKRVVTDIFRRLHEQGDIYKSSYEGLYCTPCEAFWTDRQVVEGNCPD---CGR--PVELVAEESYFFRQSRYAERLLAHIDRNPDFIQPVSRRNEVV-SFIKM-GLEDLCVSRTTFNWGIPVPFDPRHVIYVWVDALTNYISALNYGAEDDSLYRRYWPVD----VHLVGKDIVRFHCIIWPIILMAAGIPLPKRVVGHGWLMLESGKMSKSKGNVVDPFVLIDRYGVDAIRYYLLREMLFGADGYYSEDNLIRRINVDLANDLGNLLSRTTAMIDKYLDGEIQAPGPADDPLDRELIDLALITPGEVAGLVNELDLSAALGAIMKLVGRANKYIEETAPWTLAKDPAKK 441
>gi|152973886|ref|YP_001373403.1| methionyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022638|gb|ABS20408.1| methionyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (659 aa)
Score = 958, Expect = 4.0e-101, Identities = 208/520 (40%), Positives = 311/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-----QLHPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+  ++TG DEHGQKI++KA+EL + PQ  VD       +LW  + I Y  FIRTT + HK VV++ F +L+ +  IYL  ++G Y V  E  YT++  V    ++            H +    E SYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WGI++  NPKHV+YVW+DAL NY++ LGY  ++   ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY DG IP + K K++   EF++ L  F  +    +   +E +     LS +   I+  N +I++ +PW L K+  +++ L   ++ +   +++    L P L   S +  +Q  I    +       + SL          K+   +PI+ R+E E
  S:     3 EEKKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYDVHYLTGTDEHGQKIQKKAEELQVTPQAYVDDIVAGIKDLWNKMDISYDDFIRTTEDRHKEVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMENGKVVGGKSPDSGHAVELVREASYFFRM---GKYVDRLLKFYEENPHFIQPESRKNEMINNFI-KPGLEDLAVSRTSFDWGIRVPGNPKHVIYVWVDALSNYITALGYGTENAEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFDGQIPAF-KEKVT---EFDEALVNFATDTLQKVEEAMENMEFSVALSSIWQFISRTNKYIDETQPWVLAKDEKDREKLASVMAHLAEMLRQTSIMLMPFLTTTSGKIFEQLGITDEAYQ-----SWESLSTIGCIPTGTKVVKGQPIFPRLEVE 526
>gi|147676404|ref|YP_001210619.1| methionyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] >gi|146272501|dbj|BAF58250.1| methionyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] (544 aa)
Score = 958, Expect = 4.2e-101, Identities = 186/445 (41%), Positives = 272/445 (61%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD 1015
           FYITTPIYYPS N HIGHA+TT+ AD + R+KK  GY+T F+TG DEHGQKIE  A+     PQE VDK       LW+ L ++Y  FIRTT   HK VV   F +L ++  IY   ++G YC  CE  + ++   R E  +   C +  P+    EESYF ++ ++ + +   +++ P  + P +R NE+  SF+ +   +DL +SR+ F+WGI +  +P HV+YVW+DAL NY+S LGY  +DDS F+K+W +     V LM K+I RFH + WPI+L   GL  P + + HGW++ E GKMSKS GNV+DP+  I+ YG DA RYYLL+EL    D  +SE+ L+   NKDLAN++GNL +RSI M+ KY  G +     P+   + E     +Q    +  +++K+++   L+ +  L+   N ++++  PW L K+ +  D
  S:    36 FYITTPIYYPSDNLHIGHAYTTVAADAVARFKKMTGYDTRFLTGTDEHGQKIERAARSRGEDPQEFVDKIVAGIKLLWQKLEVDYDDFIRTTEPRHKKVVSAFFQKLYEQGDIYKAGYEGWYCTPCEAFWAES---RLEGGNCPDCGR--PVELLREESYFFRMSKYAERLLRHIEEHPEFIQPASRRNEMV-SFIKS-GLEDLCVSRTTFNWGIPVPFDPGHVIYVWVDALTNYISALGYGTEDDSLFKKYWPAD----VHLMGKDIVRFHSVIWPILLMAAGLELPRQVVGHGWLLLESGKMSKSKGNVVDPLVLIDKYGVDAIRYYLLRELPFGADGYYSEEALVERINKDLANDLGNLVSRSIAMVEKYFQGRVQPPGLPE-GPDRELIDLAEQTPAAVEELMDKMDLSGALAAIWRLVGRANKYVDETAPWGLAKDPSRAD 469
>gi|167769712|ref|ZP_02441765.1| hypothetical protein ANACOL_01046 [Anaerotruncus colihominis DSM 17241] >gi|167668073|gb|EDS12203.1| hypothetical protein ANACOL_01046 [Anaerotruncus colihominis DSM 17241] (690 aa)
Score = 956, Expect = 8.6e-101, Identities = 199/480 (41%), Positives = 272/480 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP--KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ 1048
           K FYITTPIYYPS   HIGH++ T+  DV+ RYK+  G++  F+TG DEHGQKIE+KA    + PQ  VDK       LW LL I    F+RTT +YH   VQ+ F +L  K +IY G +KG YC  CE  +T +  V  +  D   C +   +   EEE+YF K+  F   I    +D P  + P +R+NE+ N+F+     +DL +SR++F WGI +  +PKHVVYVW+DAL NY++ LGY      +F+K+W +     V  + KEI RFH I WP ML  L L  P K   HGW++ E GKMSKS GNV+DP+  ++ YG DA RY+LL+E     D +FS + LI   N DLAN++GNL +RS+ M  KY    +P  + S+P     I   K LK+  D     +E    Q  L  +  LI+  N +I++  PW L K E N   L   +  +L  V+     L P +   S +   Q
  S:    38 KTFYITTPIYYPSDKLHIGHSYCTVATDVMARYKRMQGFDVMFLTGTDEHGQKIEQKALAAGVTPQAYVDKIVDGIKELWNLLNISNDRFVRTTDDYHVESVQKIFKDLYDKGYIYKGSYKGKYCTPCESFWTDSQLVDGKCPD---CGR--EVADAEEEAYFFKLSAFSDRILKLYEDNPQFMEPQSRMNEMINNFI-KPGLEDLCVSRTSFKWGIPVTFDPKHVVYVWVDALTNYITALGYGNGRYHDFEKYWPAD----VHFVGKEIIRFHTIIWPAMLMALDLPLPKKVFGHGWLLLEGGKMSKSKGNVVDPVVLVDRYGVDAIRYFLLREFPFGSDGLFSNESLITRINADLANDLGNLVSRSVAMAEKYFGDALPAERKSEPIDDEIISIAKSLKETYDR---HMESYAFQNALIDIFKLISRTNKYIDETAPWVLAKDEANRPRLATVIYNLLECVRICAILLTPFMPATSPKIFAQ 508
>gi|134297944|ref|YP_001111440.1| methionyl-tRNA synthetase [Desulfotomaculum reducens MI-1] >gi|134050644|gb|ABO48615.1| methionyl-tRNA synthetase [Desulfotomaculum reducens MI-1] (518 aa)
Score = 954, Expect = 1.1e-100, Identities = 198/486 (40%), Positives = 286/486 (58%)
  Q:   567 VMKK--FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTK-NIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID 1052
           V+KK  FYITTPIYYPS N HIGHA+TT+ AD + RYK+  GY+ +F+TG DEHGQKIE  AK  N  P+E VD     F  LW+ L + Y+ FIRTT E H  VVQ+ F +L  +  IY   ++G YC  CE  +T+  +A  K       C      ++K  EESYF +  ++ ++++    ++P  + P++R NE+  SF+     +DL +SR+ F WGI++  +PKHVVYVW+DAL NY+S LGY   D+S FQKFW +     + LM+K+I RFH I WPI+L  L L  P K I+HGW++ + GKMSKS GNV+DP   I+ YG DA RY+LL+EL    D ++SE+ L+   N DLAN+ GNL +RS  M+ KY+ G++     P+   + E           +   +EK  +   L+ +  ++   N ++E+  PW L K N  + L+  L  +   ++     + P +    K    Q  I+
  S:     2 VLKKPNFYITTPIYYPSDNLHIGHAYTTVAADTMARYKRLTGYDVWFLTGSDEHGQKIERAAKNKNQTPKEYVDHIVSGFKKLWERLDVSYNDFIRTTDERHHKVVQKFFQQLFDQGDIYKSEYEGWYCTPCETFFTEYQLAEGK-------CPDCQREVEKVREESYFFRQSKYAERWLKFIEENPEFIQPVSRRNEMV-SFVKQ-GLEDLCVSRTTFDWGIRVPFDPKHVVYVWVDALTNYISALGYDTGDNSLFQKFWPAD----IHLMAKDIVRFHAIIWPILLMALDLPLPKKVIAHGWLLLDSGKMSKSKGNVVDPHVLIDKYGVDAVRYFLLRELPFGSDGLYSEEALVKRINTDLANDYGNLLSRSATMMEKYQQGVLQTPGAPE-GPDEELIDLATATPKLVEEYMEKSELSNALAAIWQMVGRANKYLEETAPWTLAKNNETERLNTVLYNVAEVMRFATIMITPFMPQLPKRVWPQLGIE 478
>gi|165872552|ref|ZP_02217184.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|164711680|gb|EDR17225.1| methionyl-tRNA synthetase [Bacillus anthracis str. A0488] (660 aa)
Score = 954, Expect = 1.4e-100, Identities = 201/520 (38%), Positives = 307/520 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           E  K FYITTPIYYPSG  HIGHA+TT+  D + RYK   GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I    FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ ++++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+   +PI+ R+E +
  S:     3 EENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISCDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAH-----TSWGSLSTIGCIPAGTKVEKGQPIFPRLEMD 526
>gi|154249481|ref|YP_001410306.1| methionyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] >gi|154153417|gb|ABS60649.1| methionyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] (650 aa)
Score = 952, Expect = 2.3e-100, Identities = 206/512 (40%), Positives = 311/512 (60%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL-KQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIY 1079
           MKKFYITTPIYY +  PHIG ++TT+I D+L RYK+ +GYE F++TG DEHGQKI + A+E  L+P+EL D  A+ F  LWK LGI   +FIRTT E H+  VQ   S++++   IY G+++G YCV CE  + +      E+   +   C +   LI+  EE+YF ++ ++    +  F ++P+ V P  R NE+    +      DLSI+R+   WGI +  +P+HV+YVW+DAL+NY+S +GY   D   F K+W +     V L+ KEI RFH + WP ML  +GL  P K  +HGW+     K+SKSLGN +DP  ++  YG D  RYYL++++   +D  FSE+ LI   N DLAN+ GNL +R++ MI K+ D +IP     +     E +K+L + +D      IE ++  KI   L  +   I++ N + ++ KPW L KE N++ L   LSL+  ++ +V   + PV+ D S E  K+ +++  KFD KF++ ++ +   KI   EP++
  S:     1 MKKFYITTPIYYVNAEPHIGSSYTTIIGDILARYKRLMGYEVFYLTGTDEHGQKIAQAAREKGLEPKELCDTLAEKFKELWKDLGITNDYFIRTTDENHEKTVQYFVSKMMENGDIYKGIYEGWYCVPCETYWNEEELEHDEHGHNICPSCKREVNLIR--EENYFFRLSKYNDALLKHFQENPDFVEPDFRRNEMLK--ILESGLKDLSITRTTLKWGIPMPNDPEHVIYVWVDALINYVSAIGY-PNDMDKFNKWWPAD----VHLIGKEINRFHSLIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISKSLGNAIDPREYVRKYGNDVVRYYLVRDIVFGKDGDFSEENLIKRLNSDLANDYGNLLHRTLAMIQKHFDSVIPGVGNLE-----EIDKKLIEDYDLVKNKFIELMDSYKITDALEVLWQFISQLNKYFDETKPWVLAKEGNKERLGTVLSLVTESIFKVATLVSPVMPDSSLEVYKRLSVN-EKFDEKFLSGWNIIKGNKIIHGEPLF 504
>gi|28210009|ref|NP_780953.1| methionyl-tRNA synthetase [Clostridium tetani E88] >gi|38258346|sp|Q899D9|SYM_CLOTE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|28202444|gb|AAO34890.1| methionyl-tRNA synthetase [Clostridium tetani E88] (641 aa)
Score = 949, Expect = 5.0e-100, Identities = 200/519 (38%), Positives = 305/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEAL-KQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           K FYITTPIYYPS   HIG+ +TT+ AD L R+K+  G++  F+TG DEHGQKI+  A+E  LKP+E +D        LWK + I Y  FIRTT +YH   VQ+ F +L ++  IY G ++G YC  CE  +T++     + DD        P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL ISR++F WGI +  + KHV+YVW+DAL NY++ LGY   +    +KFW +     V L+ K+I RFH IYWPIML  LG+  P +   HGW++ + GKMSKS GNV+DP+  ++ +G D  RYYLL+E+    D +F+ +L I   N DLAN++GNL +R++ M+ KY +GI+P     K   + E         +++   +EKL I ++L  +  LI   N +I++  PW L K+ ++KD    +   L+   R+I  L    I  + E + +Q N+D + +D       +S D  K  T     + ++ RI+ E K
  S:     4 KTFYITTPIYYPSAKLHIGNTYTTVAADALARFKRLTGHDVLFLTGTDEHGQKIQRVAEEKGLKPKEYLDNMVDSIKELWKSMNISYDKFIRTTDDYHIESVQKIFKKLYEQGDIYKGEYEGWYCTPCESFWTES-----QLDDHNCPDCGRPVEKTKEEAYFFKMSKYADRLIKYIEENPHFIQPESRKNEMLNNFL-KPGLQDLCISRTSFDWGIPVSFDNKHVIYVWIDALSNYITALGYNSDNQELLEKFWPAN----VHLVGKDILRFHTIYWPIMLMALGIELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVDHFGEDTVRYYLLREIPFGSDGLFNNELFIKKINSDLANDLGNLLSRTVAMVQKYFNGIMPA-PIAKEPIDDELINLALDTREKVENNMEKLKIPEVLDEIWTLIGRANKYIDETTPWILAKDEDKKDRLGTVLYNLSETLRIISVLISAFIPKTSERINEQLNVDLTTWD-----SIASFDGTKAGTKVVKGDALFPRIDVEAK 512
>gi|116492070|ref|YP_803805.1| methionyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] >gi|116102220|gb|ABJ67363.1| methionyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] (673 aa)
Score = 949, Expect = 5.2e-100, Identities = 192/517 (37%), Positives = 310/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNE---KDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL--DNQKINTPEPIYLRIESEDK 1087
           +YITTPIYYPSG  HIG+++TT+  D   R+++  G + FF+TG DEHG KIE+KA+ LN  P+  VD  A+    LW LL I    FIRTT +YH+  VQ+ F +LL +  IYLG ++G Y VS EE +T++    V ++ D  +   +     + E   EESYF K+ ++  ++  + +  PN + P +R+NE+ N+F+     +DL+++R+ F WG+ IK +PKHV+YVW+DAL NY++ LGY   +D NF+KFW +     V ++ KEI RFH IYWPIML  LGL +P +   HGW++ +  KMSKS GNV+ P   +  YG DA RYYLLK +    D  F+ +  I+  N DLAN++GNL NR++ MINKY  G+IP +       +++ E            ++  L+    L+ +  L+   N +I++  PW L + +++   + L   ++ +  +++ +   ++P++     +   Q  +D ++ +++ +  F  +  D + +    PI+ R++ E +
  S:     7 YYITTPIYYPSGKLHIGNSYTTIACDAEARFQRLEGKDVFFLTGTDEHGLKIEQKAEALNTTPKAYVDGMAEDIKKLWDLLEITNDKFIRTTDDYHEKAVQKIFQKLLDQGDIYLGEYEGWYSVSDEEYFTESQLAEVYRDADGNVTGGKAPSGNEVELVKEESYFFKMSKYADWLLDYYQTHPNFIQPASRMNEMINNFIK-PGLEDLAVTRTGFKWGVPIKNDPKHVIYVWIDALSNYITALGYSSDEDGNFKKFWPAN----VHMVGKEIVRFHTIYWPIMLHALGLEQPDQIYGHGWLLMKDSKMSKSKGNVIYPETIVKNYGLDALRYYLLKAMPYGNDGNFTPEDFISKINFDLANDLGNLLNRTVAMINKYEGGVIPTFQSGVNDVDVDLETTAATTIKNYEDLMNNLHFADALAEIWKLVARTNKYIDETTPWILARNDDDESKQKLASVMNHLAESLRVIAILIQPMMTQSPAKIFAQLGLDVNQLELQGLK-FGEIPADTKVVEKGTPIFPRLDVEKE 528
>gi|121534360|ref|ZP_01666184.1| methionyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] >gi|121307130|gb|EAX48048.1| methionyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] (640 aa)
Score = 948, Expect = 6.8e-100, Identities = 202/515 (39%), Positives = 299/515 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKF--VTDFSSLD-NQKINTPEPIYLRIE 1083
           K FYITTPIYYPS   HIGHA+ T IAD + RYK+  GY+ FF+TG DEHGQKIE KAKE  + P E VDK    F +LW+ L I    FIRTT   HK VVQ  F ++  +  IY   ++G YC  CE  + +   V  +  D   C +   L+Q  EESYF ++ +++  +  ++++ P+ + P +R NE+ N F+ +   +DL +SR+ F WGI +  + KHVVYVW DAL+NY++  GY   D   F K+W +     V L+ KEI RFH I WPI+L  LG+  P     HGW++ E  KMSKS GNV+DP+  I+ +G DA RY+LLKE++L  D  FS + LI+  N DLAN++GNL +R++ MI ++  G+I  P  ++P    ++E  +  +         +E + I   +  V  LI   N +I++  PW L K+  +K  L+  L  +   ++ V   + P +   + +   Q  I+ +  +++      +  L    ++N PEPI+ RIE
  S:     4 KSFYITTPIYYPSDRLHIGHAYCTTIADAIARYKRLAGYDVFFLTGSDEHGQKIERKAKEHGVTPIEYVDKIVASFKHLWEKLNISNDDFIRTTETRHKEVVQSIFQKIYDQGDIYKATYEGQYCTPCETFWLERQLVDGKCPD---CGRPVELVQ--EESYFFRLSKYQDRLLQYIEENPDFIQPASRRNEMIN-FIKS-GLEDLCVSRTTFDWGIPVPFDTKHVVYVWFDALVNYITAAGYLH-DREKFNKYWPAD----VHLVGKEIVRFHTIIWPIILMALGIELPKMVYGHGWLVVEGDKMSKSKGNVIDPLALIDEFGADAIRYFLLKEITLGLDGNFSREALISRINADLANDLGNLLHRTLSMIGRFNGGVIEGPGANEP---IDLELVELAQNTAAAYEKHMENMEINAAIKEVWGLIGRANKYIDETAPWALAKDATKKSRLNTVLYNLAEVLRIVSILISPFMPQAAPKIWSQLGIEDNFGNMRLDDAQRWGQLKAGTRVNKPEPIFPRIE 510
>gi|167038518|ref|YP_001666096.1| methionyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857352|gb|ABY95760.1| methionyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (633 aa)
Score = 947, Expect = 7.6e-100, Identities = 194/486 (39%), Positives = 297/486 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS 1054
           K FYITTPIYYPS   HIGH++TT+ AD + R+K+  GY+  F+TG DEHGQKI+  A+E  + P+E VD   +   +LWK++ I Y  FIRTT +YH+ +VQ+ F++L +K  IY   ++G YC  CE  +T++  V  +  D   C +   + + +EE YF ++ ++  + +  + + P+ + P +R NE+ N F+ +   +DL +SRS+F WGI++  +PKHV+YVW+DAL NY++ LGY    D +F+K+W +     V L+ KEI RFH I WP ML  L L  P K   HGW+I E GKMSKS GNV+DP   ++ YG DA RY+LL+E+    D VFS + LIN  N DLAN++GNL +R++ MI KY DGI+PK S+ K   + +     +     +   ++KL     L  +  L+   N +I++  PW L K+ ++K+ L   L  +  A++ +   + P + +  K+  +Q  I+ +
  S:     3 KTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAREKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSKYEGWYCTPCESFWTESQLVDGKCPD---CGR--QVERVKEEGYFFRLSKYGDRLLQYYDEHPDFIQPESRRNEMIN-FIKS-GLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALGYSTDHDDDFKKYWPAD----VHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKMSKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLSRTVTMIEKYFDGILPKPSQ-KEEVDDDLINTAQNLPKTVEEYMDKLQFSNALIEIWKLVRRANKYIDETMPWVLAKDESKKERLGTVLYNLAEALRFIAILISPFMPNTPKKIFEQLGIEEN 478
>gi|39997330|ref|NP_953281.1| methionyl-tRNA synthetase [Geobacter sulfurreducens PCA] >gi|39984221|gb|AAR35608.1| methionyl-tRNA synthetase [Geobacter sulfurreducens PCA] (510 aa)
Score = 947, Expect = 7.9e-100, Identities = 192/478 (40%), Positives = 289/478 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           + FY+TTPIYY +  PHIGHA+TTL ADVL RYKK  GYE FF+TG DEHGQK+E+ A      P EL D+  K F  LW+ L I+Y+ FIRTT E HK  V   F++++ +  IYLG ++  YC  CE  +T+   +  +  D   C +  P+ + +EESYF ++ ++++ + + ++ +P+ + P +R NE+  SF+  +   DLS+SR++F+WGI +  N KHV+YVW DAL NY++ LGY   + S F+ FW       V L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+    D  FS   L++  N DLAN++GNL NRS  M+NKY DG++P    P+   +  F ++ +    ++   +++L   K L  + ++I+  N +I++  PW L K+  +++ L   +  +L A + V   L   +   S +AL
  S:     3 RTFYVTTPIYYVNDVPHIGHAYTTLAADVLARYKKLKGYEVFFLTGTDEHGQKVEKAANTAGETPLELADRVVKRFQGLWEKLDIQYTDFIRTTQERHKKGVSHIFTKIMAQGDIYLGEYEDWYCTPCETFWTETQLIDGKCPD---CNR--PVDKLKEESYFFRMSKYQEQLLAHIEANPDFIQPKSRRNEII-SFV-KEGLRDLSVSRTSFNWGIPVPGNEKHVIYVWFDALTNYITALGY-PDEQSAFKTFWPVD----VHLIGKDILRFHAVYWPTFLMAAGLPVPKKVFAHGWWTVEGQKMSKSLQNVVEPNMLVDRYGIDAVRYFLLREVPFGLDGDFSHAALVHRINSDLANDLGNLLNRSTAMVNKYFDGVLPA-PGPQTELDTAFREKTEAMVRQLDACMDELAFSKGLQAIWEVISAGNKYIDETAPWALAKDPAKREYLGTVMYTLLEAQRIVHLVLSAFMPRTSAKAL 469
>gi|89210931|ref|ZP_01189313.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Halothermothrix orenii H 168] >gi|89159477|gb|EAR79143.1| Methionyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, beta subunit, C-terminal [Halothermothrix orenii H 168] (656 aa)
Score = 946, Expect = 1.1e-99, Identities = 212/518 (40%), Positives = 309/518 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD----DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-----DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           K FY+TTPIYYPS   HIGHA+TT+ AD L ++K+   Y+T F+TG DEHGQKIE KA E   KP E VD+    F +LWK LG++Y +FIRTT   H+ VVQE F ++ +K  IY G ++G YC  CE  +T+    R+   +K+      P+   EEESYF K+ ++  + +    K P  + P +R  E+ N F+ +   +DLS+SR+ F WGI +  +  HV+YVW DAL NY+S +GY   DD  F  +W +     V ++ K+I RFH I WPI+L  L L  P K   HGW++TE GKMSKS GNV+DP   I+ +G D  RYYLL+E++  +D  +S + LI   N DLAN++GNL +R++ M++KY DG+IP+    K     E +K LK +     DEI   ++ L     L  + + I   N +I+Q  PW L ++ ++KD L   L  ++ A++ +   L+P L++      +Q N       +S  D+K     S    +K+   +PIY RI+ E+
  S:     7 KTFYVTTPIYYPSDRLHIGHAYTTVAADTLAKFKEMQDYDTMFLTGSDEHGQKIERKASEAGKKPGEYVDEIVATFKDLWKRLGVDYDYFIRTTNPDHEKVVQEIFKKIYEKGDIYKGKYEGWYCTPCETFWTE----RQLEGEKVCPDCGRPVEWVEEESYFFKLSKYADRLLEHIKKHPEFIQPESRRKEMIN-FIES-GLEDLSVSRTTFDWGIPVPIDDDHVIYVWFDALSNYISAIGYLS-DDKKFNHYWPAD----VHIVGKDILRFHTIIWPIILMALDLPLPKKVFGHGWLLTETGKMSKSKGNVVDPNKLIDDFGVDPIRYYLLREVAFGQDGTYSTEALIKRINSDLANDLGNLLHRTVTMVDKYFDGVIPEPGVEK-----EVDKDLKNYALKTLDEIDNSMDNLKYAVALESLWNFIRRSNKYIDQTTPWILARDEDKKDRLGTVLYNLIEALRIIAGMLKPFLVETPYMIGEQINARDLIEKASWSDLKQWGLLSP--GRKVKKGKPIYPRIDIEE 517
>gi|167629315|ref|YP_001679814.1| methionyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] >gi|167592055|gb|ABZ83803.1| methionyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] (668 aa)
Score = 946, Expect = 1.2e-99, Identities = 188/513 (36%), Positives = 298/513 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT----TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL------DNQKINTPEPIYLRIE 1083
           FYITTPIYYPSGNPHIGHA+TT+  D + RYK+  G + +F+TG+DEHGQKIE  A+   + P + +D  A  F  LW+ L I Y  FIRTT E HK  VQ  F ++  K  IY   ++G YC  CE  + +      E  +KL      P+ + +EESYF ++ ++  + +    ++P  + P++R NE+  SF+     +DL +SR+ F WGI +  N  HV+YVW DAL NY++ LGY   DD  ++++W +     + L+ K+I RFH I WPI+L  LG   P +  SHGW + E GKMSKS GNV+DP    + YG DAFRY+L++E+   +D++FSE+ LI+  N DLAN++GNL +RS+ M+ ++  GI+     P+ +     EK++++   +       ++++  +    S +  LI   N +I++  PW L KK   + +L+  L  ++ +++     L+  + + + +   Q  +         +  + +       D  K+   +PI+ RI+
  S:     9 FYITTPIYYPSGNPHIGHAYTTVATDTMARYKRLRGCDVWFLTGLDEHGQKIERAAQGKGMAPIDYLDPVAVTFKKLWERLEITYDDFIRTTEERHKKAVQVIFQKIWDKGDIYKSEYEGWYCTPCEAFWPERQLKIGEKGEKLCPDCDRPVERMKEESYFFRMSKYADRLLQHIEENPEFIQPVSRRNEMV-SFIKQ-GLEDLCVSRTTFKWGIPVPINANHVIYVWFDALSNYITALGYGSDDDEKYRRYWPAD----IHLVGKDIVRFHTIIWPIILMALGEPLPKQVFSHGWFLLESGKMSKSKGNVVDPFMLADRYGVDAFRYFLIREMIGGQDALFSEETLISRINTDLANDLGNLLHRSLSMVERFSGGIV---RAPEAAAEGPLEKEIRELTAKTVADFGALMDRFELANAHSALWKLIGRMNKYIDERAPWSLAKKPEAKAELEAVLYTMVESLRITAILLQAAMPNVAGKIFAQLGLSGENRPASCLMTWDAARWGLFPDGVKVAKGDPIFPRID 524
>gi|167038739|ref|YP_001661724.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166852979|gb|ABY91388.1| methionyl-tRNA synthetase [Thermoanaerobacter sp. X514] (632 aa)
Score = 944, Expect = 1.8e-99, Identities = 200/515 (38%), Positives = 310/515 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL------DNQKINTPEPIYLRIE 1083
           K FYITTPIYYPS   HIGH++TT+ AD + R+K+  GY+  F+TG DEHGQKI+  A+E  + P+E VD   +   +LWK++ I Y  FIRTT +YH+ +VQ+ F++L +K  IY   ++G YC  CE  +T++  V  +  D   C +   + + +EE YF ++ ++  + +  + + P+ + P +R NE+ N F+ +   +DL +SRS+F WGI++  +PKHV+YVW+DAL NY++ LGY    D +F+K+W +     V L+ KEI RFH I WP ML  L L  P K   HGW+I E GKMSKS GNV+DP   ++ YG DA RY+LL+E+    D VFS + LIN  N DLAN++GNL +R++ MI KY  GI+PK S+ K   + +     +     +   ++KL     L  +  L+   N +I++  PW L K+ ++K+ L   L  +  A++ +   + P + +  K+  +Q  ++ +      +T + SL      +  K+   E I+ RI+
  S:     3 KTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKFLTGTDEHGQKIQRIAREKGMSPKEYVDGIVEWIKDLWKIMDISYDQFIRTTDKYHEEIVQKIFTKLYEKGDIYKSKYEGWYCTPCESFWTESQLVDGKCPD---CGR--QVERVKEEGYFFRLSKYGDRLLQYYDEHPDFIQPESRRNEMIN-FIKS-GLEDLFVSRSSFDWGIKVPFDPKHVIYVWIDALSNYITALGYSTDHDDDFKKYWPAD----VHLVGKEIMRFHTIIWPAMLMALDLPLPKKVFGHGWLILEGGKMSKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLSRTVTMIEKYFGGILPKPSQ-KEEVDDDLITTAQNLPKTVEEYMDKLQFSNALIEIWKLVRRANKYIDETMPWVLAKDESKKERLGTVLYNLTEALRFIAVLISPFMPNTPKKIFEQLGVEEN------LTTWESLKFGLLKEGTKVKRGEIIFPRID 507
>gi|154499613|ref|ZP_02037651.1| hypothetical protein BACCAP_03269 [Bacteroides capillosus ATCC 29799] >gi|150271691|gb|EDM98935.1| hypothetical protein BACCAP_03269 [Bacteroides capillosus ATCC 29799] (656 aa)
Score = 943, Expect = 2.8e-99, Identities = 190/479 (39%), Positives = 281/479 (58%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAK----VFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ 1048
           K+YITTPIYYPS   HIGHA+ T+  DV+ RYK+  GY+  F+TG DEHGQKIE+KAK+  + P++ VD   +    V D LWKL+ I    FIRTT +YH+  VQ+ F +L ++  IY G +KG YC  CE  +T++  V  +  D   C +   +   EEE+YF ++ ++   I   L++ + + P +R+NE+ N+F+     +DL +SR++F+WG+ +  +P HVVYVW+DAL NY++ LGY     +++ KFW +     V  + KEI RFH I WP +L  L L  P K   HGW++ + GKMSKS GNV+DP      YG DA R++LL+      D  FS + LI T N DLAN++GNL +R++ M+ KY +G      +     + E         D+    +E+   Q  LS V  LI+  N +I++  PW L + E N+  L   +  +L +++     L P + D S E L+Q
  S:     6 KYYITTPIYYPSDKLHIGHAYCTVATDVMARYKRLTGYDVMFLTGTDEHGQKIEDKAKDAGVTPKQYVDNIVEGERGVLD-LWKLMNISNDRFIRTTDDYHEAAVQKIFKQLYEQGDIYKGTYKGKYCKPCESFWTESQLVDGKCPD---CGR--EVQDAEEEAYFFRLSKYADRIQDLLENTDFLEPRSRVNEMVNNFIK-PGLEDLCVSRTSFTWGVPVDFDPGHVVYVWIDALSNYITALGYDNDKYNDYDKFWPAD----VHFVGKEIVRFHSIIWPAILMALNLPLPKKVFGHGWLLLDGGKMSKSKGNVVDPYLLSERYGVDALRFFLLRTFPFGSDGNFSNEALIGTINTDLANDLGNLLSRTVSMVGKYFEGGTLPAEQTADGLDDELIALASGLRDKYEAAMERFAFQDALSEVFKLISRANKYIDETAPWVLARDEANKPRLARVMYNLLESLRISAVLLTPFMPDTSAEILRQ 478
>gi|184154662|ref|YP_001843002.1| methionyl-tRNA synthase [Lactobacillus fermentum IFO 3956] >gi|183226006|dbj|BAG26522.1| methionyl-tRNA synthase [Lactobacillus fermentum IFO 3956] (666 aa)
Score = 941, Expect = 4.6e-99, Identities = 191/481 (39%), Positives = 291/481 (60%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKL---YCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           +YITTPIYYPSG  HIG+++TT+  D   R+K+  G++ FF+TG DEHG KIE+KA++L   PQ  VD+ A     LW+ L I    FIRTT  YH+  VQ+ F +LL +  IY G + G Y V  EE +T++    V K+ + ++        H +   +EESYF K+ ++  ++  + K  P+ + P +R+NE+  +FL     +DL+++R++F+WG+++  +PKHVVYVW+DAL NY++ LGY   DDS F+K+W +     V ++ KEI RFH IYWPI+L  LGL  P   I HGW+  + GKMSKS GNV+ P   I+ YG DA RYYLL+ +    D VFS +  +   N DLAN++GNL NR++ M+NKY+ G +         F+ + E+  +    E   ++++      LS +  LI   N +I++ +PW L K+  +   L   L+ +  +++ V   L+P++    KE L Q  +
  S:     7 YYITTPIYYPSGRLHIGNSYTTVACDAEARFKRLSGFDVFFLTGTDEHGLKIEQKAEKLGKDPQTYVDEMAAGIKELWQKLEITNDKFIRTTDGYHEATVQKIFQQLLDQGDIYKGEYVGWYSVDDEEYFTESQLKEVFKDENGQVTGGIAPSGHEVQLVKEESYFFKMSKYADWLMDYYKAHPDFIQPESRMNEMVKNFLE-PGLEDLAVTRTSFNWGVKVPNDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPAD----VHMVGKEIVRFHTIYWPIILHALGLPLPKHVIGHGWLTMKDGKMSKSKGNVVYPETLIDRYGLDATRYYLLRAMPFGNDGVFSPEDFVEKVNYDLANDLGNLLNRTVAMVNKYQAGKLVGQPGATTDFDADLEQVAQDALVEYRELMDQTRFADALSAIWKLIARANKYIDETEPWVLAKDEQQAPVLSDVLTHLAKSLRMVAAMLQPIMPTAPKEILGQLGL 489
>gi|12044871|ref|NP_072681.1| methionyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|1351165|sp|P47267|SYM_MYCGE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|3844630|gb|AAC71237.1| methionyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|166079081|gb|ABY79699.1| methionyl-tRNA synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (512 aa)
Score = 940, Expect = 5.5e-99, Identities = 204/483 (42%), Positives = 293/483 (60%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNL-VYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWN--SQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQ----FDDEITTIIEKLN---IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFN 1050
           MK+ YITTPIYY SG PHIGHAFTT++ADV+ R+K + GYE F + G DEHG KIE KAK LNL P+  VD  A+ F  +WK L I + HFIRTT E HK  VQ+TF +L  K  IY   WKG YCV CE+NY         N   + C   H L   +E  +F+     K +I + +    L + P +R +EL N+F+NN   +DL+++R N +WGI++  +P   +YVW DAL +Y++ LG+R   D NF K+WN  +++ E++ L+S+EITRFHCIYWPI L +L ++ PT+++SHGWI+  +G KMSKSL NV+ P   I+ +G D  RY LLKE+ L +D+  S  +L   +N DLAN+ GN  +R+ GMI KY +G        KL + I  +  L++     D+ I       N     + ++ ++ ++ E +  I+  KPW+L K      L   L   +  V+     L P+L++ + +    FN
  S:     1 MKRCYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFLLVGSDEHGNKIESKAKSLNLDPKTFVDINAQAFKLMWKTLNISFDHFIRTTDEIHKQQVQKTFQDLYDKKLIYQSEWKGAYCVECEQNYFTF------NKQTMLCEIGHNLSLVQEPCWFISFSSTKNWIETTIGKNQLNIIPKSRASELKNNFINN-GLNDLALTRKNVTWGIKVPFDPNQTIYVWFDALFSYITNLGFRN-GDPNFIKWWNNDNKEREVIHLISREITRFHCIYWPIFLHLLDIKLPTQFLSHGWIVDGEGRKMSKSLNNVISPEQLIDQFGVDGTRYCLLKEMRLDKDNRCSVSILKEIYNADLANSFGNHVSRTFGMIKKYLNG--------KLEYQIITDNALQKIMILIDESIVQFDHYFNSYEFYRAINLLLKIVFELSKLIDDFKPWELFKNQEFSLLKQLLFTCVRCVQVCYVLLTPILVNTASKVFHLFN 478
>gi|104773496|ref|YP_618476.1| methionyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422577|emb|CAI97180.1| Methionyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (660 aa)
Score = 937, Expect = 1.1e-98, Identities = 199/519 (38%), Positives = 302/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI---DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG   IG+A+TT+ AD +TRYKK  GY+TFF+TG DEHG KIE+KA++L +KP+  +D   K    LWK L I Y  FIRTT E H   VQ+ F +L     IYLG + G Y V  EE +T++       DD+           H +   +E SYF K+ ++   +  + KD P  + P +R  E+ N+F+     +DLS++R+   WGI +  +PKHVVYVW+DAL NY++ LGY  +DDS F+K+W +     V L+ KEI RFH IYWPIML  L L  P +   HGW++  + KMSKS GN + P   I+ YG D  RYYL++ +    D  F+ +  +   N DLAN++GNL NR++ MIN+Y+ G++    + +  +  +      +   +    ++K++    L  V  LI+  N +I++  PW L KE   ++L   +S +  +++ V   + PV+ +   +   Q  +   D S+ D++F     + D   +  P PI+ R++++++
  S:     6 KTFYITTPIYYPSGRLTIGNAYTTIAADTMTRYKKARGYDTFFLTGTDEHGLKIEQKAEKLGMKPKAYLDGMVKDIKELWKKLDINYDKFIRTTDEEHVKAVQKIFEKLKASGDIYLGEYTGWYSVEDEEYFTESQLKEVFKDDQGNVVGGIAPSGHEVQLVKEPSYFFKMSKYADRLLQYYKDHPEFIQPNSREKEMVNNFI-KPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWIDALANYITALGYGSEDDSLFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFGHGWVLIYKDKMSKSKGNAVYPESLISRYGLDPVRYYLMRAIPFGADGSFTPEDFVERTNFDLANDLGNLLNRTVSMINQYQKGLVAPVDQEQDKYGQDLAAVAAKAISDYYGNMDKMHFSNALENVWQLISRANKYIDETTPWVLNKEGKTEELSRVMSNLAESLRLVAIMIAPVMTETPGKMFAQLGLDWEDESQKDLQF--GGFAWDVNVVAKPTPIFPRLKNDEE 526
>gi|15643843|ref|NP_228891.1| methionyl-tRNA synthetase [Thermotoga maritima MSB8] >gi|6094407|sp|O33925|SYM_THEMA Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|4981630|gb|AAD36162.1|AE001768_11 methionyl-tRNA synthetase [Thermotoga maritima MSB8] >gi|2645225|gb|AAB87143.1| methionyl-tRNA synthetase [Thermotoga maritima] (629 aa)
Score = 937, Expect = 1.3e-98, Identities = 194/517 (37%), Positives = 306/517 (59%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP-------EPIYLRIESED 1086
           KFYITTPIYY +  PHIG A+TT++AD++ RYK+ +GY+ FF+TG DEHGQK+ + A++    PQE  D+ A+ F  LWK L I   +FIRTT E H   VQE  +++ +   +Y G++KG YCV CE  + ++  V KE +++       P+   EEE+YF ++ +++  +  + ++ P+ V P  R NE+    +      DLSI+R+ F WG+ +K++P+HV+YVW+DAL+NY+S +GY   D+  F K+W +     + L+ KEI RFH I WP ML  +GL  P K  +HGW+     K+SKSLGN +DP +F+  YG D  RYYL++++   +D  FSE+ L++  N DLAN+ GNL +R   MI KY +G +P  S  +  F+   +++  +  D    +++   + + L ++ + I + N +    KPW L KE N + L   L   L AV +V     PV+ D S+E  ++ + +              L+N  +  P       EP++ +I+++D
  S:     2 KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQAGKDPQEFCDELAEKFKRLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYKGWYCVPCETFWNED-EVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDSLLKYYEEHPDFVEPDFRRNEMLK--ILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYGWNDEM-FNKWWPAD----LHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISKSLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRITAMIKKYFNGRLPSPSAQE-GFDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVNKYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSEEVFRRVSFEEKPSK-------EHLENWGVLKPGSTVIHGEPLFKKIDAKD 510
>gi|116513491|ref|YP_812397.1| methionyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092806|gb|ABJ57959.1| methionyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (660 aa)
Score = 936, Expect = 1.4e-98, Identities = 199/519 (38%), Positives = 302/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDK-----LYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI---DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           K FYITTPIYYPSG   IG+A+TT+ AD +TRYKK  GY+TFF+TG DEHG KIE+KA++L +KP+  +D   K    LWK L I Y  FIRTT E H   VQ+ F +L     IYLG + G Y V  EE +T++       DD+           H +   +E SYF K+ ++   +  + KD P  + P +R  E+ N+F+     +DLS++R+   WGI +  +PKHVVYVW+DAL NY++ LGY  +DDS F+K+W +     V L+ KEI RFH IYWPIML  L L  P +   HGW++  + KMSKS GN + P   I+ YG D  RYYL++ +    D  F+ +  +   N DLAN++GNL NR++ MIN+Y+ G++    + +  +  +      +   +    ++K++    L  V  LI+  N +I++  PW L KE   ++L   +S +  +++ V   + PV+ +   +   Q  +   D S+ D++F     + D   +  P PI+ R++++++
  S:     6 KTFYITTPIYYPSGRLTIGNAYTTVAADTMTRYKKARGYDTFFLTGTDEHGLKIEQKAEKLGMKPKAYLDGMVKDIKELWKKLDINYDKFIRTTDEEHVKAVQKIFEKLKASGDIYLGEYTGWYSVEDEEYFTESQLKEVFKDDQGNVVGGIAPSGHEVQLVKEPSYFFKMSKYADRLLQYYKDHPEFIQPNSREKEMVNNFI-KPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWIDALANYITALGYGSEDDSLFKKYWPAD----VHLVGKEIVRFHTIYWPIMLMALDLPLPKQVFGHGWVLIYKDKMSKSKGNAVYPESLISRYGLDPVRYYLMRAIPFGADGSFTPEDFVERTNFDLANDLGNLLNRTVSMINQYQKGLVAPVDQEQDKYGQDLAAVAAKAISDYYGNMDKMHFSNALENVWQLISRANKYIDETTPWVLNKEGKTEELSRVMSNLAESLRLVAIMIAPVMTETPGKMFAQLGLDWEDESQKDLQF--GGFAWDVNVVAKPTPIFPRLKNDEE 526
>gi|95930673|ref|ZP_01313407.1| methionyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] >gi|95133325|gb|EAT14990.1| methionyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] (510 aa)
Score = 936, Expect = 1.6e-98, Identities = 203/515 (39%), Positives = 299/515 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLN---IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIE 1083
           K FYITTPIYY +  PHIGHA+TTL  DVL RYKK  GYE FF+TG DEHGQK+E+ A      P EL D+  + F  LW+ L I+ + FIRTT + HK  VQ+ F+++ ++  IYLG ++  YC  CE  +T+   +     D   C +  P  + +EESYF ++ ++++ +   ++ +P+ + P +R NE+  SF+  +   DLSISR++FSWGI +  + KHV+YVW DAL NY++ LGY       F+KFW       V ++ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++TYG D  RY+LL+E+    D  FS   LI+  N DLAN++GNL +RS  M+NKY  G +P   +P    +I+ +  + QF  ++  I +++N     K L  + +LI+  N +I+   PW L K+  +K+ L   +  +L AV+ +   + P L D  K  ++    DS    +     +  L     I    P++ RIE
  S:     3 KTFYITTPIYYVNDVPHIGHAYTTLACDVLARYKKARGYEVFFLTGTDEHGQKVEKAAIAAGETPLELADRVMQRFAALWQKLNIDNTDFIRTTQQRHKEGVQKMFTQIQEQGDIYLGAYEDWYCTPCETFWTETQLIDGCCPD---CGR--PTDKLKEESYFFRMSKYQQQLLDHIEANPDFIQPRSRRNEVL-SFV-REGLRDLSISRTSFSWGIPVPGDDKHVIYVWFDALNNYITALGYPDDKQGTFEKFWPCS----VHVIGKDILRFHTVYWPTFLMAAGLPLPEKVFAHGWWTVEGKKMSKSLQNVVEPNMLVDTYGIDPIRYFLLREVPFGLDGDFSHSALIHRINSDLANDLGNLVSRSTAMLNKYFGGTLP---EPTAMADID-QPFIDQFPAKLELIDKQMNDLAFNKALLSIWELISSANKYIDDTAPWGLAKDEAQKERLGTVMYNLLEAVRLIGLMVAPFLPDTGKRIMEILGQDSDNLMLDGQDQWGGLQAGTTIEKAPPMFPRIE 508
>gi|153956357|ref|YP_001397122.1| methionyl-tRNA synthetase [Clostridium kluyveri DSM 555] >gi|146349215|gb|EDK35751.1| MetS [Clostridium kluyveri DSM 555] (644 aa)
Score = 935, Expect = 2.2e-98, Identities = 204/517 (39%), Positives = 308/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           +YITTPIYYPS N HIG+ +TT+ AD L R+K+  GY+   +TG DEHGQKI+  A+   + P+E VD+      +LWK++ I Y  FIRTT +YH   VQ+ F +L  +  IY G ++G YC  CE  +T+   +    D K  C      ++K +EE+YF K+ ++    I      P+ + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  +DD  ++K+W +     V L+ K+I RFH IYWPIML  LG   P K   HGW++ + GKMSKS GNV+DP+  +N +G DA RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R+  MI KY DGI+P    PK   +I+ E  L     +I   IEK    L I + L  + +L++  N +I++  PW L K+ ++KD L   L  +  +++ +   L   L + S++  KQ N++ + +D     D  +    K+N  + ++ RI+ + K
  S:     6 YYITTPIYYPSANLHIGNTYTTVAADALARFKRITGYDVMLLTGTDEHGQKIQRLAEAKGVPPKEYVDEIVAGIKDLWKIMNINYDKFIRTTEKYHIAAVQKIFKKLYDQGDIYKGNYEGWYCTPCESFWTETQLI----DGK--CPDCGRTVEKAKEEAYFFKMSKYAPALIKHIETHPDFIQPESRKNEMLNNFLK-PGLQDLCVSRTSFDWGIPVTFDNKHVIYVWIDALANYITALGYGSEDDKLYKKYWPAN----VHLVGKDILRFHTIYWPIMLMALGEEIPEKVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDAVRYYLLREIPFGADGLFNNEIFIKKINSDLANDLGNLLSRTCTMIEKYFDGIMP---APKEKEDIDDE--LIGLALDIPIKIEKHMNHLRIPEALDSIWELVSRTNKYIDETTPWILAKDESKKDRLGTVLYNLSESLRIISVCLSAFLPETSEKIYKQLNVEVTSWDSIASFD-GTRSGTKVNKGDILFPRIDVDKK 512
>gi|160943218|ref|ZP_02090454.1| hypothetical protein FAEPRAM212_00704 [Faecalibacterium prausnitzii M21/2] >gi|158445457|gb|EDP22460.1| hypothetical protein FAEPRAM212_00704 [Faecalibacterium prausnitzii M21/2] (665 aa)
Score = 935, Expect = 2.2e-98, Identities = 187/515 (36%), Positives = 296/515 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           K FYITTPIYYPS   HIGH++TT+  D L R+K+  GY+  F+TG DEHGQKI++KA +  + P+E VDK      +LWKLL + Y  FIRTT +YH    Q+ F++L ++  IY G + G YC  CE  +T +  V  +  D   C +   +    EE+YF K  ++  + +  + ++P  + P +R NE+  +F+      D  +SR++  WGI +  +PKH +YVW+DAL NY+S LGY  +   ++ KFW +     + ++ KEI RFH I WP ML  L L  P +   HGW++   GKMSKS+GNV+DP+   + YG DA RY+LL+E+    D +F+ + LIN  N DLAN++GNL +R++ M  KY  G +   +  + + + E E  + +   ++T  ++ L I + L  +  +I   N +I++  PW L K E N++ L+  L  +  A++     L   L   + + ++Q  +D+S  D+   T + +     ++  E ++ RI+
  S:     5 KTFYITTPIYYPSDKLHIGHSYTTVACDALARFKRMQGYDVMFLTGTDEHGQKIQDKAADAGVTPKEYVDKIVATVKDLWKLLDVSYDRFIRTTDDYHMESCQKIFTKLYEQGDIYKGEYIGHYCKPCESFWTDSQLVDGKCPD---CGR--EVYDAHEEAYFFKTSKYADRLLKLYEENPQFIQPESRKNEMI-AFIKQ-GLQDTCVSRTSVKWGIPVPFDPKHTMYVWVDALSNYISALGYGNETYHDYDKFWPAD----LHMVGKEILRFHTILWPAMLMALDLPLPKRVFGHGWLLMNGGKMSKSVGNVVDPVILCDRYGVDAIRYFLLREIPFGNDGMFTNEALINRINSDLANDLGNLLSRTVAMCEKYFGGTVHNVAGTE-AIDTELETMVNELTAKVTADMDDLTIPQALMEIFAVIQRANKYIDETAPWALAKDEANKQRLESVLYHLCEALRVCGILLNAYLPTTAPKMMEQLGLDASALDLTKTT-YGAQQTYTVHKGEALFPRID 508
>gi|170289510|ref|YP_001739748.1| methionyl-tRNA synthetase [Thermotoga sp. RQ2] >gi|170177013|gb|ACB10065.1| methionyl-tRNA synthetase [Thermotoga sp. RQ2] (629 aa)
Score = 934, Expect = 2.8e-98, Identities = 193/517 (37%), Positives = 308/517 (59%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIESED 1086
           KFYITTPIYY +  PHIG A+TT++AD++ RYK+ +GY+ FF+TG DEHGQK+ + A++    PQE  D+ A+ F  LWK L I   +FIRTT E H   VQE  +++ +   +Y G++KG YCV CE  + ++  V KE +++       P+   EEE+YF ++ +++  +  + ++ P+ V P  R NE+    +      DLSI+R+ F WG+ +K++P+HV+YVW+DAL+NY+S +GY   D+  F K+W +     + L+ KEI RFH I WP ML  +GL  P K  +HGW+     K+SKSLGN +DP +F+  YG D  RYYL++++   +D  FSE+ L++  N DLAN+ GNL +R   MI KY +G +P  S  +   +   +++  +  D    +++   + + L ++ + I + N +    KPW L KE N + L   L   L AV +V     PV+ D SKE  ++ + +  K   + + ++  L +   +   EP++ +I+++D
  S:     2 KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQAGKDPQEFCDELAEKFKQLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYKGWYCVPCETFWNED-EVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDPLLKYYEEHPDFVEPDFRRNEMLK--ILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYGWNDEM-FNKWWPAD----LHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISKSLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRITAMIKKYFNGRLPSPSAQE-GLDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVNKYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSKEVFRRVSFE-EKPSKEHLENWGVLKSGSTVVHGEPLFRKIDAKD 510
>gi|188039653|ref|ZP_02998354.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] >gi|188039682|ref|ZP_02998375.1| methionyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] (314 aa)
Score = 934, Expect = 3.0e-98, Identities = 180/312 (57%), Positives = 225/312 (72%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNV 880
           KKF+I+TPIYY SGNPHIGHA+TT+IADVL RYK+  GY+ FF+TGMDEHGQKI++KA E N+ P+ LVD+ + +F NLWK L I +S FIRTT   H+  VQ+ FS L K+  IYLG W G YCVSCEENY     + K  D+ + C   H L  K EESYF K+     ++ ++ ++ PN + P  R NE+ N+FLNN   +DLSISR+ F WGI I ENPKHV+YVWLDAL+NYL+  GY   +D  FQK+W   + EIV L+SKEI RFHCIYWPI L  L +R P+  +SHGWIIT++GKMSKSLGNV
  S:     5 KKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKRLHISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNP-AEIIKSQDNIMLCRMGHKLETKSEESYFYKMSDQAPFLKTYYQNHPNFIIPNERANEMINNFLNN--LEDLSISRTTFDWGIPIAENPKHVIYVWLDALMNYLTATGYLSNNDELFQKYWCDNETEIVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNV 314
>gi|148270780|ref|YP_001245240.1| methionyl-tRNA synthetase [Thermotoga petrophila RKU-1] >gi|147736324|gb|ABQ47664.1| methionyl-tRNA synthetase [Thermotoga petrophila RKU-1] (629 aa)
Score = 934, Expect = 3.0e-98, Identities = 193/517 (37%), Positives = 308/517 (59%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIESED 1086
           KFYITTPIYY +  PHIG A+TT++AD++ RYK+ +GY+ FF+TG DEHGQK+ + A++    PQE  D+ A+ F  LWK L I   +FIRTT E H   VQE  +++ +   +Y G++KG YCV CE  + ++  V KE +++       P+   EEE+YF ++ +++  +  + ++ P+ V P  R NE+    +      DLSI+R+ F WG+ +K++P+HV+YVW+DAL+NY+S +GY   D+  F K+W +     + L+ KEI RFH I WP ML  +GL  P K  +HGW+     K+SKSLGN +DP +F+  YG D  RYYL++++   +D  FSE+ L++  N DLAN+ GNL +R   MI KY +G +P  S  +   +   +++  +  D    +++   + + L ++ + I + N +    KPW L KE N + L   L   L AV +V     PV+ D SKE  ++ + +  K   + + ++  L +   +   EP++ +I+++D
  S:     2 KFYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQAGKDPQEFCDELAEKFKQLWKELKITNDYFIRTTDEMHMKTVQEFVAKMKENGDVYKGIYKGWYCVPCETFWNED-EVIKEGEERFCPECKRPVKWVEEENYFFRLSKYRDPLLKYYEEHPDFVEPDFRRNEMLK--ILEGGLKDLSITRTTFKWGVPMKDDPEHVIYVWVDALINYISAIGYGWNDEM-FNKWWPAD----LHLIGKEINRFHSIIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISKSLGNAIDPRFFVKRYGNDVVRYYLIRDIMFGKDGDFSEERLVHRLNSDLANDYGNLLHRITAMIKKYFNGRLPSPSAQE-GLDSWLKERFFETKDAYHELMDSYRLTEALDKIWEFIADVNKYFNDTKPWILGKEGNMERLGTVLYNSLEAVFKVALMTLPVMPDTSKEVFRRVSFE-EKPSKEHLENWGVLKSGSTVIHGEPLFRKIDAKD 510
>gi|182420024|ref|ZP_02951258.1| methionyl-tRNA synthetase [Clostridium butyricum 5521] >gi|182376061|gb|EDT73648.1| methionyl-tRNA synthetase [Clostridium butyricum 5521] (647 aa)
Score = 933, Expect = 3.1e-98, Identities = 189/489 (38%), Positives = 288/489 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFD 1057
           K FYITTPIYYPS   HIG+ +TT+ AD + R+K+  GY+  F+TG DEHGQKI+  A+E  + P E VD+      +LWK++ I Y  FIRTT +YH   VQ+ F +L  +  IY   ++G YC  CE  +T    V     D   C +  P+ + +EE+YF K+ ++   +  ++++ P+ + P +R NE+ N+FL      DL +SR++F WG+ +  + KHVVYVW+DAL NY++ LGY Q +   + KFW +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DL N++GNL +R++ MI KY DG IP  ++ K  F+ E          ++   + +LN+   L  V +LI   N +I++  PW L K+ ++K  L   L  ++ +++     +   L D +K+  +Q N +   +D
  S:     7 KPFYITTPIYYPSTKLHIGNTYTTVAADAIARFKRLTGYDVMFLTGTDEHGQKIQRIAEEKGITPIEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQDIFKKLYDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPD---CGR--PVEKSKEEAYFFKMSKYADRLIKYIEEHPHFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFDWGVPVTFDEKHVVYVWIDALSNYITALGYGQDNKELYDKFWPAD----VHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLREIPFGADGLFNNEIFIKKINSDLCNDLGNLLSRTVAMIEKYFDGEIPAQAE-KGEFDDELINLALSTPAKVEEAVTELNLPLALEHVFELIGRANKYIDETTPWILAKDEDKKARLGTVLYNLIESLRFASVMISAFLPDTAKKINEQINTEVLSWD 486
>gi|114565624|ref|YP_752778.1| methionyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336559|gb|ABI67407.1| methionyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (645 aa)
Score = 932, Expect = 4.6e-98, Identities = 196/515 (38%), Positives = 305/515 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIE 1083
           K +YITTPIYYPS N HIGHA+TT+ AD + R+K+  GY+ F++TG DEHGQKIE+ A+E  ++P + VD   +    LW+ + I ++ FIRTT   H+ +VQ+ F+++ ++  I++  ++G YC  CE  +T+         D   C +   L++  EESYF  + ++  + +      P+ + P +R NE+ N F+     +DL +SR+ F WG+ +  N KHVVYVW DAL+NYL+ +GY   D+  F+++W +     V LM+K+I RFH I WPIML  L L  P K  +HGWI+ E GKMSKS GNV+DP+  +  YG DA RYYL++ELS  +D  +SE++L+N  N DLAN++GNL +R+I MI +Y DG+IP  S    + + +     ++   E T  ++KL+    +     L++  N +I++  PW L KE  +K+ L   +  +  +++  +  L P +      A +Q  I    FD+    D+             K+   EP++ RI+
  S:     5 KSYYITTPIYYPSDNLHIGHAYTTVAADCMARFKRMQGYDVFYLTGTDEHGQKIEKAAREKGMEPIKYVDGIVESIRQLWETMLITHTDFIRTTEARHEQLVQKIFNKVYEQGDIFISQYEGWYCTPCETFFTERQLAEGNCPD---CGREVELLK--EESYFFNMSKYADRLLEHIETHPDFIQPESRRNEVVN-FIKMG-LEDLCVSRTTFQWGVPVPFNQKHVVYVWFDALINYLTAIGY-MDDEEKFKQYWPAD----VHLMAKDIIRFHAIIWPIMLMALDLPLPKKVCAHGWIMLEGGKMSKSKGNVVDPVVLVKKYGVDAVRYYLVRELSFGQDGYYSEEMLVNRINSDLANDLGNLISRTIAMIERYFDGVIP-VSGIAEALDEDLINTAREAYREATEKLDKLDFASYIMATRKLVSRANKYIDETAPWLLAKEVAKKERLASVMYNLAESIRIALIMLAPCMPTLLSRANRQIEI----FDLNQNLDWDEAAEWGRCKAGSKVRRGEPLFPRID 511
>gi|116491711|ref|YP_811255.1| methionyl-tRNA synthetase [Oenococcus oeni PSU-1] >gi|118587385|ref|ZP_01544811.1| methionine-tRNA ligase [Oenococcus oeni ATCC BAA-1163] >gi|116092436|gb|ABJ57590.1| methionyl-tRNA synthetase [Oenococcus oeni PSU-1] >gi|118432209|gb|EAV38949.1| methionine-tRNA ligase [Oenococcus oeni ATCC BAA-1163] (675 aa)
Score = 932, Expect = 4.7e-98, Identities = 196/482 (40%), Positives = 294/482 (60%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQK------DDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           +FYITTPIYYPSG   +G+ +TT++AD + R+ + LG + FF+TG DEHG KI+EKA+       E +D+ A     LWKL+ I Y  FIRTT EYH+ VVQ  F + + +  IY G + G Y VS EE +T++    V ++ D K+   +    H +   +EE+YF K+ ++  ++  +  D P  + P +R+NE+ ++F+     +DL+++R++F+WGI +  + KHV+YVW+DAL NY++ LGY  +          F+KFW +     +QL+ KEI RFH IYWPIML  LGL  P + + HGW++ + GKMSKS GNV+ P    + YG DA RYYLL+ +    D VFS +  +N  N DLAN++GNL NR+I MIN+Y +G IPK  K  L  + E E+   Q  +     +EK++    L  V  LI   N +I++ +PW L K     +LD  ++ +  +++ V   L+PVL    K+   Q  +
  S:     6 RFYITTPIYYPSGKLQLGNTYTTVLADSVARFHRALGEDVFFLTGTDEHGLKIQEKAEAAGKSEMEYLDEMAVSIKKLWKLMNISYDKFIRTTDEYHERVVQHIFKKFMDEGDIYKGNYTGWYSVSDEEYFTESQLAEVYRDKDGKVIGGKAPSGHEVQLVKEETYFFKMSKYSDWLLQYYHDHPEFLQPESRMNEMISNFIK-PGLEDLALTRTSFNWGIPVPGDEKHVIYVWIDALSNYITALGYDPELGDFDHQPELFKKFWPAN----LQLVGKEIVRFHTIYWPIMLHALGLPLPGEVLGHGWLVMKNGKMSKSKGNVVYPETLESRYGLDAVRYYLLRSMPFGNDGVFSPEDFVNRVNFDLANDLGNLLNRTISMINRYENGQIPKLDK-LLPEDRELEETASQAVENFKDEMEKVHTADALEAVWTLIRRTNKYIDETEPWVLDKNKQRAELDDAMAHLAASLRVVGSLLQPVLTQAPKKIFDQLGL 493
>gi|148265184|ref|YP_001231890.1| methionyl-tRNA synthetase [Geobacter uraniireducens Rf4] >gi|146398684|gb|ABQ27317.1| methionyl-tRNA synthetase [Geobacter uraniireducens Rf4] (509 aa)
Score = 931, Expect = 5.5e-98, Identities = 189/466 (40%), Positives = 285/466 (61%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIE--FEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYL 1034
           + FY+TTPIYY +  PHIGHA+TTL ADVL RYK+  G+E FF+TG DEHGQK+E+ A      PQEL D+  K F  LW+ L I Y+ FIRTT E HK  V + F++++ K  IYLG ++  YC  CE  +T+   +  +  D   C +  P  + +EESYF ++ ++++ + + ++ +P+ + P +R NE+  SF+  +   DLS+SR+ F+WGI +  N KHV+YVW DAL NY++ LGY   +  NF KFW   DA    L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   I+ YG DA RY+LL+E+    D  FS   L++  N DLAN++GNL NRS  M+NKY  G++     P +   I+  + ++ ++   ++   +++L   K L  + ++++  N +I++  PW L K+  +KD    +   L   +R++Y++
  S:     3 RAFYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFEVFFLTGTDEHGQKVEKAANAAGETPQELADRVMKRFQALWEKLDISYTDFIRTTQERHKKGVADLFTKVMGKGDIYLGEYEDWYCTPCETFWTETQLIDYKCPD---CNR--PTEKLKEESYFFRMSKYQEQLLAHIEANPDFIQPKSRRNEII-SFV-REGLRDLSVSRTTFTWGIPVPGNDKHVIYVWFDALTNYITALGY-PDESGNFSKFW-PVDA---HLIGKDILRFHAVYWPTFLMAAGLPVPKKVFAHGWWTVEGQKMSKSLQNVVEPNMLIDKYGVDAIRYFLLREVPFGLDGDFSHTALVHRINSDLANDLGNLLNRSTAMVNKYFGGVV---QAPGVFNEIDSIYREKTEEMVRQVDAHLDELAFSKALQSIWEVVSAGNKYIDETAPWTLAKDEAQKDRLATVMYCLLESQRIVYFI 456
>gi|187934680|ref|YP_001884366.1| methionyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] >gi|187722833|gb|ACD24054.1| methionyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] (645 aa)
Score = 929, Expect = 1.0e-97, Identities = 197/519 (37%), Positives = 303/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS   HIG+ +TT+ AD L R+K+  GYE  F+TG DEHGQKI+  A+E  + P E VD+      +LW ++ + Y  FIRTT +YH   VQ+ F +L  +  IY   ++G YC  CE  +T    V     D   C +  P+ + +EE+YF K+ ++   +  ++++ PN + P +R NE+ N+FL      DL +SR++F WG+ +  +  HVVYVW+DAL NY++ LGY Q +   + KFW +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DL N++GNL +RS+ MI KY DG I   ++       EF+++L        +++   I++LNI   L  V +LI   N +I++  PW L K+ ++K  L   L  ++ +++     +   L D +K+  +Q N D   ++   +  F+ +    K+   E ++ RI+ E K
  S:     7 KPYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGYEVMFLTGTDEHGQKIQRIAEEKGITPIEHVDEIVAGIKDLWSMMNVSYDKFIRTTDDYHVKAVQDIFKKLHDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPD---CGR--PVEKSKEEAYFFKMSKYADRLIKYIEENPNFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFDWGVPVTFDESHVVYVWIDALSNYITALGYGQDNKELYDKFWPAD----VHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLREIPFGADGLFNNEIFIKKINSDLCNDLGNLLSRSVAMIEKYFDGEIQPQAESG-----EFDEELINLALAAPNKVQEAIDELNIPLALEHVFELIGRANKYIDETTPWILAKDESKKARLGTVLYNLIESLRFASVMISSFLPDTAKKINEQINTDEISWE--SLKSFNGIKAGNKVAKGENLFPRIDVEKK 515
>gi|188588457|ref|YP_001919550.1| methionyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] >gi|188498738|gb|ACD51874.1| methionyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] (645 aa)
Score = 929, Expect = 1.1e-97, Identities = 197/519 (37%), Positives = 303/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESEDK 1087
           K +YITTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+E  + P E VD+      +LW ++ + Y  FIRTT +YH   VQ+ F +L  +  IY   ++G YC  CE  +T    V     D   C +  P+ + +EE+YF K+ ++   +  ++++ PN + P +R NE+ N+FL      DL +SR++F WG+ +  +  HVVYVW+DAL NY++ LGY Q +   + KFW +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DL N++GNL +RS+ MI KY DG I   ++       EF+++L        +++   I++LNI   L  V +LI   N +I++  PW L K+ N+K  L   L  ++ +++     +   L D +K+  +Q N D   ++   +  F+ +    K+   E ++ RI+ E K
  S:     7 KPYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGYDVMFLTGTDEHGQKIQRIAEEKGITPIEHVDEIVAGIKDLWSMMNVSYDKFIRTTDDYHVKAVQDIFKKLHDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPD---CGR--PVEKSKEEAYFFKMSKYADRLIKYIEENPNFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFDWGVPVTFDENHVVYVWIDALSNYITALGYGQDNKDLYDKFWPAD----VHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLREIPFGADGLFNNEIFIKKINSDLCNDLGNLLSRSVAMIEKYFDGEIQPQAESG-----EFDEELINLALAAPNKVQEAIDELNIPLALEHVFELIGRANKYIDETTPWILAKDENKKARLGTVLYNLIESLRFASVMISSFLPDTAKKINEQINTDEISWE--SLKSFNGIKAGTKVVKGENLFPRIDVEKK 515
>gi|15896243|ref|NP_349592.1| methionyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] >gi|25009386|sp|Q97EW5|SYM_CLOAB Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|15026047|gb|AAK80932.1|AE007796_2 Methionyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] (644 aa)
Score = 928, Expect = 1.3e-97, Identities = 201/519 (38%), Positives = 301/519 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII-PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KKFYITTPIYYPS   HIG+ +TT+ +D L R+K+  GY+ F +TG DEHGQKI+  A++  + P+  VD+      +LWK++ I Y  FIRTT E H   VQ+   +      IY   ++G YC  CE  +T+   V  +  D   C +  P+ + +EE+YF K+ ++   +  +++D P+ + P +R NE+ N+FL      DL ISRS+F WGI I  + KHV+YVW+DAL NY++ LGY   +D  + KFW +     + L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  IN +G D  RYYLL E+    D +F+ ++ I   N DLAN++GNL +R+  MI KY DG I P   K ++  + E         +++   I+KL I + L  + DLI   N +I++  PW L K+ N+K  L   L  ++ +++ V   L P L +  ++   Q NI+   ++     D  +    K++  E I+ RI+ + K
  S:     5 KKFYITTPIYYPSAKLHIGNTYTTVASDALVRFKRLQGYDAFMLTGTDEHGQKIQRIAEDKGITPKAYVDEIVAGIKDLWKMMNISYDKFIRTTDEEHVKAVQKIVKKFYDNGDIYKSAYEGWYCTPCESFWTETQLVDGKCPD---CGR--PVEKTKEEAYFFKMSKYADRLIKYIEDHPDFIQPESRKNEMLNNFL-KPGLQDLCISRSSFDWGIPITFDEKHVIYVWIDALSNYITALGYGSDNDELYNKFWPAD----LHLVGKDIIRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLINEFGTDPVRYYLLHEIPFGSDGLFNNEIFIKKINSDLANDLGNLVSRTAAMIEKYFDGSIQPPVDKEEI--DNELIDMAISLPEKLDEDIKKLKIPEALDHIWDLIKRANKYIDETTPWVLAKDENKKARLGTVLYNLVESLRFVATTLTPFLPETGEKIKTQLNIELDTWESLSAFD-GTRAGTKVSKGEVIFPRIDVDKK 513
>gi|189425008|ref|YP_001952185.1| methionyl-tRNA synthetase [Geobacter lovleyi SZ] >gi|189421267|gb|ACD95665.1| methionyl-tRNA synthetase [Geobacter lovleyi SZ] (508 aa)
Score = 927, Expect = 1.6e-97, Identities = 194/476 (40%), Positives = 285/476 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           FY+TTPIYY +  PHIGHA+TT+ ADVL RYK+  G++ FF+TG DEHGQK+E+ A+     P EL D+  K F  LW+ LGI ++ FIRTT E HK  V   F +L+++  IYLG ++  YC  CE  +T+     +  D K  C   +  ++K +EESYF K+  + +K ++    +P+ + P TR NE+  SF+  +   DLS+SR++FSWGI +  N +HV+YVW DAL NY+S LGY    D N+ ++W + DA    L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   I+ YG D  RY+LL+E+    D  FS   LIN  N DLAN++GNL +RS  M+ KY DGI+P    P    +   + + +     +   +++L   K L  + D+I+  N +I++  PW L K+  +++ L   +  +L A + V   + P +   +++AL
  S:     5 FYVTTPIYYVNDVPHIGHAYTTVAADVLARYKRMKGFDVFFLTGSDEHGQKVEKAAQTNGETPLELADRVVKRFQALWEKLGISHNDFIRTTQERHKQGVTHIFKQLMEQGDIYLGEYEDWYCTPCETFWTET----QVEDGK--CPDCNRPVEKLKEESYFFKMSAYGEKLLAHIEANPDFIQPKTRRNEII-SFV-KEGLRDLSVSRTSFSWGIPVPGNERHVIYVWFDALTNYISALGYPNA-DGNYGRYWPA-DA---HLIGKDILRFHTVYWPTFLMAAGLPIPQKVFAHGWWTVEGQKMSKSLQNVVEPNMLIDKYGVDVVRYFLLREVPFGLDGDFSHGSLINRINSDLANDLGNLLSRSTAMLVKYFDGILPA-PGPLSELDATLKTKAEAMLAAVDNCMDELAFSKALQSIWDVISAGNKYIDETAPWGLAKDPAKREQLATVMYCLLEAQRLVHSLVAPFMPQTARKAL 469
>gi|193216594|ref|YP_001999836.1| methionyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] >gi|193001917|gb|ACF07132.1| methionyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] (517 aa)
Score = 922, Expect = 6.4e-97, Identities = 213/517 (41%), Positives = 311/517 (60%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGI---QIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINK-YRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRI 1082
           E  K FYI+TPIYYPSG  HIGH  TT +A V   +K+  GY+TFF+TG+DEHGQKI +KAK  NL  Q   D+ AK+F  LW  L I+Y  F RTT+  H+ +V++ F  LLKK FIY G ++GLY V  EE  TK+ A    N +  +    H L    EESYF K+  F  +I  + + +P+ V     INE+ N+F+ N   +DLS++R +F WGI   Q ++   HV+YVWLDAL NYL+ L + ++DD N+QKFW     E V ++ KEI+RFHCIYWPI L+ L L+ PTK I H WI+T +GKMSKS GNV+DP+  +  YG +  +Y+   ++++  D  FSE LLIN  N DLANN GNL NR+I M+N+ +++G   +  K  L+ + E   +++Q               K L + ++L +  N +I++ +PW LK  +N + L+  L+ +LN +  V+ Y+  V        + QF +  +K     + +F+  D +++     ++ RI
  S:     2 ETKKTFYISTPIYYPSGKLHIGHLLTTTLAWVYRNFKRNEGYDTFFVTGIDEHGQKIAQKAKLANLSDQAYADEQAKIFLELWDDLKIDYDFFSRTTSPKHEVIVKKVFDALLKKGFIYKGKYEGLYSVEDEEFLTKSQAFLI-NGEYYHPTSKHKLNVVSEESYFFKMSSFGPWIKDYFENNPDFVSSKATINEMLNNFI-NPGLEDLSVTRVSFDWGIKLDQYQDKKTHVIYVWLDALFNYLTALNFWEEDDENYQKFW-VNGTERVHILGKEISRFHCIYWPIFLQALDLKLPTKEIVHSWIVTPEGKMSKSKGNVIDPLPLVKKYGIEEVKYFFSSQVNIDSDFAFSESLLINVLNADLANNFGNLVNRTIKMVNQSFKEGTTYQ-EKDLLALDKELYLKIEQLYQSYCEHFNNFYADKALKKAVELSSFLNEYIDRNEPWKLK--DNLERLNVVLNTLLNGI-YVVNYMLSVAFPIKSARINQF-LCQTKLSKGLIFNFNKFDYKEVFVDNIVFPRI 515
>gi|164688857|ref|ZP_02212885.1| hypothetical protein CLOBAR_02505 [Clostridium bartlettii DSM 16795] >gi|164602061|gb|EDQ95526.1| hypothetical protein CLOBAR_02505 [Clostridium bartlettii DSM 16795] (648 aa)
Score = 919, Expect = 1.6e-96, Identities = 190/488 (38%), Positives = 286/488 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF 1056
           + FYITTPIYYPSG  HIGH +TT+  D + R+K+  GY+  F+TG DEHG+KI++KAKE  +   E +D        LWK + I Y  FIRTT   H  ++Q+ F++L ++  IY G ++G YC  CE  +T++  V   + DK         + K EE+YF K+ +++  I    K+PN  +P  R NE+  +FL     +DL ++R+ F WGI++  + KHV+YVW+DAL NY++ LGY  +DDS F+K+W +     +Q++ KEI RFH I WP +L  L L    +   HGWI+    KMSKS GN++ P   I  YG D  +YYLL+E +  +D  ++ +  I   N DLAN++GNL +R+I M+ KY  GIIP   +PK++   EF++ LKQ   E   I E    K+   + L  V  LI   N +I++  PW L K+ ++KD LD  L  +  +++     + P++   +K+   Q  I+  + 
  S:     4 ETFYITTPIYYPSGRLHIGHTYTTVATDAIARFKRFCGYDVRFLTGTDEHGEKIQKKAKEAGMTEMEYLDGMIADIKKLWKTMDISYDDFIRTTEPRHTKIIQKIFTKLYEQGDIYKGEYEGRYCTPCESFWTESQLV---DGDKCPDCGRETYVAK-EEAYFFKLSKYEDRIKELFKNPNYCFPEARANEMIANFL-EPGLEDLCVTRTTFDWGIKVPFDEKHVIYVWVDALCNYITALGYMSEDDSLFKKYWPAN----IQVVGKEIIRFHTIIWPALLMALDLPVSKQVFGHGWILFANDKMSKSKGNIVYPEQMIERYGIDTLKYYLLREFAFGQDGSYTHRNFITRINTDLANDLGNLVSRTIAMVEKYNGGIIP---EPKVA--TEFDEALKQQAAESRRIFEEQMNKMQFHEALEGVWKLIRRTNKYIDETAPWVLAKDESKKDVLDTVLYNLCESIRIFSTLINPIMNTTAKKIYAQMGIEGEEL 482
>gi|160933682|ref|ZP_02081070.1| hypothetical protein CLOLEP_02543 [Clostridium leptum DSM 753] >gi|156867559|gb|EDO60931.1| hypothetical protein CLOLEP_02543 [Clostridium leptum DSM 753] (650 aa)
Score = 917, Expect = 2.5e-96, Identities = 184/441 (41%), Positives = 260/441 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI-----------IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKK 1009
           K FYITTPIYYPSG  HIGH++ T+  D + RYK+  GY+  F+TG DEHGQKIE  A +  + P+E VD+    F  LWKLL I    FIRTT +YH   VQ+ F EL  +  IY G ++G YC  CE  +T+     +  D K  C      ++  EEE+YF K+  +   +    +D P+ + P +R NE+   F+ N   DDL +SR++F+WGI +  +PKHVVYVWLDAL NY++ +GY   DDS+++K+W +     V  + KEI RFH I WP +L  L L  P +   HGW++   G KMSKS GNV+DP+   + YG DA RY+LL+E+    D +F+ + LIN  N DLAN++GNL +R+  M+ KY  G IP             ++Q +  D ++  +           ++       L+ V  LI   N +I++  PW L K
  S:     4 KTFYITTPIYYPSGKAHIGHSYCTVATDAIARYKRMQGYDVMFLTGTDEHGQKIELNAAKAGVTPKEYVDEIVAGFQELWKLLNISNDRFIRTTDDYHVKAVQKIFKELYDRGEIYKGKYEGWYCTPCESFWTET----QLKDGK--CPDCGREVKWAEEEAYFFKLGNYADRLLKLYEDQPDFIQPESRKNEMIQ-FIKN-GLDDLCVSRTSFTWGIPVDFDPKHVVYVWLDALTNYITAMGYGSGDDSDYRKYWPAD----VHFIGKEIVRFHTIIWPAILMALDLPLPKQVYGHGWLLFGDGSKMSKSKGNVVDPVILCDRYGVDAIRYFLLREIPFGADGLFTNEALINRINYDLANDLGNLLSRTTAMVQKYFGGSIPA------------QRQAEDLDQDLVAMATSLRGRYEESMDGFQFSNALAEVWKLIARSNKYIDETMPWALGK 434
>gi|78223524|ref|YP_385271.1| methionyl-tRNA synthetase [Geobacter metallireducens GS-15] >gi|78194779|gb|ABB32546.1| methionyl-tRNA synthetase [Geobacter metallireducens GS-15] (509 aa)
Score = 917, Expect = 2.5e-96, Identities = 186/466 (39%), Positives = 283/466 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYL 1034
           + FY+TTPIYY +  PHIGHA+TTL ADVL RYK+  GY+ FF+TG DEHGQK+E+ A      P EL D+  K F  LW+ L I Y+ FIRTT E HK  V   F E++ K  IYLG ++  YC  CE  +T+   +  +  D   C +  P+ + +EESYF ++ ++++ + + ++ +P+ + P +R NE+  SF+  +   DLS+SR++F+WGI +  N +HV+YVW DAL NY++ LGY  +   N+ KFW   DA    L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+    D  FS   L++  N DLAN++GNL +RS  M+NKY  G +P+        +  F  + +    ++ + ++++   K L  + ++I+  N +I++  PW L K+  +K+ L   +  +L A +R+++ L
  S:     3 RTFYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGYDVFFLTGTDEHGQKVEKAANAAGETPLELADRVVKRFQALWEKLDISYNDFIRTTQERHKKGVTHLFREVMAKGDIYLGEYEDWYCTPCETFWTETQLIDGKCPD---CNR--PVEKLKEESYFFRMSKYQEQLLAHIEANPDFIQPKSRRNEII-SFV-KEGLRDLSVSRTSFNWGIPVPGNERHVIYVWFDALTNYITALGYPDQ-AGNYGKFW-PVDA---HLIGKDILRFHAVYWPTFLMAAGLPVPRKVFAHGWWTVEGQKMSKSLQNVVEPNMLVDKYGIDAVRYFLLREVPFGLDGDFSHAALVHRINSDLANDLGNLLSRSTAMVNKYFGGTLPQ-PGAMTELDAAFRARTEAMISQLESCMDEMAFSKGLQAIWEVISAGNKYIDESAPWTLAKDPAQKERLGTIMYTLLEA-QRIVHTL 456
>gi|170016653|ref|YP_001727572.1| methionyl-tRNA synthetase [Leuconostoc citreum KM20] >gi|169803510|gb|ACA82128.1| Methionyl-tRNA synthetase [Leuconostoc citreum KM20] (705 aa)
Score = 916, Expect = 2.9e-96, Identities = 188/481 (39%), Positives = 283/481 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDD--KLYCAQL---HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           K FYITTPIYYPSG   +G+ +TT++AD   RY + LG +  F+TG DEHG KI++KA+         +D  AK   +LW+L+ I Y  FIRTT E H+  VQ+ F+ L +K  IY G ++G Y VS EE +T++      +DD  K+   +    H +   +EE+YF K+ ++  ++  + K  P  + P  R+NE+ N+F+     +DL+++R+   WGI +  + KHV+YVW+DAL NY++ LGY   +   F KFW +     VQL+ KEI RFH IYWPIML  LGL  P   I HGW++ + GKMSKS GNV+ P      YG DA RYYLL+ +    D VF+ +  +   N DLAN++GNL NR++ MINKY  G++P+    K  F+ +  + ++    +     + +     L  V  +I   N +I++ +PW L K++ +K  L   ++ +  A++ V   L+PVL    K+  +Q 
  S:    37 KTFYITTPIYYPSGKLQLGNTYTTVLADAAARYHRLLGEQVHFLTGTDEHGLKIQQKAEAAGTSEIAYLDGMAKQIKDLWQLMDISYDDFIRTTEERHEKAVQKIFNTLFEKGDIYKGEYEGWYSVSDEEYFTESQLAEVYHDDAGKMIGGKAPSGHEVELVKEEAYFFKMSKYADWLLDYYKTHPEFIQPEARMNEMINNFIA-PGLEDLAVTRTAVDWGIPVPGDEKHVIYVWIDALSNYITALGYDSDNTDLFDKFWPAN----VQLVGKEIVRFHTIYWPIMLHALGLELPKSVIGHGWLVMKDGKMSKSKGNVIYPEVLEARYGLDAVRYYLLRAMPFGNDGVFTPEDFVARVNFDLANDLGNLLNRTVAMINKYEHGVVPELHTGKTDFDEDLVRTVEDAIADYNRYFQDMRTADALESVWTIIRRANKYIDETQPWVLAKDDTQKVVLSNVMAHLAAALRVVAVLLQPVLTQAPKKIYEQL 519
>gi|77919292|ref|YP_357107.1| methionyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] >gi|77545375|gb|ABA88937.1| methionyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] (511 aa)
Score = 914, Expect = 5.8e-96, Identities = 196/516 (37%), Positives = 296/516 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSFNIEFEKQLKQFDDEITTI---IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           +FY+TTPIYY +  PHIGHA+TT+  D+L RYK+  G E FF+TG DEHGQK+E+ A+     P EL D+  K +  LW+ L I ++ FIRT+ E HK  V + F +L     IYLG ++  YC  CE  +T+   +     D   C +  P  + +EESYF ++ +++ + +    ++P+ + P +R NE+ N     +   DLSISR++FSWGI +  N +HV+YVW DAL NY++ LGY    + +++ FW +     V ++ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+    D  FS   L++  N DLAN++GNL +RS  M+NKY  GI+  PK  +P      E E  +  F D +  +   ++ L   K L  + +LI   N +I+   PW L K+ +++D L   L  +L++++ V   + PV+ D S + L   N             +  L+   +I   +P++ RIE E
  S:     4 RFYVTTPIYYVNDVPHIGHAYTTVACDMLARYKRAQGQEVFFLTGTDEHGQKVEKAAQAKGETPLELADRVVKRYQALWEKLNISHTDFIRTSQERHKKGVCDLFEKLHATGDIYLGEYEDWYCTPCETFWTETQLMDGCCPD---CGR--PTDKLKEESYFFRMSKYQDQLLKHIEENPDFIQPRSRRNEILN--FVREGLRDLSISRTSFSWGIPVPGNERHVIYVWFDALTNYITALGYPDDPEGHYKNFWPAN----VHIIGKDILRFHTVYWPTFLLAAGLPLPAKVFAHGWWTVEGQKMSKSLQNVVEPNMLVDKYGVDAIRYFLLREVPFGLDGDFSHAALVHRINSDLANDLGNLVSRSTAMLNKYFGGILPEPKDRRP------EDEPFIAAFADTVRKVDIFMDDLAFNKALQTIWELIGLGNKYIDDTAPWALAKDPSQQDRLGTVLYNLLDSLRLVAQLIAPVMPDTSDKILALLNSKPDSLTAMGDDCWGGLEPGSEIAKAKPLFPRIEME 510
>gi|160902697|ref|YP_001568278.1| methionyl-tRNA synthetase [Petrotoga mobilis SJ95] >gi|160360341|gb|ABX31955.1| methionyl-tRNA synthetase [Petrotoga mobilis SJ95] (645 aa)
Score = 913, Expect = 6.4e-96, Identities = 189/481 (39%), Positives = 292/481 (60%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ 1048
           M KFY+TTPIYY +  PHIG A+TT++AD++ R+K+ +GY+ FF+TG DEHGQK+ + AKE N+ PQE VD  +  F NLW  +GI Y HF+RTT  YH   VQ    ++++   +Y G + G YC+  +E++     +  ++  KL       L   EEE+YF K+ ++ +  +  +  +P+ V P  R NE+    + ND   DLSI+R+ F WGI +K +PKHVVYVW+DAL+NY+S +GY   D   F ++W +     + L+ KEI RFH + WP ML  +GL  P K  +HGW+     K+SKSLGN +DP   ++ YGRD  RYYLL++++   D  FSE+ LI  +N DL N++ NL +R++ M+ KY +G+IPK  + K   + E  + L+   +    ++E+    + L  + ++I   N +I+  +PW L  + NEKD L   L  +L+ ++ +   + P++ D S+  LK+
  S:     1 MDKFYVTTPIYYVNSEPHIGSAYTTIVADIVARFKRMMGYDVFFLTGTDEHGQKVLQAAKEKNIPPQEYVDSLSSKFKNLWDEMGISYDHFVRTTDAYHVKTVQMFVDKMMENGDVYKGKYAGWYCIH-DESFWDESEIVTQDGVKLCPECNRELKWVEEENYFFKLSKYTEPLLKHYENNPDFVEPSFRRNEMLQ--ILNDGLKDLSITRTTFDWGIPLKSDPKHVVYVWVDALINYVSAIGY-SDDQQKFNRYWPAD----LHLIGKEINRFHSLIWPAMLMSVGLPLPKKVFAHGWLTVNGQKISKSLGNAVDPRILMDAYGRDVIRYYLLRDIAFGRDGDFSEENLITRYNADLVNDLSNLVHRTLTMVEKYFNGVIPKPER-KDKVDEELLELLESKKNAYLNLMERYQFTQALENLWEVIRFSNKYIDLTEPWILGNDPNEKDRLSTVLYNLLDVIRIISILIYPIMPDTSETMLKK 474
>gi|187777332|ref|ZP_02993805.1| hypothetical protein CLOSPO_00884 [Clostridium sporogenes ATCC 15579] >gi|187774260|gb|EDU38062.1| hypothetical protein CLOSPO_00884 [Clostridium sporogenes ATCC 15579] (645 aa)
Score = 910, Expect = 1.6e-95, Identities = 193/517 (37%), Positives = 301/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+      +LWK++ I+Y  FIRTT +YH  +VQ+ F  L  K  IY   ++G YC  CE  +T+   V  +  D   C +  P+ + +EE+YF K+ ++  K I      P+ + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++++W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP+    K   + +  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K+ L   L  ++ +++ +   +   + + S +  +Q N D   +D       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKGVTPKAYVDEIVAGIKDLWKMMNIDYDKFIRTTDDYHVELVQKIFKTLCDKGDIYKSEYEGWYCTPCESFWTETQLVEGKCPD---CGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPDFIQPESRKNEMINNFL-KPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNTEKDELYKRYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGMFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPE-GNCKEDIDEDLIKLALETPRKVEENMEKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKERLGTVLYNLVESLRIISVCISAFIPETSIKINEQINTDILNWD-----SLSEFNGTKVGTKVKKGEAIFPRIDIEKK 512
>gi|170758335|ref|YP_001785405.1| methionyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169405324|gb|ACA53735.1| methionyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] (645 aa)
Score = 910, Expect = 1.7e-95, Identities = 194/517 (37%), Positives = 301/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+      +LWK++ I+Y  FIRTT EYH  +VQ+ F  L  K  IY   + G YC  CE  +T+    + E+     C +  P+ + +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  ++D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K+ L   L  ++ +++ +   +   + + S +   Q N D   +D   +++F+   +  K+   E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAEKVTPKAYVDEIVAGIKDLWKIMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGWYCTPCESFWTE---TQLEDGKCPDCGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNTENDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGADPVRYYLLREIPFGADGMFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEEDMEKLRIPEALEEIWTFIGRANKYIDETTPWVLAKDESKKERLGTVLYNLVESLRIISVCISAFIPETSIKINTQINADILTWDS--LSEFNGTKSGTKVKKGEAIFPRIDVEKK 512
>gi|168714899|ref|ZP_02747176.1| methionyl-tRNA synthetase [Clostridium difficile QCD-63q42] >gi|196125478|ref|ZP_03117227.1| methionyl-tRNA synthetase [Clostridium difficile ATCC 43255] (645 aa)
Score = 909, Expect = 2.4e-95, Identities = 183/517 (35%), Positives = 302/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL----DNQKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIGH ++T+ AD + R+K+  GY+  F+TG DEHG+KI++KA E  +   E +D   K    LW  + I Y  FIRTT + H +++Q+ F++L ++  IY G ++G YC  CE  +T++  +  E +    C +   L++  EESYF ++ +++  +    KD +  +P  R NE+  +FL+    +DLS++R+ F WGI++  + KHV+YVW+DAL NY++ LGY   +D  F+K+W +     VQ++ KEI RFH I WP +L  LGL  P +   HGWI+    KMSKS GNV+ P   I  YG D  +Y+LL+E +  +D  ++ +  +   N DLAN++GNL +R++ M+ KY +GIIP  +K   +F+ + ++Q     +     ++K+   + L  V  L+   N +I++  PW L K+  +KD LD  L  +  +++ +   + P++ + + +  +   I     DI       +     +N K+   EP++ R++ E +
  S:     6 FYVTTPIYYPSGGLHIGHTYSTVAADTIARFKRFCGYDVKFLTGTDEHGEKIQKKAIEQGMSEIEYLDGMIKDIKALWNTMDISYDDFIRTTEKRHTDIIQKIFTKLYEQGDIYKGEYEGRYCTPCESFWTESQLL--EGNKCPDCGRETYLVK--EESYFFRLSKYEDRLKELFKDDSFCFPAARKNEMVANFLDK-GLEDLSVTRTTFDWGIKVPFDEKHVIYVWVDALCNYITALGYMTDNDEEFKKYWPAN----VQIVGKEIVRFHTIIWPALLMALGLEVPKQVFGHGWILFADDKMSKSKGNVVYPEPIIERYGIDTLKYFLLREFAFGQDGSYTHRNFVTRINYDLANDLGNLISRTVAMVEKYNNGIIPT-AKVSTNFDADLKEQAVSTRENFEAEMDKMQFHEALESVWKLVRRTNKYIDETMPWALAKDETKKDELDTVLYNLCESIRIIATLINPIMNETANKIYEHIGIKGQD-DITTWESTKTFGLIGENVKVFKGEPLFPRLDVEKE 516
>gi|111657212|ref|ZP_01407985.1| hypothetical protein SpneT_02001579 [Streptococcus pneumoniae TIGR4] (626 aa)
Score = 908, Expect = 2.7e-95, Identities = 186/483 (38%), Positives = 287/483 (59%)
  Q:   605 LGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL-----YCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  +Q   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     1 MGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIE-PGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 486
>gi|168697831|ref|ZP_02730108.1| methionyl-tRNA synthetase [Clostridium difficile QCD-37x79] >gi|168726465|ref|ZP_02758742.1| methionyl-tRNA synthetase [Clostridium difficile QCD-76w55] >gi|168730088|ref|ZP_02762365.1| methionyl-tRNA synthetase [Clostridium difficile QCD-97b34] >gi|196162265|ref|ZP_03122826.1| methionyl-tRNA synthetase [Clostridium difficile CIP 107932] (645 aa)
Score = 907, Expect = 3.2e-95, Identities = 183/517 (35%), Positives = 301/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL----DNQKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIGH ++T+ AD + R+K+  GY+  F+TG DEHG+KI++KA E  +   E +D   K    LW  + I Y  FIRTT + H +++Q+ F++L ++  IY G ++G YC  CE  +T++  +  E +    C +   L++  EESYF ++ +++  +    KD +  +P  R NE+  +FL+    +DLS++R+ F WGI++  + KHV+YVW+DAL NY++ LGY   +D  F+K+W +     VQ++ KEI RFH I WP +L  LGL  P +   HGWI+    KMSKS GNV+ P   I  YG D  +Y+LL+E +  +D  ++ +  +   N DLAN++GNL +R++ M+ KY +GIIP  +K    F+ + ++Q     +     ++K+   + L  V  L+   N +I++  PW L K+  +KD LD  L  +  +++ +   + P++ + + +  +   I     DI       +     +N K+   EP++ R++ E +
  S:     6 FYVTTPIYYPSGGLHIGHTYSTVAADTIARFKRFCGYDVKFLTGTDEHGEKIQKKAIEQGMSEIEYLDGMIKDIKALWNTMDISYDDFIRTTEKRHTDIIQKIFTKLYEQGDIYKGEYEGRYCTPCESFWTESQLL--EGNKCPDCGRETYLVK--EESYFFRLSKYEDRLKELFKDDSFCFPAARKNEMVANFLDK-GLEDLSVTRTTFDWGIKVPFDEKHVIYVWVDALCNYITALGYMTDNDEEFKKYWPAN----VQIVGKEIVRFHTIIWPALLMALGLEVPKQVFGHGWILFADDKMSKSKGNVVYPEPIIERYGIDTLKYFLLREFAFGQDGSYTHRNFVTRINYDLANDLGNLISRTVAMVEKYNNGIIPT-AKVSTDFDADLKEQAVSTRENFEAEMDKMQFHEALESVWKLVRRTNKYIDETMPWALAKDETKKDELDTVLYNLCESIRIIATLINPIMNETANKIYEHIGIKGQD-DITTWESTKTFGLIGENVKVFKGEPLFPRLDVEKE 516
>gi|196163965|ref|ZP_03124496.1| methionyl-tRNA synthetase [Clostridium difficile QCD-23m63] (645 aa)
Score = 907, Expect = 4.0e-95, Identities = 183/517 (35%), Positives = 301/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL----DNQKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIGH ++T+ AD + R+K+  GY+  F+TG DEHG+KI++KA E  +   E +D   K    LW  + I Y  FIRTT + H +++Q+ F++L ++  IY G ++G YC  CE  +T++  +  E +    C +   L++  EESYF ++ +++  +    KD +  +P  R NE+  +FL+    +DLS++R+ F WGI++  + KHV+YVW+DAL NY++ LGY   +D  F+K+W +     VQ++ KEI RFH I WP +L  LGL  P +   HGWI+    KMSKS GNV+ P   I  YG D  +Y+LL+E +  +D  ++ +  +   N DLAN++GNL +R++ M+ KY +GIIP  +K    F+ + ++Q     +     ++K+   + L  V  L+   N +I++  PW L K+  +KD LD  L  +  +++ +   + P++ + + +  +   I     DI       +     +N K+   EP++ R++ E +
  S:     6 FYVTTPIYYPSGGLHIGHTYSTVAADTIARFKRFCGYDVKFLTGTDEHGEKIQKKAIEQGMSEIEYLDGMIKDIKALWNTMDISYDDFIRTTEKRHTDIIQKIFTKLYEQGDIYKGEYEGRYCTPCESFWTESQLL--EGNKCPDCGRETYLVK--EESYFFRLSKYEDRLKELFKDDSFCFPAARKNEMVANFLDK-GLEDLSVTRTTFDWGIKVPFDEKHVIYVWVDALCNYITALGYMTDNDEEFKKYWPAN----VQIVGKEIVRFHTIIWPALLMALGLEVPKQVFGHGWILFADDKMSKSKGNVVYPEPIIERYGIDTLKYFLLREFAFGQDGSYTHRNFVTRINYDLANDLGNLISRTVAMVEKYNNGIIPT-AKVSTDFDADLKEQAVSTRENFEAEMDKMQFHEALESVWKLVRRTNKYIDETMPWALAKDEAKKDELDTVLYNLCESIRIIATLINPIMNETANKIYEHIGIKGQD-DITTWESTKTFGLIGENVKVFKGEPLFPRLDVEKE 516
>gi|150014947|ref|YP_001307201.1| methionyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149901412|gb|ABR32245.1| methionyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] (645 aa)
Score = 906, Expect = 4.7e-95, Identities = 178/446 (39%), Positives = 268/446 (60%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK 1014
           K +YITTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+E  + P++ VD+      +LW ++ I Y  FIRTT +YH   VQ+ F +L  +  IY   ++G YC  CE  +T    V     D   C +  P+ + +EE+YF K+ ++   +  +++D P  + P +R NE+ N+FL      DL +SR++F+WG+ +  +  HVVYVW+DAL NY++ LGY Q++   + K+W +     V L+ K+I RFH IYWPIML  L L  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLLKE+    D +F+ ++ I   N DL N++GNL +R++ M+ KY  G +P   + K + + E          +I   I +LNI + L  V +LI   N +I++  PW L K+ ++K
  S:     7 KTYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGYDVMFLTGTDEHGQKIQRIAEEKGITPKQHVDEVVAGIKDLWSMMNISYDKFIRTTDDYHIKAVQDIFKKLYDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPD---CGR--PVEKSKEEAYFFKMSKYADKLIKYIEDHPEFIQPESRKNEMLNNFL-RPGLQDLCVSRTSFNWGVPVTFDESHVVYVWIDALSNYITALGYGQENKDLYNKYWPAD----VHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLKEIPFGADGLFNNEIFIKKINSDLCNDLGNLLSRTVAMVEKYFGGEMPAQDE-KEAIDDELINLALSAPAKIEEAINELNIPQALEYVFELIRRANKYIDETTPWILAKDESKK 442
>gi|168182315|ref|ZP_02616979.1| methionyl-tRNA synthetase [Clostridium botulinum Bf] >gi|182674668|gb|EDT86629.1| methionyl-tRNA synthetase [Clostridium botulinum Bf] (645 aa)
Score = 904, Expect = 7.1e-95, Identities = 196/517 (37%), Positives = 296/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+       LWK++ I+Y  FIRTT EYH  +VQ+ F  L  K  IY   + G YC  CE  +T+    + E+     C +  P+ + +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL ISR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K+ L   L  +  +++ +   +   + + S +  +Q N D   +D       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGWYCTPCESFWTE---TQLEDGKCPDCGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCISRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYSTEKDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVLNWD-----GLSKFNGTKVGTKVKKGEAIFPRIDVEKK 512
>gi|126701164|ref|YP_001090061.1| methionyl-tRNA synthetase [Clostridium difficile 630] >gi|115252601|emb|CAJ70444.1| methionyl-tRNA synthetase [Clostridium difficile 630] (645 aa)
Score = 904, Expect = 8.2e-95, Identities = 182/517 (35%), Positives = 301/517 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL----DNQKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIGH ++T+ AD + R+K+  GY+  F+TG DEHG+KI++KA E  +   E +D   K    LW  + I Y  FIRTT + H +++Q+ F++L ++  IY G ++G YC  CE  +T++  +  E +    C +   L++  EESYF ++ +++  +    KD +  +P  R NE+  +FL+    +DLS++R+ F WGI++  + KHV+YVW+DAL NY++ LGY   +D  F+K+W +     VQ++ KEI RFH I WP +L  LGL  P +   HGWI+    KMSKS GNV+ P   I  YG D  +Y+LL+E +  +D  ++ +  +   N DLAN++GNL +R++ M+ KY +GIIP  +K    F+ + ++Q     +     ++K+   + L  V  L+   N +I++  PW L K+  +K +LD  L  +  +++ +   + P++ + + +  +   I     DI       +     +N K+   EP++ R++ E +
  S:     6 FYVTTPIYYPSGGLHIGHTYSTVAADTIARFKRFCGYDVKFLTGTDEHGEKIQKKAIEQGMSEIEYLDGMIKDIKALWNTMDISYDDFIRTTEKRHTDIIQKIFTKLYEQGDIYKGEYEGRYCTPCESFWTESQLL--EGNKCPDCGRETYLVK--EESYFFRLSKYEDRLKELFKDDSFCFPAARKNEMVANFLDK-GLEDLSVTRTTFDWGIKVPFDEKHVIYVWVDALCNYITALGYMTDNDEEFKKYWPAN----VQIVGKEIVRFHTIIWPALLMALGLEVPKQVFGHGWILFADDKMSKSKGNVVYPEPIIERYGIDTLKYFLLREFAFGQDGSYTHRNFVTRINYDLANDLGNLISRTVAMVEKYNNGIIPT-AKVSTDFDADLKEQAVSTRENFEAEMDKMQFHEALESVWKLVRRTNKYIDETMPWALAKDETKKGELDTVLYNLCESIRIIATLINPIMNETANKIYEHIGIKGQD-DITTWESTKTFGLIGENVKVFKGEPLFPRLDVEKE 516
>gi|148985860|ref|ZP_01818954.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|147922006|gb|EDK73130.1| methionyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] (626 aa)
Score = 903, Expect = 9.7e-95, Identities = 185/483 (38%), Positives = 287/483 (59%)
  Q:   605 LGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL-----YCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDS-SKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           +GY+ F++TG+DEHGQKI++KA+E  + PQ  VD  A     LW+LL I Y  FIRTT +YH+ VV + F  LL +D IYLG + G Y VS EE +T++       D+            H +    EESYFL++ +++  +  F K  P  + P  R+NE+  +F+     +DL++SR+ F+WG+ +  NPKHVVYVW+DALLNY + LGY Q +  NF KFWN     +  ++ K+I RFH IYWPI+L ML ++ P + I+HGW + + GKMSKS GNV+ P   +  YG D  RYYL++ L +  D  F+ +  +   N +LAN++GNL NR++ MINKY DG IP Y +    F+    +  ++   +  T +E ++  + L  V  LI+  N +I++  PW L K+   +D L   +S +  +++ V + +EP +++ S+  L Q  ++  S  +   + DF + D   +    PI+ R+  E++
  S:     1 MGYDVFYLTGLDEHGQKIQQKAEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLGEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDRLVEFFKAHPEFITPDGRLNEMLRNFIE-PGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDALLNYATALGYAQDEHGNFDKFWN---GTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAHGWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEKSIADFHTHMEAVDYPRALEAVWTLISRTNKYIDETAPWVLDKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETSRAVLTQLGLEEVSSLENLSLADFPA-DVTVVAKGTPIFPRLNMEEE 486
>gi|168177409|ref|ZP_02612073.1| methionyl-tRNA synthetase [Clostridium botulinum NCTC 2916] >gi|182670464|gb|EDT82438.1| methionyl-tRNA synthetase [Clostridium botulinum NCTC 2916] (645 aa)
Score = 903, Expect = 1.1e-94, Identities = 194/517 (37%), Positives = 296/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+       LWK++ I+Y  FIRTT EYH  +VQ+ F  L  K  IY   + G YC  CE  +T+    + E+     C +  P+ + +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K+ L   L  +  +++ +   +   + + S +  +Q N D   ++       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGWYCTPCESFWTE---TQLEDGKCPDCGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYSTEKDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVLNWN-----SLSKFNGTKVGTKVKKGEAIFPRIDVEKK 512
>gi|153938113|ref|YP_001389440.1| methionyl-tRNA synthetase [Clostridium botulinum F str. Langeland] >gi|152934009|gb|ABS39507.1| methionyl-tRNA synthetase [Clostridium botulinum F str. Langeland] (645 aa)
Score = 902, Expect = 1.2e-94, Identities = 194/517 (37%), Positives = 295/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+       LWK++ I+Y  FIRTT EYH  +VQ+ F  L +   IY   + G YC  CE  +T+    + E+     C +  P+ + +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K  L   L  +  +++ +   +   + + S +  +Q N D   +D       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYENGDIYKSEYSGWYCTPCESFWTE---TQLEDGKCPDCGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCVSRTSFDWGIPVTFDDKHVIYVWIDALANYITALGYSTEKDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEESMEKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKGRLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVLNWD-----SLSKFNGTKVGTKVKKGEAIFPRIDVEKK 512
>gi|170755122|ref|YP_001779702.1| methionyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] >gi|169120334|gb|ACA44170.1| methionyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] (645 aa)
Score = 898, Expect = 3.8e-94, Identities = 194/517 (37%), Positives = 295/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+       LWK++ I+Y  FIRTT EYH  +VQ+ F  L  K  IY   + G YC  CE  +T+    + E+     C +  P+ + +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   + KL I + L  +   I   N +I++  PW L K+ ++K+ L   L  +  +++ +   +   + + S +  +Q N D   +D       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKVTPKAYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGWYCTPCESFWTE---TQLEDGKCPDCGR--PVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYNTEKDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEENMGKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCILAFIPETSIKINEQINADVLNWD-----SLSKFNGTKVGTKVKKGEAIFPRIDVEKK 512
>gi|118474589|ref|YP_891971.1| methionyl-tRNA synthetase [Campylobacter fetus subsp. fetus 82-40] >gi|118413815|gb|ABK82235.1| methionyl-tRNA synthetase [Campylobacter fetus subsp. fetus 82-40] (632 aa)
Score = 897, Expect = 5.3e-94, Identities = 204/518 (39%), Positives = 308/518 (59%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY--CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN---PKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           MKKF ITTPIYY +  PHIGHA+TT+IAD + RY + +GY+TFF+TG DEHGQKIEE AK     P+E  D+ +  F +LW    I Y HFIRTT +YHK   Q  F ++ +K  IY G ++G YCVSCE  + +N  +    DD+    C +   +++  EESYF K+  ++  +  + +  N + P  + NE+  SF+      DLSI+R++F WG+++  +   P+HV+YVWLDAL+NYLS LGY    D+    +WN    + + L+ K+I RFH +YWP  L  L L  PT   +HGW   +  KMSKS+GNV+DP    N YG +AFRY+LL+E+   +D  FS+K LI+  N +L+N++GNL +R +GM +KY +  I   +  KL  N E E      D  I  I E +   + L  +  +++  N  + + +PW+L KE    + +  ++L+ N + +V   L P +   S +  K   F I++  ++   + +   L N K ++ EP++ ++ESE
  S:     1 MKKF-ITTPIYYVNDVPHIGHAYTTIIADTMARYYRLVGYDTFFLTGTDEHGQKIEEAAKAHCKTPKEYADEVSAKFRSLWDEFEISYDHFIRTTDDYHKFTAQNVFLKMYEKGDIYKGEYEGNYCVSCETFFPQNQLI----DDEFCPDCGKKTRIVK--EESYFFKLSDYQDKLLKWYEKGNCILPKGKKNEVI-SFVKG-GLKDLSITRTSFEWGVKLPSSLNEPRHVMYVWLDALINYLSALGY--TTDNKRMDYWN----DTMHLVGKDILRFHAVYWPAFLMSLELPLPTSVAAHGWWTRDGKKMSKSIGNVVDPRAVANAYGLEAFRYFLLREVPFGQDGDFSQKALIDRINSELSNDLGNLLSRIVGMSSKYSNYEINSQNVTKLYLN-ELESAKTHLDQAIEAINE-VATNRYLEELWKVLSLANASVAKYEPWNLIKEGKTDEANALVALVANLLAKVAVLLSPAMPKSSDKIAKTLGFEINTKTYNDIILKN--ELLNLKSSSTEPLFTKVESE 506
>gi|148378083|ref|YP_001252624.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153931420|ref|YP_001382482.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153936823|ref|YP_001386034.1| methionyl-tRNA synthetase [Clostridium botulinum A str. Hall] >gi|148287567|emb|CAL81631.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|152927464|gb|ABS32964.1| methionyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932737|gb|ABS38236.1| methionyl-tRNA synthetase [Clostridium botulinum A str. Hall] (645 aa)
Score = 897, Expect = 5.4e-94, Identities = 196/517 (37%), Positives = 295/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP----EPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIG+ +TT+ AD L R+K+  GY+  F+TG DEHGQKI+  A+   + P+  VD+       LWK++ I+Y  FIRTT EYH  +VQ+ F  L  K  IY   + G YC  CE  +T+     +  D K  C      ++K +EE+YF K+ ++  K I      P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHV+YVW+DAL NY++ LGY  + D  ++K+W +     V L+ K+I RFH IYWPIML  L +  P +   HGW++ + GKMSKS GNV+DP+  +N +G D  RYYLL+E+    D +F+ ++ I   N DLAN++GNL +R++ MI KY DG IP     K   + E  K   +   ++   +EKL I + L  +   I   N +I++  PW L K+ ++K+ L   L  +  +++ +   +   + + S +  +Q N D   +D       S  +  K+ T     E I+ RI+ E K
  S:     6 YYVTTPIYYPSAKLHIGNTYTTVAADTLARFKRLTGYDVMFLTGTDEHGQKIQRLAEAKKVTPKVYVDEIVAGIKELWKMMNIDYDKFIRTTDEYHVELVQKIFKTLYDKGDIYKSEYSGWYCTPCESFWTET----QLEDGK--CPDCGRSVEKAKEEAYFFKMSKYAPKLIEYIESHPEFIQPESRKNEMLNNFL-KPGLQDLCVSRTSFDWGIPVTFDEKHVIYVWIDALANYITALGYSTEKDELYKKYWPAD----VHLVGKDILRFHTIYWPIMLMALDIPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNHFGTDPVRYYLLREIPFGADGIFNNEIFIKKINSDLANDLGNLLSRTVAMIEKYFDGEIPA-GNCKEDIDEELIKLALETPKKVEENMEKLRIPEALEEIWTFIGRANKYIDETTPWILAKDESKKERLGTVLYNLAESLRIISVCISAFIPETSIKINEQINADVLNWD-----SLSKFNGTKVGTKVKKGEAIFPRIDVEKK 512
>gi|34556660|ref|NP_906475.1| methionyl-tRNA synthetase [Wolinella succinogenes DSM 1740] >gi|34482374|emb|CAE09375.1| METHIONYL-TRNA SYNTHETASE [Wolinella succinogenes] (649 aa)
Score = 897, Expect = 5.5e-94, Identities = 198/514 (38%), Positives = 294/514 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN---PKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPE-PIYLRIE 1083
           K +ITTPIYY +  PHIGHA+TT+I D L  Y + +G+ETFF+TG DEHGQKIE+ A++    PQ   D+ +  F +LW    I Y HFIRTT   HK  VQ+ F ++ +K  IY G ++G YCVSCE  +TK   V     D LYC    P   KE     EESYF  + +++ K ++ + ++P+ + P  + NE+          DDLSI+R++F WG+++ +    PKHV+YVWLDALLNY++ LGY   DD     FW ++    V L+ K+I RFH IYWP  L  L L  P    +HGW      KMSKS+GNV++P    + YG + FRY++L+E+   +D  FS+K LI+  N DL+N++GNL NR  GM  KY D  I   SK   +F+ +  ++ +   D +   I+++   + L  +  +    N  I   +PW L KE  E      ++LI N + +    L P++   + +  +  N++ S    + +    +L  +   TP  P++ +IE
  S:     4 KSFITTPIYYVNDIPHIGHAYTTMIGDSLAHYYRLIGHETFFLTGTDEHGQKIEQSAQKKGKTPQAYADEISGAFKSLWDRFEISYDHFIRTTDAKHKQGVQKAFLKMFEKGDIYKGEYEGHYCVSCETFFTKRQLV-----DDLYC----PECGKETSLVKEESYFFALSRYQEKLLAWYKENPDCILPKPKKNEVMR--FVESGLDDLSITRTSFDWGVKLPQEMNAPKHVMYVWLDALLNYVTALGY--GDDEKRMDFWPAR----VHLVGKDILRFHAIYWPAFLMSLDLPLPKHVAAHGWWTRNGAKMSKSVGNVINPQEVADAYGVEPFRYFMLREVPFGQDGDFSQKALIDRLNSDLSNDLGNLLNRLGGMSGKYFDYQIT--SKEVTTFHAKELQEAELILDSLHGYIQEMQPHRYLEELWKIFTIANTAIAMHEPWKLMKEGKESQAMALVALIANLLAKATLMLSPIMPKSAAKIAQALNLEISTASYERLIIQKALLEEFTFTPTPPLFPKIE 508
>gi|51894387|ref|YP_077078.1| methionyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] >gi|51858076|dbj|BAD42234.1| methionyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] (651 aa)
Score = 897, Expect = 5.6e-94, Identities = 180/443 (40%), Positives = 263/443 (59%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWII--TEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL-KQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE 1010
           M +FYITTPIYYPS   HIGH++TT+ AD L RY ++LG+ET+F+TG DEHGQKIE  A      P + VD+       LW  L I Y  FIRTT E HK VVQ+ F +L  +  IY   ++G YC  CE  + +  +  KE +    C +  P+   ++ESYF ++ ++   +  ++++ + + P +R NE+  SF+N    +DL +SRS   WGI +  + K  +YVW+DAL NY+S LG+  ++D  ++KFW +     V L+ KEI RFH I WP +L  LGL  P K   HGW++  T+  KMSKS GNV+DP   I+ YG DA RYYLL+E+    D  ++E+  I   N DLAN++GNL +R+  MINK+ DG +P   +P  + +      L  Q   E    +++L I   L  +  L++  N +I++  PW L ++
  S:     1 MTRFYITTPIYYPSSKLHIGHSYTTVAADALARYHRRLGHETYFLTGTDEHGQKIERAALAEGKTPIQFVDEIVAGIKELWAALHISYDDFIRTTEERHKKVVQKIFKQLYDQGDIYKSSYEGWYCTPCETFWIE--SKLKEGNLCPDCGR--PVEWTKDESYFFRLSKYADRLLRYIEETDFIQPASRKNEMI-SFINQ-GLEDLCVSRSTVRWGIPVPFDEKQTIYVWIDALSNYISALGWGTENDELYRKFWPAD----VHLVGKEIVRFHTIIWPCILMALGLPLPKKVFGHGWLLFGTQAEKMSKSKGNVVDPFVLIDRYGVDAVRYYLLREVPFGADGTYTEEAFILRTNNDLANDLGNLLSRTTQMINKFSDGRVP---EPDPASDDRILSDLAAQVLREFQEAMDRLEISSALVALWKLVDRANKYIDEQAPWALARD 433
>gi|126656215|ref|ZP_01727599.1| methionyl-tRNA synthetase [Cyanothece sp. CCY0110] >gi|126622495|gb|EAZ93201.1| methionyl-tRNA synthetase [Cyanothece sp. CCY0110] (535 aa)
Score = 896, Expect = 6.9e-94, Identities = 199/526 (37%), Positives = 304/526 (57%)
  Q:   561 ITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFD-IKFVTDFSSLD-------NQKINTPEPIYLRIE--SED 1086
           +T+  +  KKF +TTP+YY +G PHIG A+TT+IADV+ RYK+ +G E   ITG DEHGQKI+  A+E  L PQ+  D+    F  LW+ L I+Y  F RTTA  H+ +V+E F  + +   IYL   +G YCV CEE   K    R+  +D   C  LHP  + E   EE+YF K+ +++  +   + K+P  + P +R NE+ N    N    D SISR N  WG  I ++P H +YVW DALL Y++ L   +++   D+   ++W       + L+ K+I RFH IYWP ML    L  P +   HG++  +  KM KSLGN LDP   ++ YG D+ RYY LKE+   +D  F+E   +N  N DLAN++GNL NR++GM  KY  G +P+ +  +L  +   +       +++    EKL   +    ++ LI   N FI++  PW L KE  + +++  L  +L +V+   Y L P++ + S +  +Q  F++D ++ D    V  F+          NQ ++ P+P++ +++  SED
  S:     1 MTADTKKPKKFALTTPLYYVNGVPHIGSAYTTIIADVIARYKRLIGEEVLLITGTDEHGQKIQRTAQEKGLLPQDHCDQIVGSFKQLWQKLDIQYDRFSRTTATKHEAIVKEFFGRVWENGDIYLAQQQGWYCVQCEEFKEK----RELLEDG--CCPLHPNKKAEWRDEENYFFKLSKYQSKLEELYAKNPQFIEPESRRNEILN--FMNQGLQDFSISRVNLEWGFPIPKDPNHTIYVWFDALLGYVTALLEPEEEPTLDNALSEWWPIN----LHLIGKDILRFHAIYWPAMLMSANLPLPEQIFGHGFLTKDGQKMGKSLGNTLDPFDLVDKYGSDSVRYYFLKEIECGKDGDFNETRFVNILNADLANDLGNLLNRTLGMTQKYCQGSLPEITASELPQDHPLKTIGLSLGEKVIKAYEKLKFNEGCEEILTLIQAGNKFIDEQAPWRLFKEGKQAEVEKILYGVLESVRLAAYLLAPIIPNLSSKIYEQLGFSVDFNQSDRFNEVVPFAHHSQWGKLAVNQGLSKPQPVFAKLDFPSED 533
>gi|89892874|ref|YP_516361.1| hypothetical protein DSY0128 [Desulfitobacterium hafniense Y51] >gi|89332322|dbj|BAE81917.1| hypothetical protein [Desulfitobacterium hafniense Y51] (647 aa)
Score = 896, Expect = 7.2e-94, Identities = 189/482 (39%), Positives = 284/482 (58%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIIT-EQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKL----NIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           K+YITTPI+YP+ +PHIG A+TT+ AD   RY +  G++ +F+TG DE+ QKI   A+   ++P   VD   + F  LW+ L I Y  FIRTT E H  VV++ F++L ++  IY   ++G YC  CE  +T+N  I  +  N D   C +   L++  EESYF K+ +++  +   +KD P+ + P +R NE+   F+     +DL +SR+ F WGIQ+  NPKHVVYVWLDAL+NY+S LGY   D   +Q++W ++    V LM K+I RFH + WPI+L  L +  P     HGW ++ E GK+SKS GNV D    I  YG DA RY+LL+E+ +  D  +SE  L+   N DLAN++GN  +RS+ MI KYR G+IPK  +P      E E +L+    E+   +E+     +    L  +  L++  N ++++  PW L K+E  ++ LD  L     A++ +     P +   + +  +Q  I
  S:     2 KYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFLTGTDENAQKIVRTAESQGMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVVKKIFTKLYEQGDIYKSEYEGWYCTPCETFWTENKLIDGKCPNPD---CGRDVELLK--EESYFFKLSKYQDALLRHIKDHPDFIQPASRRNEMIK-FIEG-GLEDLCVSRTTFQWGIQVPFNPKHVVYVWLDALINYISALGY--PDGELYQRYWPAE----VHLMGKDIVRFHAVIWPIILMALDVPLPKVVYGHGWYLSKEGGKISKSRGNVQDSFKLIRRYGSDAIRYFLLREMQVGTDGAYSEDSLVERLNSDLANDLGNFVSRSLAMIVKYRGGVIPKAGEPT-----ELEAELRALGQEVVAKVEERLEAHDPAGALENLWRLVSRMNKYVDETAPWTLAKQEGQQERLDTVLHTFAEAIRVLGILCAPFMPKLTGKMFRQCGI 474
>gi|172036861|ref|YP_001803362.1| methionyl-tRNA synthetase [Cyanothece sp. ATCC 51142] >gi|171698315|gb|ACB51296.1| methionyl-tRNA synthetase [Cyanothece sp. ATCC 51142] (535 aa)
Score = 895, Expect = 8.6e-94, Identities = 200/518 (38%), Positives = 297/518 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFD-IKFVTDFSSLD-------NQKINTPEPIYLRIE--SED 1086
           KKF +TTP+YY +G PHIG A+TT+IADV+ RYK+ +G +  FITG DEHGQKI+  A+E  L PQ+  D+    F+ LW+ L I+Y  F RTTA  H+ +V+E F  +     IYL   +G YCV CEE   K    R+  +D   C  LHP  + E   EE+YF K+ +++  +    K +P  + P +R NE+ N    N    D SISR N +WG  I  +P H +YVW DALL Y++ L   +++   ++    +W       + L+ K+I RFH IYWP ML    L  P K   HG++  +  KM KSLGN LDP   ++ YG DA RYY LKE+   +D  F+E   +N  N DLAN++GNL NR++GM  KY  G +PK +  +L      +       +++    E L   +    ++ LI   N FI++  PW L KE  + +++  L  +L +V+   Y L P++ + S +  +Q  F++D ++ D +  V  F+          NQ +  P+PI+ +++  SED
  S:     9 KKFALTTPLYYVNGVPHIGSAYTTIIADVIARYKRLIGEDVLFITGTDEHGQKIQRTAEEKGLLPQDHCDQIVASFEALWQKLDIQYDRFSRTTAPRHQAIVKEFFERVWDNGDIYLAQQQGWYCVQCEEFKEK----RELLEDG--CCPLHPNKKAEWRDEENYFFKLSKYQSKLEELYKNNPQFIEPESRRNEILNFI--NQGLQDFSISRVNLAWGFPIPTDPDHTIYVWFDALLGYVTALLDPEEEPTLNNALSDWWPIN----LHLIGKDILRFHAIYWPAMLMSAKLPLPQKIFGHGFLTKDGQKMGKSLGNTLDPFELVDKYGADAVRYYFLKEIECGKDGDFNETRFVNILNADLANDLGNLLNRTLGMTQKYCQGSLPKMTATELPQEHSLKTIGLTLGEKVINAYETLKFNEGCEEILTLIQAGNKFIDEQAPWRLFKEGKQAEVEKILYGVLESVRLAAYLLAPIIPNLSSKIYQQLGFSVDFNQSDRLNEVIPFAHHSQWGKLAVNQGLAKPQPIFAKLDLPSED 533
>gi|109647818|ref|ZP_01371721.1| methionyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] >gi|109640908|gb|EAT50463.1| methionyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] (647 aa)
Score = 895, Expect = 9.3e-94, Identities = 192/514 (37%), Positives = 298/514 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAV--RKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIIT-EQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKL----NIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIE 1083
           K+YITTPI+YP+ +PHIG A+TT+ AD   RY +  G++ +F+TG DE+ QKI   A+   ++P   VD   + F  LW+ L I Y  FIRTT E H  VV++ F++L ++  IY   ++G YC  CE  +T+N  +  +  N D   C +   L++  EESYF K+ +++  +   +KD P+ + P +R NE+   F+     +DL +SR+ F WGIQ+  NPKHVVYVWLDAL+NY+S LGY   D   +Q++W ++    V LM K+I RFH + WPI+L  L +  P     HGW ++ E GK+SKS GNV D    I  YG DA RY+LL+E+ +  D  +SE  L+   N DLAN++GN  +RS+ MI KYR G+IPK ++P      E E +L+    E+   +E+     +    L  +  L++  N ++++  PW L K+E  +  LD  L     A++ +     P +   + +  +Q  I       +   +++ L +  ++   E ++ RI+
  S:     2 KYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFLTGTDENAQKIVRTAESQGMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVVKKIFTKLYEQGDIYKSEYEGWYCTPCETFWTENKLMDGKCPNPD---CGRDVELLK--EESYFFKLSKYQDALLRHIKDHPDFIQPASRRNEMIK-FIEG-GLEDLCVSRTTFQWGIQVPFNPKHVVYVWLDALINYISALGY--PDGELYQRYWPAE----VHLMGKDIVRFHAVIWPIILMALDVPLPKVVYGHGWYLSKEGGKISKSRGNVQDSFELIRRYGSDAIRYFLLREMQVGTDGAYSEDSLVERLNSDLANDLGNFVSRSLAMIVKYRGGVIPKAAEPT-----ELEAELRALGQEVVAKVEERLEAHDPAGALENLWRLVSRMNKYVDETAPWTLAKQEGQQARLDTVLHTFAEAIRILGILCAPFMPKLTGKMFRQCGISDELLAWEAAKEWAVLGEGIQVQRGEALFPRID 507
>gi|150387962|ref|YP_001318011.1| methionyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] >gi|149947824|gb|ABR46352.1| methionyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] (655 aa)
Score = 893, Expect = 1.6e-93, Identities = 190/517 (36%), Positives = 306/517 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDD----EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----KINTPEPIYLRIESEDK 1087
           +Y+TTPIYYPS   HIGH +TT+ ADVL R+K+  GY+  F+TG DEHG+KI+E A++  + P+  VD+  +    +WK + I Y  FIRTT E H+  VQ+ F  L +K  IY   ++G YC  CE  +T+     KE+     C +  P    +EE+YF K+ +++ + I  F K P + YP +R NE+ N+FL     +DL +SR+ F WGI +  +PKHV+YVW DA+ NY++ LGY  +++  ++K+W +     V L++KEI RFH I WP +L  L +  P     HGWI+    KMSKS GN++ P   I  YG DA +Y+LL+E +  +D  ++ +  +   N DLAN++GNL +R++ MI KY  GIIP   +PK++   EF++ L+        ++   I++L   + L  +  ++   N +I++  PW L K E N++ L+  L  + + ++ V   ++P +   + +  +Q  ID+++       + +SL NQ     K+   E ++ R++ E +
  S:     6 YYLTTPIYYPSAKLHIGHTYTTVAADVLARFKRTRGYDVQFLTGTDEHGEKIQEAAQKNGMNPKAYVDEIVEEIKKVWKSMDISYDIFIRTTDEEHERAVQKIFQTLYEKGDIYKSEYEGWYCTPCESFWTETQL--KEDKGCPDCGR--PAHLAKEEAYFFKLSKYQDRLIEHFEKYPEICYPESRKNEMLNNFL-RPGLEDLCVSRTTFDWGIPVPFDPKHVIYVWFDAVCNYITALGYTSENEEQYKKYWPAN----VHLVAKEIVRFHTIIWPAILMALEVPLPKMVYGHGWILFGSDKMSKSKGNIVYPEPLIERYGIDALKYFLLREFTFGQDGNYTNRTFVTRLNADLANDLGNLVSRTVAMIEKYNSGIIP---EPKVAG--EFDEDLRTVATGAAAKVEKAIDQLQFHEALEEIWKVVRRTNKYIDETTPWILAKDEENKERLNTVLYHLADTLRIVSVLIQPFMEATTNKIWEQLGIDANQ---GTTWEDASLFNQIPSGVKVRKGESLFPRLDVEKE 516
>gi|145621219|ref|ZP_01777206.1| methionyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|144942480|gb|EDJ77618.1| methionyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|197088935|gb|ACH40206.1| methionyl-tRNA synthetase [Geobacter bemidjiensis Bem] (509 aa)
Score = 893, Expect = 1.7e-93, Identities = 182/474 (38%), Positives = 276/474 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           +Y+TTPIYY +  PHIGHA+TTL ADVL RYK+  G++ FF+TG DEHGQK+E+ A      P EL D+  K F +LW+ L I  + FIRTT E HK  V   F  +++K  IYLG ++  YC  CE  +T+   +  +  D   C +  P  + +EESYF ++ +++  + + ++ +P+ + P +R NE+  SF+  +   DLS+SR+ F WGI +  N KHVVYVW DAL NY++ LGY   +  NF K+W       V L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+    D  FS + L++  N DLAN++GNL NRS  M+ KY  G++ +    +   +  + ++      ++   IE L   + L  + ++I+  N +I++  PW L K+  +++    +   +   +RV+Y L    +  + E
  S:     5 YYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFDVFFLTGTDEHGQKVEKAAIAAGETPLELADRVMKRFQSLWEKLEISNTDFIRTTQERHKKGVSVLFERVMEKGDIYLGEYEDWYCTPCETFWTETQLIDYKCPD---CNR--PTEKLKEESYFFRMSKYQDQLLAHIEANPDFIQPKSRRNEII-SFV-KEGLRDLSVSRTTFQWGIPVPGNDKHVVYVWFDALTNYITALGY-PDEQGNFGKYWPCD----VHLIGKDILRFHTVYWPTFLMAAGLPIPKKVFAHGWWTVEGQKMSKSLQNVVEPNMLVDKYGVDAVRYFLLREVPFGLDGDFSHQALVHRINSDLANDLGNLLNRSTAMLGKYFGGVL-QAPGEETDLDAAYREKTAAMIGQVDGFIEDLAFSRALQAIWEVISAGNKYIDETAPWTLAKDPEKRERLATVMYYMLESQRVVYSLLSAFMPKTSE 466
>gi|191161844|ref|ZP_03023726.1| methionyl-tRNA synthetase [Geobacter sp. M21] >gi|190997428|gb|EDV72874.1| methionyl-tRNA synthetase [Geobacter sp. M21] (509 aa)
Score = 892, Expect = 2.2e-93, Identities = 182/464 (39%), Positives = 273/464 (58%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYL 1034
           +Y+TTPIYY +  PHIGHA+TTL ADVL RYK+  G++ FF+TG DEHGQK+E+ A      P EL D+  K F +LW+ L I  + FIRTT E HK  V   F  +++K  IYLG ++  YC  CE  +T+   +  +  D   C +  P  + +EESYF ++ +++  + + ++ +P+ + P +R NE+  SF+  +   DLS+SR+ F WGI +  N KHVVYVW DAL NY++ LGY   +  NF K+W       V L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+    D  FS + L++  N DLAN++GNL NRS  M+ KY  G++ +    +   +  + ++      ++   IE L   + L  V ++I+  N +I++  PW L K+  +++    +   +   +RV+Y L
  S:     5 YYVTTPIYYVNDVPHIGHAYTTLAADVLARYKRLKGFDVFFLTGTDEHGQKVEKAAIAAGETPLELADRVMKRFQSLWEKLEISNTDFIRTTQERHKKGVSVLFERVMEKGDIYLGEYEDWYCTPCETFWTETQLIDYKCPD---CNR--PTEKLKEESYFFRMSKYQDQLLAHIEANPDFIQPKSRRNEII-SFV-KEGLRDLSVSRTTFQWGIPVPGNDKHVVYVWFDALTNYITALGY-PDEAGNFGKYWPCD----VHLIGKDILRFHTVYWPTFLMAAGLPIPKKVFAHGWWTVEGQKMSKSLQNVVEPNMLVDKYGVDAVRYFLLREVPFGLDGDFSHQALVHRINSDLANDLGNLLNRSTAMLGKYFGGVL-QAPGEETELDAAYREKTAAMIGQVDGFIEDLAFSRALQAVWEVISAGNKYIDETAPWTLAKDPEKRERLATVMYYMLESQRVVYSL 456
>gi|34764087|ref|ZP_00144966.1| Methionyl-tRNA synthetase; PROTEIN SECRETION CHAPERONIN CSAA [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886141|gb|EAA23438.1| Methionyl-tRNA synthetase; PROTEIN SECRETION CHAPERONIN CSAA [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (636 aa)
Score = 892, Expect = 2.2e-93, Identities = 196/519 (37%), Positives = 304/519 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKF--VTDFSSL-DNQKINTPEPIYLRIESEDK 1087
           K F+++TPIYY +G+PH+G A+TT+ ADV+ RY K +G +T F+TG+DEHGQK+E+ A++    PQ   DK    F N+W  L I+Y  FIRTT + HK  V+     +  K  IY G ++G YC+SCE  + +N  +   N       +L  L   +EESYF K+ ++   +   +++ P+ + P +R NE+  SF+      DLSISR+ F+WGI I   P H+ YVW DAL NYL+  G+ + DD  F KFWN  +A +V L+ K+I RFH I WP ML   G++ P   ++HGW  +E  KMSKS GNV++P   I  YG DAFRYYLL+E +   D  +S K ++   N DLAN++GNL NR++GM  KY +G+I   S  +       + ++K   D+I   +EK        + L  +   I+  N +I++  PW L K+  +K  L   ++++   + ++ + + P + + +++   Q  ID    ++KF  + +++   +  K+    P++ RIE E K
  S:     3 KNFFVSTPIYYVNGDPHVGSAYTTIAADVINRYNKAMGMDTHFMTGLDEHGQKVEQAAEQNGYTPQAWTDKMTPNFKNMWAALDIKYDDFIRTTEDRHKKAVKRILDMVNAKGDIYKGEYEGKYCISCETFFPEN-QLNGSNKCPDCGKELRVL---KEESYFFKMSKYADALLKHIEEHPDFILPHSRRNEVI-SFIKQ-GLQDLSISRNTFTWGIPIDFAPGHITYVWFDALTNYLTSAGF-ENDDKKFDKFWN--NARVVHLIGKDIIRFHAIIWPCMLLSAGIKLPDSIVAHGWWTSEGEKMSKSRGNVVNPYDEIKKYGVDAFRYYLLREANFGTDGDYSTKGIVGRLNSDLANDLGNLLNRTLGMYKKYFNGVIVASSTSE-----PIDDEIKTMFDDIIKDVEKYMYLFEFSRALETIWKFISRLNKYIDETMPWSLAKDEAKKGRLATVMNILCEGLYKIAFLIAPYMPESAQKISNQLGIDKDITNVKFDDIKEWNIFKEGHKLGEASPVFPRIEIEKK 516
>gi|157363213|ref|YP_001469980.1| methionyl-tRNA synthetase [Thermotoga lettingae TMO] >gi|157313817|gb|ABV32916.1| methionyl-tRNA synthetase [Thermotoga lettingae TMO] (624 aa)
Score = 891, Expect = 2.9e-93, Identities = 186/517 (35%), Positives = 302/517 (58%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID--SSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           KFYITTPIYY + +PH+G A+TT+IAD++ RYK+ +GY+ FF+TG DEHGQKI + +  L   PQ   D+ A  F  LWK L I    FIRTT   H  VVQ    ++++ + IY G ++G YCV CE  +         N+D++   +L P   +E     E++YF ++ +++ K +  + + P  V P  R NE+    +      DLSI+R+ F WG+ + ++P+HV+YVW+DAL+NY+S +GY + D   F+K+W +     + L+ KEI RFH I WP ML   GL  P    +HGW+  +  K+SKSLGN +DP YF+  YG D  R+YL+++++  +D  FSEK L+N  N DLAN+ GNL +R++ MI KY    +P+    +   + +F+  + Q   E    +++ ++ + + +V++ +   N + ++ KPW L K+ +   L   L  +  ++ +V     P++ D S+E   +   D  SSK+ ++          +KI   EP++ + + ++
  S:     2 KFYITTPIYYVNSDPHVGSAYTTIIADIIARYKRMMGYDVFFLTGTDEHGQKILQASSSLGKDPQSFCDELADRFKQLWKKLNITNDGFIRTTDPNHMKVVQYFVKKMVENNDIYKGEYRGWYCVPCETYW---------NEDEIGSDKLCPSCGRELKYVSEQNYFFRLSRYQDKLLRYYEEHPEFVQPDFRRNEMMR--ILEGGLKDLSITRTTFKWGVPMPDDPEHVIYVWVDALINYISAIGYPE-DLKTFEKYWPAD----LHLIGKEINRFHSIIWPAMLMSAGLELPRTVFAHGWLTVDGQKISKSLGNAIDPKYFVEEYGNDVLRFYLVRDINFGKDGDFSEKNLVNRLNSDLANDYGNLLHRTLAMIKKYYSSTMPRPGAHE-QIDEKFKHDILQCCKEYQQFMDQYSLTQAVEKVMEALAISNKYFDERKPWVLAKQKDFDKLSTVLFNVCESLLKVATMFSPIMPDSSEEVFSRLGFDQKSSKYMLETWNILKP--GKKIVHAEPLFAKRDQKE 507
>gi|118580084|ref|YP_901334.1| methionyl-tRNA synthetase [Pelobacter propionicus DSM 2379] >gi|118502794|gb|ABK99276.1| methionyl-tRNA synthetase [Pelobacter propionicus DSM 2379] (506 aa)
Score = 885, Expect = 1.4e-92, Identities = 177/445 (39%), Positives = 265/445 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD 1015
           FY+TTPIYY +  PHIGHA+TT+ ADVL RYK+ +GY+ +F+TG DEHGQK+E+ A      P EL D+  K +  LW+ LGI  + FIRTT E HK  V + FS ++++  IYLG ++  YC  CE  + +   +     D   C +  P+ + +EESYF ++ ++++ + + ++ +P+ + P ++ NE+  SF+  +   DLSISR+ FSWGI +  N KH+VYVW DAL NYL+ LGY     + + +FW +     V L+ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSL NV++P   I+ YG D  RY+L++E+    D  FS   LI   N DLAN++GNL +RS  M  KY  GI+P  ++     +   +++       +   +++L   K L  + ++I+  N +I+   PW L K+  +KD
  S:     5 FYVTTPIYYVNDVPHIGHAYTTVAADVLARYKRLMGYDVYFLTGSDEHGQKVEKAATTAGETPLELADRVVKRYQALWERLGISNNDFIRTTQERHKKGVSQLFSLIMERGDIYLGEYEDWYCTPCETFWPETQLIEDRCPD---CNR--PVEKLKEESYFFRMSKYQEQLLAHIEANPDFIQPKSKRNEII-SFV-KEGLRDLSISRTTFSWGIPVPGNDKHIVYVWFDALTNYLTALGY-PDSTAEYGRFWPAN----VHLIGKDILRFHTVYWPTFLMAAGLPLPEKVFAHGWWTVEGQKMSKSLQNVVEPNMLIDKYGVDVVRYFLMREVPFGLDGDFSHTALIQRLNSDLANDLGNLLSRSTAMAVKYFGGILPAATELT-EIDHSLQEKTSAMIAAVDKFMDELAFSKALQAIWEVISAGNKYIDDCAPWVLAKDPAQKD 437
>gi|152992719|ref|YP_001358440.1| methionyl-tRNA synthetase [Sulfurovum sp. NBC37-1] >gi|151424580|dbj|BAF72083.1| methionyl-tRNA synthetase [Sulfurovum sp. NBC37-1] (649 aa)
Score = 883, Expect = 2.0e-92, Identities = 200/514 (38%), Positives = 295/514 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIK---ENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD---DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD---LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           K YITTPIYY +   HIGHA+TT+IAD L RY +  G +TFF+TG DEHGQKIEE AK      QE  D+ +  F NLW   GI Y  FIRTT   H   VQ+ F  +     IY  V+KG YC+SCE  + ++  V  E     +C +   P    EEESYF K+  ++ K ++ +  +PN + P ++ NE+          DDLSI+R++F WG+++     +PKHV+YVWLDAL+NY++ LGY    D     FW ++    V L+ K+I RFH IYWP  L  LGL  P    +HGW   +  KMSKS GNV++P    + YG D FRY++L+E+    D  FS+K LI+  N DL N++GNL NR IGM  KY +G +   +  K      ++ +L + D   +++  ++  + I + L  +   ++  N  I++ +PW L KE  E +   L+  ++ IL  V  ++Y + PV+      AL  F+ID++ ++   + +   L+   I    P++ R+E
  S:     7 KAYITTPIYYVNDIAHIGHAYTTIIADTLARYSRMSGLDTFFLTGTDEHGQKIEESAKARGKTSQEYADEISATFKNLWDDFGISYDKFIRTTDADHMKGVQKAFKVMYDNGDIYKDVYKGHYCISCETFFPESQLVDGE-----FCPECGKPTTIVEEESYFFKLSAYEDKLLAWYNDNPNCILPKSKRNEVIR--FVEGGLDDLSITRTSFDWGVKLPAELNDPKHVMYVWLDALMNYVTALGY--GTDEAKMDFWPAR----VHLIGKDILRFHAIYWPAFLMSLGLEMPKHIAAHGWWTRDGEKMSKSKGNVVNPREVADAYGLDNFRYFMLREVPFGGDGDFSQKALIDRINSDLGNDLGNLLNRLIGMSGKYFEGKVDSANVSKY-----YQTELDEVDISLEKLEPLLFDMQIHRYLEELWRPLSVANKAIDKYQPWTLMKEGKEGEAMALNGLIANILAKVSVMLYPVMPVICPKIATAL-SFSIDNASWN-SLIKEKQLLETFTIEKIPPLFPRVE 511
>gi|160939618|ref|ZP_02086966.1| hypothetical protein CLOBOL_04510 [Clostridium bolteae ATCC BAA-613] >gi|158437409|gb|EDP15173.1| hypothetical protein CLOBOL_04510 [Clostridium bolteae ATCC BAA-613] (683 aa)
Score = 881, Expect = 3.6e-92, Identities = 176/447 (39%), Positives = 268/447 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD 1015
           K +YITT I Y SG PHIG+ +  ++AD + RYK++ GY+ FF TG DEHGQKIEEKA+   + PQE VDK A     +W L+   Y  FIRTT + H+  VQ+ F +L  +  IY G ++GLYC  CE  +T++  V  +  D   C  ++ P    +EE+YF ++ ++   +  ++ + P  + P++R NE+ N+FL      DL +SR+ FSWGI +  +PKHV YVWLDAL NY++G+GY     S   F+K+W +     + L+ K+I RFH IYWPI L  L +  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+    D V S +L++   N DLAN +GNL NR+I M NKY DG++        + + + +K + +   +    +E+L +   ++ + ++   CN +I++  PW L K+ ++KD
  S:    26 KPYYITTAIAYASGKPHIGNTYEIILADSIARYKREQGYDVFFQTGTDEHGQKIEEKAEAAGVTPQEFVDKAAAEIKRIWDLMNTSYDKFIRTTDQDHEAQVQKIFKKLYDQGDIYKGYYEGLYCTPCESFFTESQLVDGKCPD---CGREVKP---AKEEAYFFRMSKYAPRLIEYINEHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTTFSWGIPVDFDPKHVTYVWLDALTNYITGIGYDCDGSSTDQFKKYWPAD----LHLIGKDIIRFHTIYWPIFLMALDVPLPKQVFGHPWLLQGDGKMSKSKGNVLYADTLVDFFGVDAVRYFVLHEMPFDNDGVISWELMVERMNSDLANILGNLVNRTISMSNKYFDGVVCDKGVCGEA-DEDLKKVVLEEVKKADAKMEQLRVADAMTEIFNIFRRCNKYIDETTPWTLAKDESQKD 464
>gi|150384121|ref|ZP_01922827.1| methionyl-tRNA synthetase [Victivallis vadensis ATCC BAA-548] >gi|150259496|gb|EDM96731.1| methionyl-tRNA synthetase [Victivallis vadensis ATCC BAA-548] (646 aa)
Score = 881, Expect = 4.0e-92, Identities = 183/474 (38%), Positives = 281/474 (59%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFN---IEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           FY+TTPIYY +  PHIGHA+TT++ADVL RY + L  +TFF+TG DEHGQK+E+ A +  + P++  D+    F  LWK LGI    FIRTT EYHK VV+E   EL  +D IY   + G YCV CE  YT+   V  +  +   C +    I+  E +YF ++ ++++++  +++  P+ + P  R NE    FL   +  DL ISR  S  SWGI++  +  +V YVW DAL+NY+S +GYR ++ + F+K+W +       L+ K+I   H +YWP ML+ +GL  P    +HGW +T   KMSKSLGNV++P+  I   G DAFRY+LL E+S   D+ FSE+  +  +N DLAN++GNL +R + M  +   G+I    +P    N   +E  ++++     + T ++ +   + L+ V++ +   N ++E+  PW L K+     L+  L    +A++R+   L PV+ D   E
  S:     6 FYVTTPIYYVNDKPHIGHAYTTILADVLARYYRSLNVDTFFLTGTDEHGQKVEKAAAKRGVSPKQQADETVVRFQELWKRLGITNDRFIRTTDEYHKEVVREILQELYDRDEIYKAEYTGWYCVGCERFYTEKDLVEGKCPE---CGREVSAIR--ESNYFFRMSKYQQWLIDYIQTHPDFIQPAFRANETL-GFLKR-ELGDLCISRPKSRLSWGIELPFDADYVCYVWFDALINYISAVGYR-RNQAEFEKWWPAS----YHLIGKDILTTHSVYWPTMLKAIGLPMPRTIFAHGWWLTGNTKMSKSLGNVVNPMDMIEKCGVDAFRYFLLSEMSPGNDANFSEESFVARYNSDLANDLGNLLSRVLKMTLR-SGGVI----QPPAELNADDLELNREVETAIAAMETSLKAMKFDQGLNAVMNAVRAGNRYLEKTAPWALAKKGEVARLNTVLYTAADALRRISVLLAPVMPDKMAE 468
>gi|167760642|ref|ZP_02432769.1| hypothetical protein CLOSCI_03024 [Clostridium scindens ATCC 35704] >gi|167661767|gb|EDS05897.1| hypothetical protein CLOSCI_03024 [Clostridium scindens ATCC 35704] (637 aa)
Score = 880, Expect = 5.2e-92, Identities = 191/518 (36%), Positives = 290/518 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           +K+YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQKIE KA+E  + P+E VD  A     +W L+   Y  FIRTT   H+  VQ+ F +L  +  IY G ++G+YC  CE  +T++  V  +  D   C  ++ P    +EE+YF K+ ++  + I      P  + P++R NE+ N+FL      DL +SR++F WGI +  +P+HVVYVWLDAL NY++G+GY    +S   F+K W +     + L+ K+I RFH IYWPI L  L L  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V S +L++   N DLAN +GNL NR+I M NKY DG++              +  L+   +     +E    +L +   ++ + +L   CN +I++  PW L K+ ++KD L+  L  +L ++K     LE  + D S + L Q                   D +  + PE ++ R++ E+
  S:     4 QKYYITTAIAYTSGKPHIGNTYEIVLADAIARYKRSQGYDVFFQTGTDEHGQKIELKAEEAGVTPKEFVDGVAGQIQTIWDLMNTSYDKFIRTTDADHEKQVQKIFKKLYDQGDIYKGYYEGMYCTPCESFFTESQLVDGKCPD---CGREVQP---AKEEAYFFKMSKYADRLIEHINSHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPEHVVYVWLDALTNYITGIGYDCGGESTEQFKKDWPAD----LHLIGKDIIRFHTIYWPIFLMALDLPLPKQIFGHPWLLQGDGKMSKSKGNVLYADELVDFFGVDAVRYFVLHEMPFENDGVISWELMVERMNSDLANTLGNLVNRTISMTNKYFDGVVTDKKVADDEDAKAVDADLRAVTENTPKAVEAKMDELRVADAITEIFNLFKRCNKYIDETMPWALAKDEDKKDRLETVLYNLLESIKAGAVLLESFMPDTSAKILAQLG-----------------DGKVTDKPEILFARLDVEE 502
>gi|148323072|gb|EDK88322.1| methionine--tRNA ligase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (636 aa)
Score = 877, Expect = 1.1e-91, Identities = 196/513 (38%), Positives = 301/513 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKF--VTDFSSL-DNQKINTPEPIYLR 1081
           K F+++TPIYY +G+PH+G A+TT+ ADV+ RY K +G +T F+TG+DEHGQK+E+ A++    PQ   DK    F N+W  L I+Y  FIRTT + HK  V+     +  K  IY G ++G YCVSCE  + +N         +L  +   P   KE     EESYF K+ ++   +   +++ P+ + P +R NE+  SF+      DLSISR+ F+WGI I   P H+ YVW DAL NYL+  G+ + +D  F KFWN  +A +V L+ K+I RFH I WP ML   G++ P   ++HGW  +E  KMSKS GNV++P   I  YG DAFRYYLL+E +   D  +S K +I   N DLAN++GNL NR++GM  KY + +I   S  +       ++++K   +E+   +EK        + L  +   I+  N +I++  PW L K+ ++KD L   ++++   + ++ + + P +   +++   Q  ID    D+KF  V +++   +  K+    PI+ R
  S:     3 KNFFVSTPIYYVNGDPHVGSAYTTIAADVINRYNKAMGMDTHFMTGLDEHGQKVEQAAEQNGYTPQAWTDKMTPNFKNMWAALEIKYDDFIRTTEDRHKKAVKRILDMVNAKGDIYKGEYEGKYCVSCETFFPEN---------QLNGSNKCPDCGKELTILKEESYFFKMSKYADALLKHIEEHPDFILPHSRRNEVI-SFIKQ-GLQDLSISRNTFTWGIPIDFAPGHITYVWFDALTNYLTSAGF-ENNDEKFNKFWN--NARVVHLIGKDIIRFHAIIWPCMLLSAGIKLPDSIVAHGWWTSEGEKMSKSRGNVVNPYDEIKKYGVDAFRYYLLREANFGTDGDYSTKGIIGRLNSDLANDLGNLLNRTLGMYKKYFNDVIVSSSASE-----AIDEEIKSMFNEVIKDVEKYMYLFEFSRALETIWRFISRLNKYIDETMPWALAKDESKKDRLAAVMNILCEGLYKIAFLIAPYMPMSAQKISNQLGIDKDITDVKFDDVKEWNIFKEGHKLGEASPIFPR 510
>gi|67921186|ref|ZP_00514705.1| Methionyl-tRNA synthetase, class Ia [Crocosphaera watsonii WH 8501] >gi|67857303|gb|EAM52543.1| Methionyl-tRNA synthetase, class Ia [Crocosphaera watsonii WH 8501] (535 aa)
Score = 876, Expect = 1.6e-91, Identities = 195/523 (37%), Positives = 299/523 (57%)
  Q:   561 ITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFD-IKFVTDFSSLD-------NQKINTPEPIYLRIE 1083
           +TSK    KKF +TTP+YY +G PHIG A+TT+IADV+ R+K+ +G E   ITG DEHGQKI+  A+E  L PQ+  D+    F+ LW+ L I+Y  F RTTA  H+ +V+E F  + +   IYL   +G YCV+CEE   K    R+  +D   C  +H   + E   EE+YF K+ +++  +   + K+P  + P +R NE+ N    N    D SISR N  WG  I ++P H +YVW DALL Y++ L   + +   ++    +W       + L+ K+I RFH IYWP ML    L  P K   HG++  +  KM K+LGN LDP   ++ YG DA RYY LKE+   +D  F+E   +N  N DLAN++GNL NR++GM  KY  G +P+ +  +L      +       +++    E L   +    ++ LI   N FI++  PW L KE  + +++  L  +L +V+   Y L P++ + S +  +Q  F++D ++ D +  V  F+          NQ ++ P+PI+ +++
  S:     1 MTSKTTKPKKFALTTPLYYVNGVPHIGSAYTTIIADVIARHKRLIGDEVLLITGTDEHGQKIQRTAEEKGLAPQKHCDEIVSSFEELWQKLEIQYDRFSRTTASKHEVIVKEFFERVWENGDIYLAQQQGWYCVACEEFKEK----RELLEDG--CCPIHTNKKAEWRDEENYFFKLSKYQTKLEELYEKNPQFIQPESRRNEILN--FVNQGLQDFSISRVNLEWGFPIPKDPSHTIYVWFDALLGYVTALLEPEAEPTLNNALSTWWPIN----LHLIGKDILRFHAIYWPAMLMSAELPLPDKVFGHGFLTKDGQKMGKTLGNTLDPFALVDKYGADAVRYYFLKEIECGKDGDFNETRFVNILNADLANDLGNLLNRTLGMTKKYCKGSLPELTAAELPQEHPLKTIGLTLGEKVIKAYETLKFNEGCEEILTLIRAGNKFIDEQAPWRLFKEGKQAEVEQILYGVLESVRLAAYLLAPIIPNLSSKIYEQLGFSVDFNQSDRLNQVIPFTHHSQWGKLAVNQNLSKPQPIFAKLD 528
>gi|158321682|ref|YP_001514189.1| methionyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] >gi|158141881|gb|ABW20193.1| methionyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] (654 aa)
Score = 875, Expect = 1.7e-91, Identities = 192/517 (37%), Positives = 295/517 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK-FDIKFVTDFSSLD-NQKINTPEPIYLRIESEDK 1087
           FY+TTPIYYPSG  HIGH +TT+ ADVL R+K+  GY+  F+TG DEHG+KI+E A++  + P+E +DK  +   +LWK + I Y  FIRTT + H+  VQ+ F  L  K  IY   ++G YC  CE  +T+     KE      C +  P    +EE+YF K+ +++ + +  F + P + YP +R NE+ N+FL     +DL +SR+ F WGI++  +PKH++YVW DA+ NY++ LGY   ++  F K+W +     V L+ KEI RFH I WP +L  L +  P     HGWI+    KMSKS GN++ P   I  YG DA +Y+LL+E +  +D   + +  IN  N DLAN++GNL +R++ MI KY +GIIP    P +    EF+  LK+       ++   I KL     L  +  ++ + N +I++  PW L K E N++ L+  L  +  A++ +   ++P +   + +   Q  I   +  D +    F  L     +   E ++ R+E E +
  S:     6 FYLTTPIYYPSGRLHIGHTYTTVAADVLARFKRFTGYDVQFLTGTDEHGEKIQEAAEKAGVSPKEYLDKIVEEIKDLWKKMDISYDIFIRTTDQEHEERVQKIFQTLYDKGDIYKSEYEGWYCTPCESFWTETQL--KEGHVCPDCNR--PAHLAKEEAYFFKLSKYQDRLLQYFEEHPEICYPESRKNEMVNNFL-KPGLEDLCVSRTTFDWGIKVPFDPKHIIYVWFDAVCNYITALGYGSDNEETFNKYWPAD----VHLVGKEIVRFHTIIWPAILMALEIPLPKMVYGHGWILFGADKMSKSKGNIVYPEPLIERYGLDAIKYFLLREFTFGQDGNHTNRNFINRLNSDLANDLGNLVSRTVSMIEKYNEGIIP---SPGVEG--EFDGSLKEIATGAASKVENAINKLQFHDGLEEIWKVVRKTNKYIDETAPWVLAKDEANKERLNTVLYNLAEAIRIISVLIKPFMESTTNKIWSQVGITEDQGTDWESTGTFGKLKAGTAVKKGEALFPRLELEKE 516
>gi|177663628|ref|ZP_02939432.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 8801] >gi|196243093|ref|ZP_03141823.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 8802] >gi|172077342|gb|EDT62752.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 8801] >gi|196208992|gb|EDY03781.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 8802] (535 aa)
Score = 875, Expect = 1.9e-91, Identities = 189/516 (36%), Positives = 298/516 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFD-IKFVTDFSSLD-------NQKINTPEPIYLRIE 1083
           + KF +TTP+YY +  PHIG A+TT+IADV+ R+K+  G     ITG DEHGQKIE  A+   L+PQE  D+  + F++LW+ L I+Y  F RTTA+ H  +V+E F  + ++  IYL   +G YCV CEE   K    R+  +D   C  LHP  + E   EE+YF ++  +++ + +  ++ P  + P +R NE+  SF++     D SISR N +WG  +  +  H +YVW DALL Y++ L    ++   ++   ++W       + L+ K+I RFH +YWP ML    L  P +  SHG++  +  KMSKSLGN ++P   +  YG DA RYY LKE+    D  F+E   +N  N DLAN++GNL NR++GMI KY  G+IP     +L+     +    +  D +T   E L   +    ++ LI   N FI++  PW L K+  +K+++  L+ +L +V+   Y L P++ + S +  +Q   ++D ++ D ++    F+          NQ +   +PI+ R++
  S:     8 IAKFALTTPLYYVNDVPHIGSAYTTMIADVIARFKRLQGSSVLLITGTDEHGQKIERTAEAKGLEPQEHCDRIVESFESLWQKLNIQYDRFSRTTAKNHGAIVKEFFQRVWEQGDIYLAQQQGWYCVPCEEFKEK----RELLEDG--CCPLHPNKKAEWRDEENYFFRLSNYQEKLETLYQEHPEFIEPESRRNEVI-SFVSGG-LQDFSISRVNVAWGFPVPGDDNHTIYVWFDALLGYITALLEPDQEAGLENALSQWWPIN----LHLIGKDILRFHAVYWPAMLMSAKLPLPKQIFSHGFLTKDGQKMSKSLGNTVNPFDLVERYGSDAVRYYFLKEIDCGRDGDFNETRFVNVLNADLANDLGNLLNRTLGMIKKYCQGVIPPLIIEELALEHSLKSIGLELGDRVTQAYETLRFNQACEEILTLIRASNKFIDEQAPWRLFKQGQQKEVESILAAVLESVRLSAYLLSPIIPNLSNKVYQQLGLSVDFNEGDRLQETAPFAQHSQWGKLKVNQTLTEAQPIFARLD 528
>gi|154482623|ref|ZP_02025071.1| hypothetical protein EUBVEN_00290 [Eubacterium ventriosum ATCC 27560] >gi|149736523|gb|EDM52409.1| hypothetical protein EUBVEN_00290 [Eubacterium ventriosum ATCC 27560] (648 aa)
Score = 873, Expect = 2.8e-91, Identities = 189/518 (36%), Positives = 295/518 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGY--RQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL--DNQKINTPEPIYLRIESED 1086
           K +Y+TT I Y SG PHIG+ +  ++AD + R+K++ GY+  F TG DEHGQKIE KA E  + P+E VD  + V   +W L+   Y  FIRTT   H+  VQ+ F +L  +  IY G ++G+YC  CE  +T++  V  +  D   C +   +   +EE+YF ++ ++  + I      P  + P +R NE+ N+FL      DL +SR++F WGI +  +PKHVVYVW+DAL NY++GLGY     +D  + K+W +     + L+ K+I RFH IYWPIML  L +  P +   H W++   GKMSKS GNV+      N +G DA RY++L E+  + D   + +L++   N DLAN +GNL NR+I M NKY DG++      +   + +F+K +     +    ++KL +   ++ +  L   CN +I++  PW L KE +++D L   L  ++  +      LEP + + SK+ L Q N     F+   +T+F     DN+    PE ++ R++ +D
  S:     3 KTYYLTTAIAYTSGKPHIGNTYEAILADSIVRFKRQQGYDVRFQTGTDEHGQKIELKAAEAGITPKEFVDNVSGVIKEIWDLMNTSYDKFIRTTDPDHEKQVQKIFKKLYDQGDIYKGHYEGMYCTPCESFFTESQLVDGKCPD---CGR--EVTPAKEEAYFFRMSKYADRLIEHINTHPEFIQPESRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWIDALSNYITGLGYDVDGNNDPLYDKYWPAD----LHLIGKDILRFHTIYWPIMLMALDVPLPKQIFGHPWLLQGDGKMSKSKGNVIYADDLANLFGVDAVRYFVLHEMPFENDGTITWELMVERMNSDLANTLGNLVNRTISMSNKYFDGVVSNKGVDE-EVDDDFKKVILDTPVKAAEKMDKLRVADAITEIFTLFKRCNKYIDETMPWALAKEEDKQDRLATVLYNLIEGITIGASLLEPFMPETSKKILAQINAQPRAFED--MTEFGKYPSDNKVTEKPEILFARMDIKD 513
>gi|153816358|ref|ZP_01969026.1| hypothetical protein RUMTOR_02610 [Ruminococcus torques ATCC 27756] >gi|145846319|gb|EDK23237.1| hypothetical protein RUMTOR_02610 [Ruminococcus torques ATCC 27756] (633 aa)
Score = 872, Expect = 4.0e-91, Identities = 180/481 (37%), Positives = 275/481 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           +K+YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQKIE KA+E  + P+E VD  +     +W L+   Y  FIRTT E H+  VQ+ F +L  +  IY G ++G+YC  CE  +T++  V  +  D   C  ++ P    +EE+YF K+ ++  + I      P  + P++R NE+ N+FL      DL +SR++F WGI +  + KHVVYVWLDAL NY++G+GY    DS   + K W +     + L+ K+I RFH IYWPI L  LGL  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V + +L++   N DLAN +GNL NR++ M NKY  G++      +   + + +  +      +   ++ L +   ++ + +L   CN +I++  PW L K+  +KD L+  L  ++  +      LE  +   SK+ L Q 
  S:     5 QKYYITTAIAYTSGKPHIGNTYEIVLADAIARYKRSQGYDVFFQTGTDEHGQKIELKAEEAGVTPKEFVDGVSAEIKKIWDLMDTSYDKFIRTTDEDHEKQVQKIFKKLYDQGDIYKGHYEGMYCTPCESFFTESQLVDGKCPD---CGREVQP---AKEEAYFFKMSKYADRLIEHINTHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDDKHVVYVWLDALTNYITGIGYDADGDSTEQYAKLWPAD----LHLIGKDIIRFHTIYWPIFLMALGLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADELVDFFGVDAVRYFVLHEMPFENDGVITWELMVERLNSDLANTLGNLVNRTVSMTNKYFGGVVSDKGAAE-DVDADLKAVIDNTPKAVDAKMDGLRVADAITEIFNLFKRCNKYIDETMPWALAKDEEKKDRLETVLWNLIQGISAGARLLESFMPSTSKKILDQL 478
>gi|163814866|ref|ZP_02206254.1| hypothetical protein COPEUT_01017 [Coprococcus eutactus ATCC 27759] >gi|158449805|gb|EDP26800.1| hypothetical protein COPEUT_01017 [Coprococcus eutactus ATCC 27759] (678 aa)
Score = 872, Expect = 4.1e-91, Identities = 192/518 (37%), Positives = 300/518 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGY--RQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIY---YLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT-----PEPIYLRIESED 1086
           K +YITT I Y SG PHIG+ +  ++AD + RYK+  GY+  F+TG DEHGQKIE KA E    P+E VD+ +     +W L+   Y  FIRTT +YH+  VQ+ F +L  +  IY G + G YC  CE  +T    +  +  D   C +  P+ + +EE+YF K+ +++ K +    + P  + P +R NE+ N+FL      DL +SR++F WGI +  +PKHVVYVW+DAL NY++GLGY    K D  F K+W +     + L+ K+I RFH IYWPIML  LGL  P +   H W+I   GKMSKS GNV+     ++ +G DA R+++L E+  + D V S +L++   N +LAN +GNL NR+I M NKY  GI+   +  +   + + +K +     ++   ++KL +   ++ +  L   CN +I++  PW L KE ++KD     +++ N V+ +I     LEP + + +++ + Q + +  K     VT+       K  T     PE ++ R++ ++
  S:     4 KPYYITTAIAYASGKPHIGNTYEIVLADSIARYKRFAGYDVRFMTGTDEHGQKIENKAFENMQTPKEFVDETSGEIKRIWDLMNTSYDKFIRTTDDYHEKQVQKIFKKLYDQGDIYKGHYVGKYCTPCESFFTDGQLIDGKCPD---CGR--PVQEAKEEAYFFKMSKYQDKLMKHIEQHPEFIQPESRRNEMVNNFL-KPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWVDALSNYITGLGYDVDGKSDEKFYKYWPAD----LHLIGKDILRFHTIYWPIMLMALGLPLPKQVFGHPWLIQSDGKMSKSKGNVMYADDMVDIFGVDAVRFFVLHEMPFENDGVISWELMVERLNSELANTLGNLVNRTISMSNKYFGGIVTNTNVTE-PVDEDLKKVVMDCRYKVAECMDKLKVADAITEIFALFKRCNKYIDETMPWALAKEEDKKDR--LNTVLYNLVESIIIGATLLEPYMPETTEKIMAQLSTEKRK-----VTELGKFGLYKSGTKVTEQPEILFARLDVKE 514
>gi|186902629|ref|ZP_02975571.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 7424] >gi|186690247|gb|EDU14881.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 7424] (530 aa)
Score = 872, Expect = 4.2e-91, Identities = 191/515 (37%), Positives = 294/515 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ---KEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFDIKFVTDFSSLD---------NQKINTPEPIYLRIE 1083
           KKF +TTP+YY +  PHIG A+TT+IADV+ R+K+  GY    ITG DEHGQKI+  A+   L PQ   D+    F  LW  L I Y  F RT++E H+++V+E F  + ++  IYL   KG YCV+CEE        ++E  ++ YC Q+H  ++   K+EE+YF ++ ++++ +  F + +P  + P +R NE+ N         D SISR N  WG  +  +P H +YVW DALL Y++ L    ++ +  N    W   +   + L+ K+I RFH +YWP ML    L  P +   HG++  +  KM KSLGN LDP   I  YG DA RYY +KE+ L +D  F+E   +N  N DLAN++GNL NR++GM+ KY +G  P+ +   L  N   +   +Q  + ++  +E L        +  LI  CN +I++  PW L K+  + +++  L  +L +V+   Y L P+  + S    +Q  F +D + F++    +F   D         NQ ++ PEPI+ ++E
  S:     9 KKFALTTPLYYVNDIPHIGSAYTTMIADVIARWKRLQGYSVLLITGTDEHGQKIQRTAESKGLNPQAHCDRIVDEFKTLWDKLNISYDRFSRTSSERHQDIVKEFFQRVWEQGDIYLDQQKGWYCVACEE-----FKEQRELTEEGYC-QIHTNLKAEWKDEENYFFRLSKYQEKLEEFYRLNPEFIQPESRRNEVLN--FVKQGLQDFSISRVNVDWGFPLPSDPNHTIYVWFDALLGYITPLLNPDQEPTLENALSIWWPIN---LHLIGKDILRFHAVYWPAMLMSAQLPLPDRVFGHGFLTKDGQKMGKSLGNTLDPFDLIYRYGADAVRYYFVKEIELGKDGDFNETRFVNILNADLANDLGNLLNRTLGMVQKYCNGNGPQLTSDSLDENNPLKIIGQQLSERVSESMESLQFNGACEEIFSLIRACNKYIDESAPWSLFKQKKQTEVEQVLYGVLESVRLAAYLLSPITPNLSNRIYQQLGFCVDFNDFEL-VNQNFPFQDQTQWGKFPANQNLSKPEPIFSKLE 528
>gi|159029236|emb|CAO87596.1| metG [Microcystis aeruginosa PCC 7806] (537 aa)
Score = 872, Expect = 4.3e-91, Identities = 198/515 (38%), Positives = 292/515 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKF---DIKFVTDFSSL---------DNQKINTPEPIYLRIE 1083
           K F +TTP+YY +  PHIG A+TT++ADV+ R+K+  G     ITG DEHGQKIE  A    L PQE  D+ A  F NLW  L I+Y  F RTTA  H+ +V E F ++ +K  IYL   +G YCV+CEE   K    R+  D+   C  +H  +  E   EE+YF ++ +++  +    ++ PN + P +R NE+ N    N    D SISR N +WG  I  + +H +YVW DALL Y++ L   + +   ++   K+W       + L+ K+I RFH IYWP ML   GL  P +   HG++  +  KM KSLGN LDP   ++ YG DA RYY +KE+ L +D  F E   +N  N DLAN++GNL NR++GM+ KY   I P+ +      +I  + +LK     +  I+E+    L   +    ++ LI   N FI++  PW L K+  +  ++  L  +L +V+   Y L P++   S +  +Q  F ID + F   D +   D  S           N ++ TPEPI+ ++E
  S:     8 KTFALTTPLYYVNDIPHIGSAYTTIVADVMARWKRLQGNSVLLITGTDEHGQKIERTAAAKGLNPQEHCDRIATSFANLWAKLHIQYDRFSRTTAPRHQAIVNEFFEKVWEKGDIYLDRQQGWYCVACEEFKEK----RELLDNG--CCPIHTNLAAEWRDEENYFFRLSKYQAQLEQLYQEQPNFIQPESRRNEVLN--FVNQGLQDFSISRVNVAWGFPIPHDGQHTIYVWFDALLGYVTALLDPEDEPTLENALAKWWPID----LHLIGKDILRFHAIYWPAMLMSAGLPLPKRVFGHGFLTKDGRKMGKSLGNTLDPFDLVDRYGADAVRYYFVKEIELGQDGDFQETRFVNILNADLANDLGNLLNRTLGMVKKYCQNIPPQLT----GVDIPNDNRLKNMGTNLGVIVEQKYDALQFNQACEEILALIRASNKFIDESAPWSLFKQKQQAAVEQVLYAVLESVRLSAYLLSPIIPTLSSKIYQQLGFVIDFNTFRSEDGENFPDSVSFFQHCQWGLPTNPQLGTPEPIFSKLE 531
>gi|19704603|ref|NP_604165.1| methionyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|25009363|sp|Q8RE57|SYM_FUSNN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|19714899|gb|AAL95464.1| Methionyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (636 aa)
Score = 869, Expect = 9.0e-91, Identities = 196/513 (38%), Positives = 297/513 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKF--VTDFSSL-DNQKINTPEPIYLR 1081
           K F+++TPIYY +G+PH+G A+TT+ ADV+ RY K +G +T F+TG+DEHGQK+E+ AK+    PQ   DK    F N+W  L I+Y  FIRTT + HK  V+     +  K  IY G ++G YCVSCE  + +N     + +    C      L   +EESYF K+    KY  + LK     P+ + P +R NE+  SF+      DLSISR+ FSWGI I   P H+ YVW DAL NY++  G+ + D++ F KFWN  ++ +V L+ K+I RFH I WP ML   G++ P   ++HGW  +E  KMSKS GNV++P   I  YG DAFRYYLL+E +   D  +S K +I   N DLAN++GNL NR++GM  KY +G I   S  +       + ++K   +++   +EK        + L  +   I+  N +I++  PW L K E  +  L   ++++   + ++ + + P + + +++   Q  ID    ++KF  + ++S   +  K+    PI+ R
  S:     3 KNFFVSTPIYYVNGDPHVGSAYTTIAADVINRYNKAMGMDTHFVTGLDEHGQKVEQAAKQNGFTPQAWTDKMTPNFKNMWAALDIKYDDFIRTTEDRHKKAVKRILDIVNAKGDIYKGEYEGKYCVSCETFFPEN-----QLNGSNKCPDCGKDLTVLKEESYFFKM---SKYADALLKHIDEHPDFILPHSRRNEVI-SFIKQ-GLQDLSISRNTFSWGIPIDFAPGHITYVWFDALTNYITSAGF-ENDENKFDKFWN--NSRVVHLIGKDIIRFHAIIWPCMLLSAGIKLPDSIVAHGWWTSEGEKMSKSRGNVVNPYDEIKKYGVDAFRYYLLREANFGTDGDYSTKGIIGRLNSDLANDLGNLLNRTLGMYKKYFNGTIVSSSTVE-----PIDDEIKSMFNDVVKDVEKYMYLFEFSRALETIWKFISRLNKYIDETMPWTLAKNEAKKARLAAVMNILCEGLYKIAFLIAPYMPESAQKISNQLGIDKDITNLKFDDIKEWSIFKEGHKLGEASPIFPR 510
>gi|166367026|ref|YP_001659299.1| methionyl-tRNA synthetase [Microcystis aeruginosa NIES-843] >gi|166089399|dbj|BAG04107.1| methionyl-tRNA synthetase [Microcystis aeruginosa NIES-843] (537 aa)
Score = 869, Expect = 9.9e-91, Identities = 197/515 (38%), Positives = 292/515 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFDIKFVTD------FSSL------DNQKINTPEPIYLRIE 1083
           K F +TTP+YY +  PHIG A+TT++ADV+ R+++  G     ITG DEHGQKIE  A    L PQE  D+ A  F NLW  L I+Y  F RTTA  H+ +V E F  + +K  IYL   +G YCV+CEE   K    R+  D+   C  +H  +  E   EE+YF ++ +++  +  F ++ P+ + P +R NE+ N    N    D SISR N +WG  I  + +H +YVW DALL Y++ L   + +   ++   K+W       + L+ K+I RFH IYWP ML   GL  P +   HG++  +  KM KSLGN LDP   ++ YG DA RYY +KE+ L +D  F E   +N  N DLAN++GNL NR++GM+ KY   I P+ +      +I  + +LK     +  I+E+    L   +    ++ LI   N FI++  PW L K+  +  ++  L  +L +V+   Y L P++   S +  +Q  F ID + F  +   D      FS         N ++ TPEPI+ ++E
  S:     8 KTFALTTPLYYVNDIPHIGSAYTTIVADVMARWQRLQGNSVLLITGTDEHGQKIERTAAAKGLNPQEHCDRIATSFANLWAKLHIQYDRFSRTTAPRHQAIVNEFFERVWEKGDIYLDRQQGWYCVACEEFKEK----RELLDNG--CCPIHTNLAAEWRDEENYFFRLSKYQTQLEQFYQEQPDFIQPESRRNEVLN--FVNQGLQDFSISRVNVAWGFPIPHDGQHTIYVWFDALLGYVTALLDPEDEPTLENALAKWWPID----LHLIGKDILRFHAIYWPAMLMSAGLPLPKRVFGHGFLTKDGRKMGKSLGNTLDPFDLVDRYGADAVRYYFVKEIELGQDGDFQETRFVNILNADLANDLGNLLNRTLGMVKKYCQNIPPQLT----GVDIPNDNRLKNMGINLGGIVEQKYDALQFNQACEEILALIRASNKFIDESAPWSLFKQKQQAAVEQVLYAVLESVRLSAYLLSPIIPTLSSKIYQQLGFVIDFNTFRSEDGEDPPDGVSFSQHCQWGLPTNPQLGTPEPIFSKLE 531
>gi|148377472|ref|YP_001256348.1| methionyl-tRNA synthetase [Mycoplasma agalactiae PG2] >gi|148291518|emb|CAL58904.1| Methionyl-tRNA synthetase (Methionine-tRNAligase) [Mycoplasma agalactiae PG2] (515 aa)
Score = 868, Expect = 1.1e-90, Identities = 197/515 (38%), Positives = 308/515 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN-FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMI-NKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           K FYITTPIYY SG  HIGH + T +  ++  YKK LG++  F+TG DEHGQKIE+KA   N  PQ   D+    +  +W+   I Y +F RT+   H  +VQ  FS+ L+  FIY G + GLY V+ EE  TKN AV K+  +  +    H L+   EESYF K+K+F+  ++     +P  + P    NE+  +F+ ++  +DLS++R+N +WGI+  E+PKH +YVWLDAL NY+S LG+  ++ S+ + K+W + D EIV ++ KEI+RFH IYW I  + LG+R PTK  +HG +  + G KMSKSL NV++P Y  + Y  +  +YY    +S  ED  FSE  LI+  N +L NN GNL +R++ MI N   +G+I  Y +     ++E E+++  F  +   ++++  + K L   ++L +  N +I+ +KPW L    ++++L+  L  +LN +  V + L+ V+ +   E  +  N++S  F++  +++FS  D  K      +Y RI+
  S:     3 KTFYITTPIYYTSGPLHIGHLYCTTVTWIIANYKKILGFDVKFLTGSDEHGQKIEQKAAAANKDPQTYADELVDSYKKMWQKYNINYDYFSRTSDPKHMKMVQAIFSKFLELGFIYKGKYDGLYSVNDEEFLTKNQAVLKDG-EYYHPVSGHKLVLMSEESYFFKMKEFQNWWLKEVENNPEWLLPAKMTNEMITNFV-SEGLEDLSVTRTNINWGIKTNEDPKHTLYVWLDALFNYVSALGFDLENPSDEYLKYWQNGD-EIVHIIGKEISRFHFIYWTIFTKALGIRIPTKIYAHGLLRDKNGRKMSKSLNNVIEPEYLFSKYDDEMIKYYFASAISFGEDGNFSEDKLIDIINSELVNNYGNLVSRTVKMISNSSPEGLI--YRQSSKIEHLEIEEKINSFSSKFIELMDEFRLDKALEYSMNLSDALNKYIDMLKPWTLTAHEHKEELENILVRLLNGIYAVSWSLQIVMPNKITEVARALNVNS--FELDNISNFSKFDGVKTADKFILYNRIK 514
>gi|154506267|ref|ZP_02043005.1| hypothetical protein RUMGNA_03809 [Ruminococcus gnavus ATCC 29149] >gi|153793455|gb|EDN75875.1| hypothetical protein RUMGNA_03809 [Ruminococcus gnavus ATCC 29149] (639 aa)
Score = 867, Expect = 1.6e-90, Identities = 184/481 (38%), Positives = 277/481 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           K +YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQKIE KA+E  + P+E VD  +     +W L+   Y  FIRTT E H+  VQ+ F +L  +  IY G ++G+YC  CE  +T++  V  +  D   C  ++ P    +EE+YF K+ ++  + I      P  + P++R NE+ N+FL      DL +SR++F WGI +  +PKHV YVWLDAL NY++G+GY    +S   F K W +     + L+ K+I RFH IYWPI L  L L  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V + +L++   N DLAN +GNL NR++ M NKY  G +      +     E +  LK   +     +   +E+L +   ++ + +L   CN +I++  PW L K+  +KD L+  L  ++ ++ R    LE  +   SK+ L+Q 
  S:    11 KPYYITTAIAYTSGKPHIGNTYEIILADAIARYKRSQGYDVFFQTGTDEHGQKIELKAEEAGVTPKEFVDNVSGEIKKIWDLMDTSYDKFIRTTDEDHEKQVQKIFKKLYDQGDIYKGHYEGMYCTPCESFFTESQLVDGKCPD---CGREVQP---AKEEAYFFKMSKYADRLIEHINTHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPKHVTYVWLDALTNYITGIGYDCDGNSTEQFHKLWPAD----LHLIGKDIIRFHTIYWPIFLMALDLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADELVDFFGVDAVRYFVLHEMPFENDGVITWELMVERMNSDLANTLGNLVNRTVSMTNKYFSGTVTDKGVAE-----EVDADLKAVTESTPKAVEDKMEELRVADAMTEIFNLFKRCNKYIDETMPWVLAKDEAKKDRLETVLWNLIQSISRGAELLESFMPSTSKKILEQL 484
>gi|167768118|ref|ZP_02440171.1| hypothetical protein CLOSS21_02673 [Clostridium sp. SS2/1] >gi|167709642|gb|EDS20221.1| hypothetical protein CLOSS21_02673 [Clostridium sp. SS2/1] (656 aa)
Score = 867, Expect = 1.6e-90, Identities = 192/518 (37%), Positives = 295/518 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN--FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT-----PEPIYLRIESED 1086
           K +YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQK+E KA+E  + P+E VD  A     +W L+   Y  FIRTT E H+  VQ+ F +L ++  IY G ++GLYC  CE  +T++  V  +  D   C +  P+   +EE+YFLK+ ++  + I      P  + P +R NE+ N+FL      DL +SR++FSWGI +  +  H+VYVWLDAL NY++G+GY    +S+  F KFW +     + L+ K+I RFH IYWPI+L  L L  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V S +L+I   N DLAN +GNL NR+I M NKY  GI+         ++ + +  +    D++   +  L +   ++ + +L   CN +I++  PW L K+   KD L   L  ++  +      L P + + S++   Q N    +FD     + ++  N K  T     P+ ++ R++ ++
  S:     4 KPYYITTAITYTSGKPHIGNTYEIILADSIARYKRMEGYDVFFQTGTDEHGQKVELKAEEKGVTPKEFVDDVAGEIKRIWDLMNTSYDRFIRTTDEDHEKQVQKIFKKLYEQGDIYKGEYEGLYCTPCESFFTESQLVDGKCPD---CGR--PVQPAKEEAYFLKLSKYADRLIEHINTHPEFIQPESRKNEMMNNFL-LPGLQDLCVSRTSFSWGIPVDFDEGHIVYVWLDALTNYITGIGYDCDGNSSDKFNKFWPAD----LHLIGKDIIRFHTIYWPIILMALDLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADDLVDFFGVDAVRYFVLHEMPFERDGVISWELMIERMNSDLANILGNLVNRTISMSNKYFGGIVEDKGVVG-DYDDDLKAVVTGTKDKVAEKMADLRVADSMTEIFNLFRRCNRYIDETMPWVLAKDEASKDRLATVLYNLVEGITIGASLLSPYMPETSEKIFAQLNTSMVEFD-----NLATFGNYKSGTKVTEKPQILFARLDEKE 514
>gi|47092860|ref|ZP_00230643.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|47018764|gb|EAL09514.1| methionyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] (630 aa)
Score = 867, Expect = 1.7e-90, Identities = 192/488 (39%), Positives = 291/488 (59%)
  Q:   598 LTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS---KFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++ ++  + +  +   P  + P +R NE+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+    D +F+ +  ++  N DLAN++GNL NR++ MINKY DG IP Y       N+ EF++ L  F + +    E     +     L+++  LI+  N +I++  PW L K+ +++ +L   ++ +   ++ +   L+P L     E   Q  +      K+D  +           +    PI+ R+E+E
  S:     1 MARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIK-PGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQG-----NVTEFDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLEAE 493
>gi|167747813|ref|ZP_02419940.1| hypothetical protein ANACAC_02535 [Anaerostipes caccae DSM 14662] >gi|167653175|gb|EDR97304.1| hypothetical protein ANACAC_02535 [Anaerostipes caccae DSM 14662] (648 aa)
Score = 866, Expect = 1.9e-90, Identities = 193/516 (37%), Positives = 294/516 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINT-----PEPIYLRIESED 1086
           +YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQK+E KA E  + P+E VD  A     +W L+   Y  FIRTT   H+  VQ+ F  L ++  IY G ++GLYC  CE  +T++  V  +  D   C  ++ P    +EE+YFLK+ ++   +  ++   P  + P +R NE+ N+FL      DL +SR++F WGI +  +  HVVYVWLDAL NY++G+GY    +S   F+K W +     + L+ K+I RFH IYWPI+L  L L  P +   H W++   GKMSKS GNVL        +  DA RY++L E+  + D V S +L++   N DLAN +GNL NR+I M NKY DG++            EF+ QLK       D++   ++ L +   ++ + ++   CN +I++  PW L K+  +KD L   L  ++  +      LEP + +  ++ LKQ N +  +F+     D ++  + K  T     PE ++ R++ E+
  S:     6 YYITTAITYTSGKPHIGNTYEIILADSIARYKRMEGYDVFFQTGTDEHGQKVELKAAEKGVTPKEFVDDVAGEIKRIWDLMNTSYDKFIRTTDADHEAQVQKIFKRLYEQGDIYKGHYEGLYCTPCESFFTESQLVDGKCPD---CGREVQP---AKEEAYFLKLSKYADRLIDYINAHPEFIQPESRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDEGHVVYVWLDALTNYITGIGYDCDGNSTDQFKKLWPAD----LHLIGKDIIRFHTIYWPIILMALDLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADDLAEMFSVDAVRYFVLHEMPFEHDGVISWELMVERMNSDLANTLGNLVNRTISMSNKYFDGVVEDKGVED-----EFDDQLKAVVTGARDKVQKKMDVLKVADAMTEIFNVFKRCNKYIDETMPWVLAKDEAKKDRLATVLYNLVEGILTGAALLEPYMPETVEKILKQLNAEPRRFE-----DLTTFGHYKSGTKVTEKPEILFARLDEEE 514
>gi|166031337|ref|ZP_02234166.1| hypothetical protein DORFOR_01024 [Dorea formicigenerans ATCC 27755] >gi|166028742|gb|EDR47499.1| hypothetical protein DORFOR_01024 [Dorea formicigenerans ATCC 27755] (648 aa)
Score = 864, Expect = 3.1e-90, Identities = 190/518 (36%), Positives = 296/518 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKI-NTPEPIYLRIESEDK 1087
           K+YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQKIE KA E  + P++ VD  A+    +W L+   Y  FIRTT E H+  V++ F  L  +  IY   ++G+YC  CE  +T++  V  +  D   C  +  P    +EE+YF ++ ++   +  ++   P  + P++R NE+ N+FL      DL +SR++F+WGI +  +PKHVVYVWLDAL NY++G+GY    +S   F+K W +     + L+ K+I RFH IYWPI L  L L  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V S +L++   N DLAN +GNL NR+I M NKY  G +      +   +   +  LK   ++    +E    +L +   ++ +  L   CN +I++  PW L KE  +KD L+  L  ++ ++K     LE  + + S++ L Q  +   K   K    F+ LD +++    E ++ ++ +E+K
  S:     9 KYYITTAIAYASGKPHIGNTYEVVLADAIARYKRSQGYDVFFQTGTDEHGQKIELKADEAGITPKQFVDNAAREIKKIWDLMNTSYDKFIRTTDEDHEAQVKKIFKRLYDQGDIYKSSYEGMYCTPCESFWTESQLVDGKCPD---CGRECKP---AKEEAYFFRMSKYADRLIDYINTHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTSFTWGIPVDFDPKHVVYVWLDALTNYITGIGYDCDGNSTEQFKKNWPAD----LHLIGKDIIRFHTIYWPIFLMALDLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADELVDFFGVDAVRYFVLHEMPFENDGVISWELMVERMNSDLANTLGNLVNRTISMTNKYFGGTVTNKGVAETEEDKAVDADLKAITEDTPKRVEAKMDELRVADAITEIFVLFKRCNKYIDETMPWALAKEEAKKDRLETVLYNLIESIKTGARLLESFMPETSEKILAQ--LGDGKVTEKPEILFARLDVEEVMKKVEELHPQMTAEEK 523
>gi|188997460|ref|YP_001931711.1| methionyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932527|gb|ACD67157.1| methionyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] (628 aa)
Score = 863, Expect = 4.3e-90, Identities = 199/493 (40%), Positives = 283/493 (57%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH--PLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRS--NFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK 1059
           + +KFY+TTPIYY +  PH+GHA+TT+ ADVL RY +++G +TFF+TG DEHGQKI++ A+E  + P+EL DK    F  LWK L I Y  FIRTT   H   VQ  F +  +   IYL  ++  YCV CEE  T+      E  D  Y   +H  P  + +EESYF ++ ++  K +  + K+P  + P  R NE+  SF+      DLS+SR     +WGI +  +P H +YVW DAL NYL+ +GY +    N  +FW +     V ++ K+I RFH +YWP  L    L    K  +HGW   E  KMSKSLGNV+DP    + +G D  RY+LL+E+    D  FS+  +IN  N DLAN++GNL +RS+ MI+K+++G I K S  K     E++    +  +     I+KL   K L  V   I+  N +I +V+PW L KE+ E  L   L  +++ +  V++ L P +     EAL   NI+  K DIK
  S:     1 MQEKFYVTTPIYYVNDVPHLGHAYTTVAADVLARYYRQIGVKTFFLTGTDEHGQKIQKTAEEKGISPKELADKTHLAFKELWKKLNISYDRFIRTTDPDHIKAVQHIFQKCYENGDIYLSEYESYYCVGCEEFKTET-----EIKDYDYKCPIHLKPCEKVKEESYFFRLSKYTDKLLEFYEKNPEFILPDFRKNEVV-SFVKQ-GLKDLSVSRKRDRVAWGIPVPFDPSHTIYVWFDALTNYLTAVGYPE----NLNEFWPAD----VHIVGKDILRFHAVYWPAFLMSARLEISKKVFAHGWWTVEGHKMSKSLGNVVDPFKAADEFGVDKLRYFLLREVPFGLDGDFSKSAVINRINSDLANDLGNLISRSLTMIHKFQNGKIEKPSVFK-EIEEEYKNVYSKTLENYKNFIQKLEFSKSLEEVWQFIDWLNKYIVKVEPWKLNKEDKEY-LKTTLYTVVDGIYAVVWMLNPFMPQKMAEALSMLNINEIKKDIK 481
>gi|114776564|ref|ZP_01451609.1| methionyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1] >gi|114553394|gb|EAU55792.1| methionyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1] (512 aa)
Score = 863, Expect = 4.8e-90, Identities = 169/471 (35%), Positives = 269/471 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           M+ +Y+TTPIYY +  PH+GH +TT+ ADVL RY++  G + FF+TG+DEHGQK+++ A+   ++P EL D+  + + +LW  L I    FIRT+++ H+  VQ  +  L     IY G ++  YCV CE  +T+      +  ++ +C      ++K +EESYF ++  ++  +  ++  +P+ + P +R NE+   F+ +   +DLS+SR+ FSWG+ +  + KHV+YVW+DAL NYLS LG+    D    K+W +     V L+ K+I RFH IYWP ML    L  P +  +HGW   E  KMSKS GN L P   +  Y  D  RY+LL+E+   +D  FS   +   +N DLAN+VGNL NRS+ M+NKYRDG++ +    + + +      ++    ++   + K      L R+  ++   N ++E+  PW L K  +E  L+  L  +   ++ V   L P +
  S:     1 MESYYVTTPIYYVNDEPHLGHIYTTIAADVLARYQRMAGRDVFFLTGVDEHGQKVQQAAEARGIEPIELADQVVERYQSLWPELAITNDDFIRTSSDRHRRGVQAMWRRLENAGAIYKGFYEDWYCVPCETYWTETQLNDADCWEEKHCPDCKRAVEKVQEESYFFRLSAYQDRLLEYINANPDFIGPASRRNEVLR-FVES-GLNDLSVSRTTFSWGVPVPGDEKHVIYVWIDALTNYLSALGF---PDQELPKYWPAD----VHLIGKDILRFHAIYWPCMLMAADLPLPQRLFAHGWWTVEGEKMSKSKGNALRPADLLEQYDADVIRYFLLREVPFGQDGDFSFSAMKQRYNSDLANDVGNLLNRSLAMLNKYRDGVLAEPGDEQ-AVDRTLIADVEGMQRDVAAHMNKQAFHLALERISVVVRHGNRYVEENAPWSLAKAGDEARLNTVLYHLAETLRLVALQLMPFM 463
>gi|169824241|ref|YP_001691852.1| methionyl-tRNA synthetase [Finegoldia magna ATCC 29328] >gi|167831046|dbj|BAG07962.1| methionyl-tRNA synthetase [Finegoldia magna ATCC 29328] (666 aa)
Score = 862, Expect = 6.5e-90, Identities = 191/492 (38%), Positives = 294/492 (59%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNL--KPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQL----KQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFD 1057
           E  K +YITTPIYYPS N H+GH +TT+IAD L ++KK  GY+ F  TG DEHGQK+ EKAKE N+   P   +D   +   +LWK L I+   F+R+T + H+  VQE F +L  K  IY   +KG YCV CE  +T++     +  D       H     EEESYF ++ ++K  I    KD P+ + P +R NE+ N+FL+ +  +DLS+SR++F WG+++  + KH++YVW+DAL  YL+G+GY Q D+  F KFW       + L+ KEI RFH I WP +L  L L  P +  +HGWI+  + KMSKS GNV  P   I+ YG DA +YY+L++ +   D  F+ +  +N FN DL N++GNL +RS+ M+ KY DG+IP+ +      N + +K L    +   +++  ++E+L+    L  +  ++   N +I++  PW L KE+ E+ L   L  +++A++ +     P + + S +  +Q  +   K++
  S:     3 EEKKSYYITTPIYYPSSNLHLGHTYTTIIADTLKKFKKIQGYDVFLTTGTDEHGQKLYEKAKEKNMGDNPLNYIDPIVQSAKDLWKKLDIDIDSFVRSTDKVHEKNVQEIFQKLYDKGDIYKSTYKGHYCVDCEAFWTESQLKDGKCPDCGRDVHYH-----EEESYFFRLSKYKDRILQLYKDNPDFLKPESRKNEMVNNFLSGE-LEDLSVSRTSFDWGVKVPFDDKHIIYVWIDALSCYLTGIGYGQ-DEELFNKFWPCD----IHLVGKEIVRFHTIIWPALLMALDLPLPKRVFAHGWILFNEDKMSKSKGNVYYPEPIIDLYGVDALKYYILRDFTFGNDGNFTTERFMNRFNSDLVNDLGNLVSRSVSMVEKYFDGVIPQPND-----NNDIDKSLISVVEGCQEKVEELLEELDFSNALEEIWKVVRRANKYIDETTPWILIKEDPER-LKTVLYNLMDAIRVICILTSPFITETSNKIKEQIGLSEIKWE 484
>gi|160947754|ref|ZP_02094921.1| hypothetical protein PEPMIC_01689 [Peptostreptococcus micros ATCC 33270] >gi|158446888|gb|EDP23883.1| hypothetical protein PEPMIC_01689 [Peptostreptococcus micros ATCC 33270] (649 aa)
Score = 861, Expect = 6.9e-90, Identities = 188/499 (37%), Positives = 297/499 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL 1067
           K FY+TTPIYYP+ N H+GH +TT++ADVL +YK+  G++ FF TG DEHGQK++E A +    P E +D   +    LW+ L I++  F+R+T + H+  V E F++L +K  IY G +KG+YCV CE  +T++  V  E +    C +   +   EEE+YF ++ +++ + +  + ++P+ + P +R NE+  SF+ N+   DLS++RS+F WG+++  + KHVVYVW+DAL  YL+G+GY   D+  F KFW       V L+ KEI RFH I WP +L  L L  P K   HGWI+ +  KMSKS GN++     I  YG DA RY++L+E +  +D  F+   ++N  N DL N++GNL +RS+ M  KY DG +P  S+ +L+   E +  L +      D +  +++KLN    L  +  L+   N +I++  PW L KE  E+ L   +  +L +++ +   ++P + + S    +Q  I  S +  + +T F  L
  S:     4 KNFYLTTPIYYPNSNLHLGHTYTTIVADVLKKYKQAQGFDVFFTTGTDEHGQKLQESAIKAGKAPLEYIDPIVESAKELWRTLDIDFDAFVRSTDKIHEKNVSEIFTKLYEKGEIYKGSYKGMYCVPCEAFWTESQLV--EGNKCPDCGR--EVSPSEEETYFFRLSKYQDRLLKLYEENPDFIQPESRKNEMI-SFI-NEGLTDLSVTRSSFDWGVRVPFDEKHVVYVWIDALSCYLTGIGY-GTDEEKFNKFWPCD----VHLIGKEIMRFHAIIWPAILMALDLPLPKKIFGHGWILFDDDKMSKSKGNIVYAEPIIERYGMDALRYFMLREFTFGQDGNFTYTKMLNRINSDLVNDLGNLVSRSVAMCEKYFDGFVP--SQTELT---ELDNDLIEIATTTRDRVAELMDKLNFSMALEEIWKLVRRTNKYIDETTPWTLIKEQKEERLKTVIYNLLESIRIISGLIKPFMKETSLRINEQ--IGYSDYSYEDLTKFGLL 489
>gi|153854787|ref|ZP_01996021.1| hypothetical protein DORLON_02019 [Dorea longicatena DSM 13814] >gi|149752694|gb|EDM62625.1| hypothetical protein DORLON_02019 [Dorea longicatena DSM 13814] (646 aa)
Score = 860, Expect = 1.1e-89, Identities = 180/480 (37%), Positives = 278/480 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           K+YITT I Y SG PHIG+ +  ++AD + RYK+  GY+ FF TG DEHGQKIE KA E  + P+E VD  +     +W L+   Y  FIRTT E H+  V++ F +L  +  IY G ++G+YC  CE  +T++  V  +  D   C  +  P    +EE+YF K+ ++   + +++ + P  + P++R NE+ N+FL      DL +SR++F WGI +  +PKH+VYVWLDAL NY++G+GY    D N  + +N      + L+ K+I RFH IYWPI L  L L  P +   H W++   GKMSKS GNVL     ++ +G DA RY++L E+  + D V S +L++   N DLAN +GNL NR+I M NKY  G++      +       +  LK   ++    +   +++L +   ++ +  L   CN +I++  PW L K+  +KD L+  L  ++ ++K     LE  + + S++ L Q 
  S:     9 KYYITTAIAYASGKPHIGNTYEIVLADAIARYKRSQGYDVFFQTGTDEHGQKIELKADEAGVTPKEFVDNASGEIKKIWDLMNTSYDKFIRTTDEDHEAQVKKIFKKLYDQGDIYKGAYEGMYCTPCESFWTESQLVDGKCPD---CGRECKP---AKEEAYFFKMSKYADRLINYINEHPEFIQPVSRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPKHIVYVWLDALTNYITGIGY--DCDGNSTELFNKNWPADLHLIGKDIIRFHTIYWPIFLMALDLPLPKQVFGHPWLLQGDGKMSKSKGNVLYADELVDFFGVDAVRYFVLHEMPFENDGVISWELMVERMNSDLANTLGNLVNRTISMTNKYFGGVVTDKGVAETEEEKAVDADLKAVTEDTPKRVDAKMDELRVADAITEIFVLFKRCNKYIDETMPWALAKDEAKKDRLETVLYNLIESIKAGAKLLESFMPETSEKILAQL 486
>gi|167042815|gb|ABZ07533.1| putative tRNA binding domain protein [uncultured marine microorganism HF4000_ANIW137I15] (665 aa)
Score = 859, Expect = 1.4e-89, Identities = 180/474 (37%), Positives = 271/474 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN-FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI----IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGS 1042
           + FY+TTPIYY +  PHIGHA+TT+ ADVL R+ +  G   F +TG DEHGQK+E  A +  L PQ L D+    +  LW  L IE   FIRTT   H+  V++ F  + +K  IYLG ++G YC   E  +T+   V    D K  C +   P+ +  EESYF ++ +++  +   L++ P  + P +R NE+   F+      DLSISR+ F WGI +     HV+YVW DAL NY+S LG+ +K+    ++ FW +     V L+ K+I RFH +YWP  L    L  P +  +HGW   E  KMSKSL NV++P   ++ YG DA RY+LL+E+   +D  FS + LI   N DLAN++GNL +R+IGM+ ++  G +P+ ++       + E+ L+Q     T +    +E L  Q++L +V D I + N +++   PW L K  +E  +   L     A++ +  +L P + D +
  S:     3 ETFYVTTPIYYVNDYPHIGHAYTTIAADVLARFHRLAGTRVFLLTGTDEHGQKVERAALDRGLTPQGLADRVVGRYHQLWDRLRIEPDDFIRTTEARHRKGVEDLFRRVQEKGDIYLGEYEGWYCTPDESFWTETQVV----DGK--CPECGRPVERVREESYFFRMSKYQDRLLRHLEEHPGFILPESRRNEVIR-FVEG-GLRDLSISRTTFQWGIPVPGGQGHVLYVWFDALTNYISALGFGEKNGGEGYETFWPAD----VHLIGKDILRFHAVYWPTFLMSAELPLPRRVFAHGWWTVEGQKMSKSLRNVVEPNRLLDRYGADAVRYFLLREVPFGQDGNFSHEALIKRINSDLANDLGNLLHRTIGMVEQFCGGRLPRAAEVG-----DLERGLQQAAGATTAVLREELESLEFQRVLKKVWDFIRQVNKYLDARAPWSLSKSGDEAGVRTTLYTAAEAIRVLSVWLWPFMPDAA 466
>gi|153811133|ref|ZP_01963801.1| hypothetical protein RUMOBE_01524 [Ruminococcus obeum ATCC 29174] >gi|149832631|gb|EDM87715.1| hypothetical protein RUMOBE_01524 [Ruminococcus obeum ATCC 29174] (652 aa)
Score = 857, Expect = 2.1e-89, Identities = 187/515 (36%), Positives = 293/515 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN--FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           +K+YITT I Y SG PHIG+ +  ++AD + RYK++ GY+ FF TG DEHGQKIE KA+E  + P+E VD  +     +W L+   Y  FIRTT   H+  VQ+ F ++  K  IY G ++G+YC  CE  +T++  V  +  D   C +  P +  +EE+YF K+ ++   +  ++   P+ + P +R NE+ N+FL      DL +SR++F WGI +  +PKHVVYVWLDAL NY++G+GY    +S+  F K W +     + L+ K+I RFH IYWPI L  L L  P +   H W++   GKMSKS GNV+     ++ +G DA RY++L E+  + D V + +L++   N +LAN +GNL NR+I M NKY  G++      +       ++ LK F      ++   ++KL +   ++ V  L    N +I++  PW L K+  +KD L   L  ++  +      LE  + + ++  L Q N +     D+K    + S  N+    PE ++ R++
  S:     4 QKYYITTAIAYTSGKPHIGNTYEIVLADAIARYKRQEGYDVFFQTGTDEHGQKIELKAEEAGITPKEFVDNVSGEIKRIWDLMNTSYDKFIRTTDADHEKQVQKIFKKMYAKGDIYKGHYEGMYCTPCESFFTESQLVDGKCPD---CGR--PCVPAKEEAYFFKMSKYADRLIDYINTHPDFIQPESRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWLDALTNYITGIGYDCDGESSEQFNKLWPAD----LHLIGKDIIRFHTIYWPIFLMSLDLPLPKQVFGHPWLLQGDGKMSKSKGNVIYADELVDFFGVDAVRYFVLHEMPFENDGVITWELMVERLNSELANTLGNLVNRTISMSNKYFGGVVENKGVVE-----PVDEDLKAFALAVPGKVAEKMDKLRVADAMTEVFTLFKRLNKYIDETMPWALAKDEAKKDRLATVLYNLVEGITMGATLLESFMPETTERILAQLNAEKRTLEDLKTFGLYPS-GNKVTEKPEILFARLD 511
>gi|160878187|ref|YP_001557155.1| methionyl-tRNA synthetase [Clostridium phytofermentans ISDg] >gi|160426853|gb|ABX40416.1| methionyl-tRNA synthetase [Clostridium phytofermentans ISDg] (664 aa)
Score = 856, Expect = 2.6e-89, Identities = 197/515 (38%), Positives = 299/515 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS--NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG--------KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK--YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIE 1083
           K +YITT I Y SG PHIG+ +  ++AD + R+K+  GYE FF TG DEHGQKIEEKA E+ + P+E VDK A    ++W L+   Y  FIRTT   H+  VQ+ F +L  +  IY G ++G+YC  CE  +T +  V  +  D   C  +  P    +EE+YFLK+  +  + I      P  + P +R NE+ N+FL      DL +SR++F WGI +  +PKHV+YVW+DAL NY++G+GY    +S   F KFW +     + L+ K+I RFH IYWPIML  L L  P +   H W++            KMSKS GNVL     +  +G DA RY++L E+    D V + +L+++  N DLAN +GNL NR+I M NKY +G++ K   ++P  +  IE   + +   D++   +  L +   +S +  L   CN +I++  PW L KE  +K  L+  L  ++ ++      LEP L + +++ L Q N  + K +I+ +  F   DN  +  + P+ ++ R++
  S:     4 KPYYITTAIAYTSGKPHIGNTYEIVLADSIARFKRLEGYEVFFQTGTDEHGQKIEEKAAEVGVSPKEFVDKVAGGIKDIWDLMNSSYDKFIRTTDVDHEKQVQKIFKKLYDQGDIYKGNYEGMYCTPCESFFTASQLVNGKCPD---CGRECQP---AKEEAYFLKLSNYTGRLIDHINTHPEFIQPESRKNEMMNNFL-LPGLQDLCVSRTSFKWGIPVDFDPKHVIYVWIDALSNYITGIGYDCDGNSTEQFNKFWPAD----LHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHPWLLQTDPNAKDGSGVKMSKSRGNVLYADDLVEFFGVDAVRYFVLHEMPFDNDGVINWELMVDRMNSDLANTLGNLVNRTISMSNKYFEGVVNKTDVTEPVDADLIEVVTKTR---DKVVAKMANLRVADAISEIFTLFKRCNKYIDETMPWALAKEEEKKARLENVLYNLVESICIGANLLEPFLPESAEKILAQLN--AKKRNIEELATFGLYDNGTKVTDQPQILFARLD 519
>gi|160916068|ref|ZP_02078275.1| hypothetical protein EUBDOL_02095 [Eubacterium dolichum DSM 3991] >gi|158431792|gb|EDP10081.1| hypothetical protein EUBDOL_02095 [Eubacterium dolichum DSM 3991] (651 aa)
Score = 855, Expect = 3.9e-89, Identities = 186/517 (35%), Positives = 296/517 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD--SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEP--IYLRIESED 1086
           K+YITT I Y SG PHIG+ +  ++ D + RYK++ GY+ FF TG DEHGQKIEEKAKE  + P+E VD  A +    + ++   Y +F+RTT +YH+  VQ+ F +L ++  IY   ++G+YC  CE  +T++  V  +  D   C +  P+ +  EE+YF  ++++  + I      P  + P +R NE+ N+FL      DL +SR++F WGI +  +P HVVYVW+DAL NY++ LG+    +   N++K+W +     V ++ K+I RFH IYWPIML  LG   P +   H W++   GKMSKS GN +     ++ +G DA RY++L E+   +D   +  L++   N DLAN +GNL NR+I M NKY  G+I  P    P  +  IE         DE    +++L + + +  +  L+  CN +I++  PW L K+  +KD L   L  +L +++     LE  + + S++ L Q  + +S+ D   +  F  L+       +P  ++ RI+ ++
  S:     8 KYYITTAIAYTSGRPHIGNTYEIVLTDAIARYKRQQGYDVFFQTGTDEHGQKIEEKAKEAGITPKEFVDNIAGIVRKNFDMMNTSYDYFVRTTDDYHEKQVQKIFKKLYEQGDIYKSTYEGMYCTPCESFWTESQLVDGKCPD---CGR--PVKKATEEAYFFNLQKYSPRLIEHIETHPEFIQPESRKNEMINNFL-KPGLQDLCVSRTSFKWGIPVDFDPDHVVYVWIDALSNYITSLGFDVDGNHGENYKKYWPAD----VHIIGKDILRFHTIYWPIMLMALGEPLPKQVFGHPWLLVGDGKMSKSKGNAIYADELVHYFGVDAVRYFVLHEMPFAQDGTITWDLMVERVNSDLANVLGNLVNRTISMQNKYFHGVISNPMEGDPLDAELIELAVATVHNVDE---KMDQLRVGEAIDEIFTLLKRCNKYIDETTPWTLGKDETKKDRLATVLYNLLESIRYAAVLLESFMPETSEKILDQ--LSTSRRDKASLESFGQLECGHTVEAKPSILFQRIDPKE 517
>gi|163784145|ref|ZP_02179086.1| methionyl-tRNA synthetase alpha subunit [Hydrogenivirga sp. 128-5-R1-1] >gi|159880589|gb|EDP74152.1| methionyl-tRNA synthetase alpha subunit [Hydrogenivirga sp. 128-5-R1-1] (633 aa)
Score = 854, Expect = 4.6e-89, Identities = 196/483 (40%), Positives = 283/483 (58%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRS--NFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII---PKYSKPKLSFNIEFEKQLKQFD----DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID 1052
           KFYITTPIYY +  PHIGHA+TT+ ADVL RY ++ G +TFF+TG DEHG KI++ A+E  + P+EL D+  + F  LW++L I Y  FIRTT E H   VQ  F +  +   IYLG ++G YCV CEE  T+      E  D  Y   +H   QK+     EESYF ++ ++  K +  + K+P  + P  R NE+  SF+      DLS+SR      WGI +  +  H +YVW DAL NYL+ +GY   +   F+ FW +     V ++ K+I RFH +YWP  L   GL  P K  +HGW   E  KMSKSLGNV+DP   + +YG D  RY+L++E+    D  FS+  +I   N DLAN++GNL +RS+ MINK++ GI+    KY+        + EK+ K+      + +   ++ L   K L  + + I+  N +I + +PW LKK  +   LD  L ++ + +  +I+ L P + D  KEAL    ++
  S:     4 KFYITTPIYYVNDVPHIGHAYTTVAADVLARYNRQKGIKTFFLTGTDEHGLKIQKSAEEKGITPKELADQTHQKFKELWQVLNISYDRFIRTTDEDHIKAVQYIFQKCYENGDIYLGKYEGWYCVGCEEFKTET-----EIKDLDYKCPIH---QKKCEKIVEESYFFRLSKYTDKLLKLYEKNPEFIQPDYRRNEVV-SFVKQ-GLKDLSVSRKRDRVKWGIPVPFDENHTIYVWFDALTNYLTAVGYPDTESELFKTFWPAD----VHIVGKDILRFHAVYWPAFLMSAGLEIPEKVFAHGWWTVEGKKMSKSLGNVVDPFKAVKSYGVDELRYFLMREVPFGLDGDFSKSAVIGRINSDLANDLGNLISRSLTMINKFKKGIVECGEKYT--------DLEKEYKEIYLYTVENVDKHLKNLEYNKSLELIWEFIDFLNKYIVKTEPWALKKSQDPY-LDTTLYVLADGIYAIIWLLSPFMPDKMKEALNMLGLE 478
>gi|169351609|ref|ZP_02868547.1| hypothetical protein CLOSPI_02389 [Clostridium spiroforme DSM 1552] >gi|169291831|gb|EDS73964.1| hypothetical protein CLOSPI_02389 [Clostridium spiroforme DSM 1552] (638 aa)
Score = 854, Expect = 5.2e-89, Identities = 192/518 (37%), Positives = 297/518 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN--FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKP--KLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD--NQKINTPEPIYLRIESED 1086
           K +Y+TT I Y SG PHIG+ +  ++AD + R+K++ GY  +F TG DEHGQKIE KAKE  + PQ+ VD+ A     +W L+   Y  F+RTT EYHK  VQ+ F +L  +  IYLG ++G YC +CE  +T++  V  +  D   C    P+   +EE+YF K+ ++  + I    K P  + P++R NE+ N+FL      DL +SR++F+W I +  +PKHVVYVW+DAL NY++GLGY    +    ++K+W +     + L+ K+I RFH IYWPIML  L +  P +   H W++  + KMSKS GNV+     ++ +G DA RYY+L E+    D   +  LL+   N DLAN +GNL NR+I M NKY DGI+  PK  +P  +   NI  E   K     +   ++       L  +  L+   N +I++  PW L K+ ++K+ L   L  ++ +++     L P +   + + L Q N D    D + + +F +     +    PE ++ R++S++
  S:     5 KDYYLTTAITYTSGKPHIGNTYEIILADAIARFKRQEGYNVYFQTGTDEHGQKIELKAKEAGIPPQQFVDEKAAEVKRIWDLMDTTYDRFMRTTDEYHKKQVQKIFKKLYDQGDIYLGHYEGKYCTACESFFTESQLVDGKCPD---CGG--PVNDAKEEAYFFKLSKYADRLIEHIEKHPEFIQPVSRKNEMMNNFL-KPGLQDLCVSRTSFTWSIPVDFDPKHVVYVWIDALTNYITGLGYDVDGNHGELYKKYWPAD----LHLIGKDIVRFHTIYWPIMLMALDIPLPKQVFGHPWLLQGESKMSKSKGNVIYADDLVDIFGVDAVRYYVLHEIPYDNDGSITWDLLVEKINSDLANVLGNLVNRTISMSNKYFDGIVNNPKVYEPVDEELINIALEMPKK-----VINKMDDFKSSDALDAIFTLLRRTNKYIDETMPWALAKDESKKERLATVLYNLIESIRFSAIALIPFIPSTANKILDQINTDQR--DYQTLNEFGAYKEGTKVTEKPEILFARLDSKE 515
>gi|150021072|ref|YP_001306426.1| methionyl-tRNA synthetase [Thermosipho melanesiensis BI429] >gi|149793593|gb|ABR31041.1| methionyl-tRNA synthetase [Thermosipho melanesiensis BI429] (634 aa)
Score = 853, Expect = 7.0e-89, Identities = 185/482 (38%), Positives = 281/482 (58%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           MKKFY+TTPIYY +  PHIG A+TT+I D++ RYK+ +GY+ F++TG DEHGQKI + AK+  ++P++L D+ ++ F  LWK L I   +FIRTT   H   VQ   S++L+   IY G++KG YC+ CE  + ++   + E   K  C      L   EEE+YF ++ ++ +  +  F ++P+ V P  R NE+    +      DLSI+R+ F WGI +  +P HV+YVW+DAL+NY+S +GY   D   F+K+W +     + L+ KEI RFH + WP ML  +GL  P K  +HGW+     K+SKSLGN +DP  F+  YG D  RYYL +++   +D  FSE+ L++  N DLAN+ GNL +R+I M+ K  D IIP+ +  +   + +  K+  +  ++    +E   +   L  + + I   N + ++ KPW L KE N+  L   L   L A  +V   L P +   S+E   + 
  S:     1 MKKFYLTTPIYYVNSEPHIGSAYTTIIGDIIARYKRLIGYDVFYLTGTDEHGQKIMQAAKKREIEPKQLCDELSEKFSQLWKDLKITNDYFIRTTDPKHMKTVQLFVSKMLENGDIYKGIYKGWYCIPCETYWNEDETEQIEG--KHICPTCGRELNFVEEENYFFRLSKYTEPLLKHFKENPDFVEPDFRRNEMLK--ILESGLKDLSITRTTFDWGIPMPNDPNHVIYVWVDALINYISAIGY-GSDQEKFEKWWPAD----LHLIGKEINRFHSLIWPAMLMSVGLPLPKKIFAHGWLTVNGQKISKSLGNAIDPREFVKKYGNDVVRYYLARDIVFGKDGDFSEENLVHRLNSDLANDYGNLLHRTIAMVVKNFDSIIPEPNNIQ-EIDEKLIKEYFEVKEKYLEYMESYKLTNALETIWEYIRYINKYFDENKPWVLAKEGNKGRLSTVLYNTLEAFLKVATLLIPFMPYSSEEVFNRL 474
>gi|149195308|ref|ZP_01872396.1| methionyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] >gi|149134572|gb|EDM23060.1| methionyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] (634 aa)
Score = 853, Expect = 7.4e-89, Identities = 196/513 (38%), Positives = 290/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP-----KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           +Y+TTPIYY +  PHIGHA+TT+IAD + RY +  G +TFF+TG DEHGQKIEE A++    P+E  D+ +  F  LW    I Y  FIRTT E HK  VQ+ F E+ KK  IY   ++G YCVSCE      IA  +  +D+L      P    +EESYF ++ +++  I  +LK+   + P  + NE+       +   DLSI+R++F WG+++ +   + KHVVYVWLDAL NYL+ LGY  +D+S  +K+W ++    + ++ K+I +FH +YWP  L  +G   P K  +HGW   +  KMSKS GNV+DP    + YG + FRY+LL+E+    D  FSEK LI+  N DL N++GNL NR IGM  KY DG +      KY   +L+   E  K L++      T + K+ I K L  +  +++  N  I+  KPW+L K    +     + LI N +      L  V+   +++       + +      + +   LD+  I    P++ +IE
  S:     8 YYLTTPIYYVNDVPHIGHAYTTIIADTIARYSRLKGIDTFFLTGTDEHGQKIEEAARKKGKSPKEYADEISAKFKELWDEFEISYDKFIRTTDEAHKRGVQKAFLEMYKKGDIYKDYYEGHYCVSCES----FIAPSQLVNDELCPDCGKPTRIIKEESYFFRLSKYQDKILDWLKNKKPILPEAKANEVIR--FVEEGLKDLSITRTSFEWGVKLPDEINDKKHVVYVWLDALFNYLTALGYGSEDESLVKKYWPAK----LHIVGKDILKFHAVYWPAFLMSIGYELPKKIAAHGWWTRDGEKMSKSKGNVIDPKEVADAYGIENFRYFLLREVPFGADGDFSEKALIDRINNDLGNDLGNLLNRIIGMAYKYFDGKVTSRDVEKYFSSELNEAREIIKNLEE------TYLWKMQIHKFLEELWKVLSIGNKAIDTYKPWELMKNGETQKAAALIGLIANLLALTSINLHAVMPKTTQKIASSLGFEINPNSFNELMEGKLLDDFVIEKIPPLFPKIE 512
>gi|152990541|ref|YP_001356263.1| methionyl-tRNA synthetase [Nitratiruptor sp. SB155-2] >gi|151422402|dbj|BAF69906.1| methionyl-tRNA synthetase [Nitratiruptor sp. SB155-2] (632 aa)
Score = 852, Expect = 9.0e-89, Identities = 198/516 (38%), Positives = 294/516 (56%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSK---EALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           MKK YITTPIYY +  PHIGHA+TT+IAD   RY +  GY+TFF+TG DEHGQKIEE AK+    PQE  D+ +  F  LW    I Y  FIRTT   H   VQ+ F ++ +K  IY G ++G YC+SCE  + ++  + +E      C +   +++  EESYF K+ +++ K +  +  +   V P  + NE+           DLSI+R++F WGI++ +   +PKHV+YVWLDALLNY++ LGY    D     +W +       L+ K+I RFH +YWP  L  L L +P    +HGW      KMSKS GNV+DP    + YG + FRY+LL+E+   +D  FS+K LI+  N DL N++GNL NR IGM  KY D  +   SK    F+ +  ++++     + ++++++   + L  +  +++  N  I+   PW   KE    +    ++L+ N + +V   L PV+   ++   EAL  F ID S FD  F+   + LD   I    P++ +IE
  S:     1 MKKRYITTPIYYVNDVPHIGHAYTTIIADSAARYFRLNGYDTFFLTGTDEHGQKIEEAAKKRGKTPQEYADEISAKFKALWDEFEISYDKFIRTTNPEHIIGVQKAFEKMYEKGDIYKGEYEGHYCISCEAFFPESQLIDEEFCPD--CGKQTSIVK--EESYFFKLSKYQDKLLELYRTNDAFVLPKNKKNEVIR--FVESGLQDLSITRTSFDWGIKLPKSINDPKHVMYVWLDALLNYITALGY--GSDEKLMYYWPAD----FHLVGKDILRFHAVYWPAFLMSLDLPQPHHIATHGWWTRNGEKMSKSKGNVIDPKKVADAYGLENFRYFLLREVPFGQDGDFSQKALIDRINNDLGNDLGNLLNRIIGMSGKYFDFTVD--SKDVQKFHQKELQEIQSIIANLDSLVDEMKWNRYLEEIWKMLHIANKAIDTYAPWAKMKEGKADEAMALVALVSNILAKVALLLHPVMPKTTQKIAEALG-FTIDQSSFD-TFIHQSNLLDTFTIQKIPPLFPKIE 507
>gi|78356637|ref|YP_388086.1| methionyl-tRNA synthetase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219042|gb|ABB38391.1| methionyl-tRNA synthetase [Desulfovibrio desulfuricans G20] (642 aa)
Score = 851, Expect = 1.1e-88, Identities = 177/484 (36%), Positives = 275/484 (56%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDD---EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           M+ FYITTPIYY +  PH+GHA+TT++AD L R+   LG +TFF+TG DEHG KI + A++    PQE VD  +  F +LW  +GI Y  F+RTT E HK  VQ    ++     IY G + G YC  CE  YT+     KE ++ L C Q    ++ E   E++YF ++ +++ ++  ++ D P+ + P    NE+  S L++   +DL ISR  S  SWG+++  +  +V YVW DALLNY+S L +   D   F  FW      +  L++K+I + H ++WP ML+  G         HG+ +    KMSKSLGNV++P+     YG  AFRY+LL+E+    D+ FSE+ L+   N DLAN++GNLF+R + M  KY DG++P  +    ++  + E  +    D       + E++     L  + +L+   N +++   PW L K  +   L   L ++L  +++V   L PV+ + S+  L Q ++
  S:     1 MQPFYITTPIYYVNAKPHLGHAYTTIVADALRRFHTLLGKKTFFLTGTDEHGDKIVQAAEKNGCTPQEYVDSISATFRDLWPSMGITYDRFVRTTDESHKKCVQAVLQKVYDSGDIYFGEYGGHYCYGCERFYTE-----KELENGL-CPQHQ--VKPEYIAEKNYFFRMSKYQDWLRQYILDNPDFIRPERYRNEVL-SLLDSGALEDLCISRPKSRLSWGVELPFDTDYVCYVWFDALLNYVSALNW--PDGEEFTTFWPG----VQHLVAKDILKPHAVFWPTMLKAAGFEPYNNLNVHGYWLVRDTKMSKSLGNVIEPLEMAGRYGLSAFRYFLLREMHFGSDASFSEEALVARLNADLANDLGNLFSRVLSMTGKYFDGVVPSPA----AYTADDEDIINLAKDACRNYVRLFERVRFSNALESLWELVRALNKYVDSSAPWTLYKTGDTARLGTVLYVLLECMRKVAVNLWPVMPEASEAMLGQLHV 474
>gi|71894319|ref|YP_278427.1| methionyl-tRNA synthetase [Mycoplasma synoviae 53] >gi|71851107|gb|AAZ43716.1| methionyl-tRNA synthetase [Mycoplasma synoviae 53] (518 aa)
Score = 849, Expect = 2.1e-88, Identities = 205/517 (39%), Positives = 307/517 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH-PLIQKEEESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-----SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGM-INKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K FYITTPIYY SGN HIGH +TT +A V+  Y+K LG ET F+TG DEHG KI +KAKE NL   E V+  A  F  LW    I Y  FIRTT+E HK   Q+ FS   K ++IY   + GLY VS EE  TK+ A+  E + K Y    H  LI+  EESYF K+ +F  ++   F ++ N ++P    NE+ N+F+ N    DLS++R+N SW I IKE+  H +YVW+DAL NY+S LGY  + D      +F+ FW + ++++V L+ KEI RFH IYWPI L+ L L++PT  ++HGWI+   GKMSKS GNV+DP   +  + ++  +Y+L  ++ +  D VF EKLL+++ N ++ N+ GNL +RS+ M  N +   +  KYSK      +E E+++ +   +    ++   + K      +L ++ N FI+   PW LK  +N K+L+  L ++ N +  +  Y   V  + +KE  +   +  + FD++ + DFS  +         +Y R++ +
  S:     3 KNFYITTPIYYASGNLHIGHLYTTTLAWVIRNYQKLLGNETKFLTGSDEHGSKIAQKAKENNLSEIEFVNSVAAKFKELWNSYDINYDIFIRTTSENHKKTAQKIFSYFYKNNYIYKNNYTGLYSVSAEEFLTKSQAL--EKNGKYYHPVSHDELIEVSEESYFFKMSEFSPWLKKYFAENSNFLFPKKIENEILNNFIKN-GLQDLSVTRTNVSWAIPIKEDLNHTLYVWVDALSNYISALGYNPELDYDSQSEDFKNFWENPNSKVVHLIGKEIARFHMIYWPIFLKALNLKQPTNIVAHGWILANDGKMSKSKGNVVDPNELLLKFDKEQIKYFLASQIPMGNDGVFDEKLLVDSINANIINSYGNLISRSLKMYANSF--SVPLKYSKNTEKDFLEIEEKILKSKVDFKKHMDLYLVDKAFEVARELASDLNKFIDIKMPWTLK--DNLKELEKILIVLFNGIYALSCYYSIVFKNKTKEVAEVLKV--THFDLEKIDDFSKFNETIFPDKYILYSRLKKD 518
>gi|154149034|ref|YP_001406307.1| methionyl-tRNA synthetase [Campylobacter hominis ATCC BAA-381] >gi|153805043|gb|ABS52050.1| methionyl-tRNA synthetase [Campylobacter hominis ATCC BAA-381] (638 aa)
Score = 848, Expect = 2.3e-88, Identities = 203/518 (39%), Positives = 297/518 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALK--QFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           MKKF ITTPIYY +  PHIGHA+TT+I D L R+ +  GYETFF+TG DEHGQKIEE AK+    P+   D  +  F +LW    I Y HFIRTT EYH    Q  F  +     IY G ++G YCVSCE  + +   +  E     YC       Q  +EESYF ++ ++   +  + +D  N + P  + NE+  SF+ +    DLSI+R++F WGI++ E   +PKHV+YVWLDAL+NYLS LGY Q  +     FWN    + + ++ K+I RFH +YWP  L  LGL  P    +HGW   +  KMSKS+GNV++P    + YG + FRY+LL+E+   +D  FS+K +I+  N +LAN++GNL NR IGM  KY +  I   SK  L F  +   + K +       +E++   + L  +   +N  N  I + +PW + K   NEK L   ++L+ N + +V   L P +   +K+      F I+++ ++ K + +   LD     T +P++ ++E E
  S:     1 MKKF-ITTPIYYVNDIPHIGHAYTTIICDTLARFYRLQGYETFFLTGTDEHGQKIEEAAKKHGTSPKIYADAVSAKFRSLWDYFDISYDHFIRTTDEYHIKTAQNAFEIMFANGDIYKGEYEGYYCVSCESFFPETQLIDGE-----YCPDCGKKTQIIKEESYFFRLSKYTDRLLKWYEDEENCILPRGKKNEVI-SFVKS-GLKDLSITRTSFDWGIKLPEKLNDPKHVMYVWLDALINYLSALGYTQNGEK--MDFWN----DTIHIVGKDILRFHAVYWPAFLMSLGLPLPKHIAAHGWWTRDGKKMSKSIGNVVNPKEVADAYGLEQFRYFLLREVPFGQDGDFSQKAIISRINSELANDLGNLLNRIIGMSEKYSNFKIN--SKDVLKFYADEMNETKNYLKNAVENLEEVATSRYLEELFKALNLANSSITKYEPWKMIKNGENEKAL-ALVALVANILAKVAVLLSPAMPQTAKKIATALNFKINTAIYN-KIIVNGELLDFLAQKT-QPLFNKMEHE 507
>gi|46580460|ref|YP_011268.1| methionyl-tRNA synthetase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46449879|gb|AAS96528.1| methionyl-tRNA synthetase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (663 aa)
Score = 848, Expect = 2.9e-88, Identities = 172/485 (35%), Positives = 281/485 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP---KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID 1052
           M +FY+TTPIYY +  PH+GHA+TT++AD + R+++ LG +T+F+TG DEHG KI + A++  + P++ VD  +  F +LW  LG+EY  FIRTT   HK VVQ     +     IY G + G YC  CE  YT+     KE ++ L C Q    ++ E   E++YF ++ +++ ++    L +P+ + P    NE+  S L++   +DL ISR  S  +WGI++  +  +V YVW DALLNY+S LG+   D   F  +W      +  L++K+I + H ++WP ML+  GL        HG+ +    KMSKSLGNV+ P+  I+ YG +AFRY+LL+E+    D+ FSE+ L+   N DLAN++GNL++R + M  KY  G++P    Y++   +      +  + F      +  ++     L  + +L+   N +++   PW L K+ + K L   +  +L ++++V  +L PV+ + +   L Q  ++
  S:     1 MDRFYVTTPIYYVNAKPHLGHAYTTIVADSMRRFQRLLGKDTYFLTGTDEHGDKIVQAAEKAGVSPKDFVDGVSGQFRDLWPHLGVEYDQFIRTTDPEHKKVVQAFLQRVYDSGDIYFGEYGGHYCYGCERFYTE-----KELENGL-CPQHQ--VKPEYIAEKNYFFRMSKYQGWLKQHILDNPDFIRPERYRNEVL-SMLDSGALEDLCISRPKSRLTWGIELPFDTDYVCYVWFDALLNYVSALGW--PDGDRFANYWPG----VQHLVAKDILKPHAVFWPTMLKAAGLEPYNNLNVHGYWLVRDTKMSKSLGNVVSPLEMIDRYGLNAFRYFLLREMHFGSDASFSEEALVGRLNADLANDLGNLYSRVLSMTAKYFGGVVPAPGAYTEEDETLRALAAEAQRNF----CNLFGRVRFSNALESLWELVRALNKYVDSAAPWTLFKQGDTKRLGTVMYTLLESMRKVAVHLLPVMPEAATSMLAQLGLE 475
>gi|118725652|ref|ZP_01574290.1| methionyl-tRNA synthetase [Clostridium cellulolyticum H10] >gi|118664932|gb|EAV71556.1| methionyl-tRNA synthetase [Clostridium cellulolyticum H10] (654 aa)
Score = 847, Expect = 2.9e-88, Identities = 193/518 (37%), Positives = 292/518 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN--FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           K +Y+TT I Y S  PHIG+ F  ++AD   R+K+  GY+  F TG DEHGQKIE KAKE  + P+E VD +AK    +  L+   Y  FIRTT +YH+  VQ+ F +L ++  IY G ++G+YC  CE  +T +  V  +  D   C  + HP    +EE+YFLK+ ++  + I    + P  + P +R NE+ N+FL      DL +SR++F WGI +  + KHVVYVW+DAL NY++GLG+    +S+  F KFW +     + L+ K+I RFH IYWPIML  L +  P +   H W++   GKMSKS GNV+     ++ +G DA RYY+L ++    D V S +L+    N DLAN +GNL NR I M NKY  G++   +  +   N   E  LK   + +   ++KL +   LS +  L   CN +I++  PW L K+  +K  L+  L  ++  +      LE  + + +++ + Q N       D+K    + S   +    PE ++LR++ +D
  S:     4 KPYYLTTAIAYTSSKPHIGNTFEIVLADSFARFKRMQGYDVRFQTGTDEHGQKIELKAKEAGISPKEYVDGFAKEIQRICDLMNTSYDKFIRTTDDYHEKQVQKIFKKLYEQGDIYKGYYEGMYCTPCEAFFTSSQLVDGKCPD---CGRECHP---AKEEAYFLKLSKYADRLIQHINEHPEFIQPESRKNEMMNNFLLA-GLQDLCVSRTSFKWGIPVDFDDKHVVYVWIDALSNYITGLGFDADGNSDEMFNKFWPAD----LHLIGKDILRFHTIYWPIMLMALEVPLPKQVFGHPWLLMGNGKMSKSKGNVIYADELVDIFGVDAVRYYILHDMPFDNDGVISWELITERINSDLANVLGNLVNRVIAMTNKYFSGVVNNSNVREDIDNELIELTLKT-PETVVEKMDKLRVADALSEIFTLFKRCNKYIDETMPWILAKDEAKKARLETVLYNLVEGIVTGASLLEAFMPETAQKIVAQLNTTVRPLKDMKVFGQYKS-GTKVTENPEILFLRMDIKD 514
>gi|120602218|ref|YP_966618.1| methionyl-tRNA synthetase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120562447|gb|ABM28191.1| methionyl-tRNA synthetase [Desulfovibrio vulgaris subsp. vulgaris DP4] (663 aa)
Score = 846, Expect = 4.5e-88, Identities = 172/485 (35%), Positives = 281/485 (57%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP---KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID 1052
           M +FY+TTPIYY +  PH+GHA+TT++AD + R+++ LG +T+F+TG DEHG KI + A++  + P++ VD  +  F +LW  LG+EY  FIRTT   HK VVQ     +     IY G + G YC  CE  YT+     KE ++ L C Q    ++ E   E++YF ++ +++ ++    L +P+ + P    NE+  S L++   +DL ISR  S  +WGI++  +  +V YVW DALLNY+S LG+   D   F  +W      +  L++K+I + H ++WP ML+  GL        HG+ +    KMSKSLGNV+ P+  I+ YG +AFRY+LL+E+    D+ FSE+ L+   N DLAN++GNL++R + M  KY  G++P    Y++   +      +  + F      +  ++     L  + +L+   N +++   PW L K+ + K L   +  +L ++++V  +L PV+ + +   L Q  ++
  S:     1 MDRFYVTTPIYYVNAKPHLGHAYTTIVADSMRRFQRLLGKDTYFLTGTDEHGDKIVQAAEKAGVSPKDFVDGVSGQFRDLWPHLGVEYDQFIRTTDPEHKKVVQAFLQRVYDNGDIYFGEYGGHYCYGCERFYTE-----KELENGL-CPQHQ--VKPEYIAEKNYFFRMSKYQGWLKQHILDNPDFIRPERYRNEVL-SMLDSGALEDLCISRPKSRLTWGIELPFDTDYVCYVWFDALLNYVSALGW--PDGDRFANYWPG----VQHLVAKDILKPHAVFWPTMLKAAGLEPYNNLNVHGYWLVRDTKMSKSLGNVVSPLEMIDRYGLNAFRYFLLREMHFGSDASFSEEALVGRLNADLANDLGNLYSRVLSMTAKYFGGVVPAPGAYTEEDETLRALAVEAQRNF----CNLFGRVRFSNALESLWELVRALNKYVDSAAPWTLFKQGDTKRLGTVMYTLLESMRKVAVHLLPVMPEAATSMLAQLGLE 475
>gi|85859641|ref|YP_461843.1| methionyl-tRNA synthetase [Syntrophus aciditrophicus SB] >gi|85722732|gb|ABC77675.1| methionyl-tRNA synthetase / protein secretion chaperonin [Syntrophus aciditrophicus SB] (644 aa)
Score = 844, Expect = 8.3e-88, Identities = 188/483 (38%), Positives = 279/483 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYIS-HGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           K FYITTPIYY + +PHIGHA+TT++ADVL RY +  G+ TFF+TG DEHG KI E A++  + P+   D+ +  F NLW  L +   +FIRTT   H   VQ   S++ +   IY G ++G YCV CE  YT+   +    D K    Q+ P  +K E +YF K+ +++ ++ S +K +P+ + P    NE+  +FL  +  +DL ISR  S  +WGI +  +  +V YVW DAL+NY++GLGY   D  NF  FW         L++K+I + H IYWP ML+  G+ +P ++++ HG+   +Q KMSKSLGNV+ P+   + YG DAFRYYLL+E+    DS FSE+  +   N DLAN++GNL +R   M  KY  G +P  S    +       ++ Q   E+     +L   K L  + DLIN  N +I + +PW+L K+  N+  LD  +  +L  ++ V   + P +   S + +    I
  S:    13 KTFYITTPIYYVNASPHIGHAYTTIVADVLARYHRLSGHRTFFLTGTDEHGDKIAEAAEKNGISPKAYADRISSQFRNLWPELSVSNDYFIRTTDANHIATVQAILSKVYEAGDIYFGHYEGFYCVGCERFYTEKELI----DGKCPDHQMEPEFRK-ESNYFFKMSKYQDWLISHIKANPDFIRPERYRNEVL-AFL-REPLEDLCISRPKSRLAWGISLPFDANYVTYVWFDALINYITGLGY--PDGENFHTFWPVAQ----HLIAKDILKPHGIYWPTMLKAAGI-EPYRHLNVHGYWNVDQSKMSKSLGNVIRPLDLKDKYGLDAFRYYLLREMVFGLDSSFSEEGFVQRVNADLANDLGNLVSRVTAMAVKYCKGSVPAASSEADTILSSTAVRVIQ---EVEASFRELTFHKALMSIWDLINTANRYIVEKEPWNLAKDPANQGTLDDVIYSLLETLRIVSVLIAPFMPGSSVKIMTSLGI 483
>gi|75908935|ref|YP_323231.1| methionyl-tRNA synthetase [Anabaena variabilis ATCC 29413] >gi|75702660|gb|ABA22336.1| methionyl-tRNA synthetase [Anabaena variabilis ATCC 29413] (530 aa)
Score = 843, Expect = 9.0e-88, Identities = 194/525 (36%), Positives = 288/525 (54%)
  Q:   559 LKITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTII----EKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ------FNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIE 1083
           + + +K E  K F +TTP+YY +  PHIG A+TT+ AD + R++K LG +   ITG DEHGQKI+  A+ L   PQE  D+    F +LW+LL I+Y  F RTTA  HK +V E F+ + +   IY G  KG YCVSCEE         KE  + L   +    + KE     E++YF ++ +++  +  F K  P+ + P +R NE+ N    +    D SISR N  WG  +  + KH +YVW DALL Y++ L   Q +   ++   K+W       + L+ K+I RFH +YWP ML   GL  P +   HG++  +  KM KSLGN +DP+  +  YG DA RYY LKE+   +D  F+E   IN  N DLAN++GNL NR++ M+ KY       Y+    + +I  E  LK    ++   +    E L   +    V+ L+   N FI+   PW L K+  +++++  L  +L +V+   Y L PV+ + S    +Q      FN  +          +  L N Q++  P+PI+ RIE
  S:     1 MNLVNKSE--KTFALTTPLYYVNDVPHIGSAYTTMAADAVARFQKLLGRDVLLITGTDEHGQKIQRSAESLGKAPQEFCDEIVPSFMSLWQLLNIQYDRFSRTTAVRHKAIVDEFFARVWQAGDIYQGQQKGWYCVSCEE--------FKEERELLEGNRCPIHVNKEVEWRDEQNYFFRLSKYQTQLEEFYKSHPDFIQPESRRNEVLN--FVSQGLQDFSISRVNLDWGFPVPTDSKHTLYVWFDALLAYVTALLDPQDEPTLENALAKWWPIN----LHLIGKDILRFHAVYWPAMLLSAGLPLPDRVFGHGFLTKDGQKMGKSLGNTIDPVGLVQQYGSDAVRYYFLKEIEFGKDGDFNEVRFINVLNADLANDLGNLLNRTLNMVKKY----CANYALSITNEDIPAENTLKALGVDLGAKVKQAYEVLAFNQACGVVLSLVQASNKFIDDQAPWSLYKQGRQQEVETVLYTVLESVRLAAYLLSPVIPNISSSIYQQLGFGINFNEQTDITPFAIHAQWGLLSNKQQLGQPQPIFKRIE 525
>gi|187251862|ref|YP_001876344.1| methionyl-tRNA synthetase [Elusimicrobium minutum Pei191] >gi|186972022|gb|ACC99007.1| methionyl-tRNA synthetase [Elusimicrobium minutum Pei191] (500 aa)
Score = 843, Expect = 9.3e-88, Identities = 187/481 (38%), Positives = 277/481 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH--PLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLS--GLGYRQKDDSNFQK----------FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP---KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           KKFYITTPIYY +  PHIGH++TTL  D+++RYK+  G E  F+TG DEHG  IE+ A++  + P+   D+    +  LWK+L I+Y  FIRTT + H+  VQ+ F  L+ K  IYLG + G+YC SCE       A   E +       +H  PL + +EE+YF K+ +++  +  F + +P+ + P  R  E+ N         DLS++R+  +WGI +K NPKH +YVW DAL+NY S  GLG    +D  F K          F +   A+ V L+ KEI RFH + WP ML  LG+  P K  +HGW   E  KMSK+LGN++DP    + YG D  R++L +E+    D  FS    I  +N DLAN++GNL +R++ M  KY D  +P   +Y  P L      +K +++        + +L + K L  V  LI + N +I++ KPW L K +     +  + LI +A+++V  ++EP +     E  K+ 
  S:     3 KKFYITTPIYYVNAYPHIGHSYTTLACDIVSRYKRSRGEEVHFLTGTDEHGINIEKAAEKAGMSPKAWCDQVVDAYKELWKILDIKYDDFIRTTDKRHEETVQQIFEILIAKGDIYLGHYSGMYCNSCE-------AYMDETEAPEGICPIHKKPLTEVKEETYFFKLSKYQDALLKFYESNPSFLNPKFRSAEITN--FVKSGLKDLSVTRTKVAWGIPVKSNPKHTIYVWFDALINYASAAGLGLNICEDKEFFKEELKKVGLNSFEDVWPAD-VHLIGKEIARFHMVIWPAMLMALGIPTPKKVFAHGWWTVEGEKMSKTLGNIVDPKKVADEYGLDPLRFFLFREVPFGADGDFSMDSFIKRYNADLANDLGNLLSRTLNMAVKYGD--LPAEGEYKSPLLVKAANVDKAVEEH-------MSELALDKTLEAVWSLIGDMNRYIDETKPWALAKTDEAAAKNVIIDLI-HALRKVAVWVEPFMPATGAEMKKRL 481
>gi|47569887|ref|ZP_00240554.1| methionyl-tRNA synthetase [Bacillus cereus G9241] >gi|47553421|gb|EAL11805.1| methionyl-tRNA synthetase [Bacillus cereus G9241] (626 aa)
Score = 843, Expect = 9.7e-88, Identities = 184/488 (37%), Positives = 284/488 (58%)
  Q:   598 LTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-------QKINTPEPIYLRIESE 1085
           + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP +      F+       K    ++   +E +     LS +  L++  N +I++ +PW L K+ N+++ L   ++ +   +++    L P L     +   Q  +          T + SL          K+    PI+ R+E E
  S:     1 MARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVAFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTEEAH-----TSWESLSTIGCIPAGTKVEKGNPIFPRLEME 492
>gi|160893725|ref|ZP_02074509.1| hypothetical protein CLOL250_01279 [Clostridium sp. L2-50] >gi|156864710|gb|EDO58141.1| hypothetical protein CLOL250_01279 [Clostridium sp. L2-50] (678 aa)
Score = 843, Expect = 1.1e-87, Identities = 187/518 (36%), Positives = 296/518 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGY--RQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-----DNQKINTPEPIYLRIESED 1086
           K +YITT I Y SG PHIG+ +  ++AD + RYK+  GY+  F TG DEHGQKIE KA E    P+E VD+ +    ++W L+   Y  FIRTT   H+  VQ+ F +L  +  IY G + G YC  CE  +T +  V  +  D   C +  P+ + +EE+YF K+ +++ + +    ++P+ + P +R NE+ N+F+      DL +SR++F WGI +  + KHV+YVW+DAL NY++GLGY     +D  ++K+W +     + L+ K+I RFH IYWPIML  LG+  P +   H W+I   GKMSKS GNV+     +  +G DA R+++L E+  + D + S +L++   N +LAN +GNL NR+I M NKY  G++      +     E ++ LK        ++   ++KL +   +S +  L   CN +I++  PW L K+  ++D L+  L  ++ ++      LEP + D S + L Q N    K     VT+          N+   TPE ++ R++ ++
  S:     4 KPYYITTAIAYASGKPHIGNTYEIVLADSIARYKRFAGYDVRFQTGTDEHGQKIENKAFENMQTPKEFVDEISGEIKDIWDLMNTSYDKFIRTTDADHERQVQKIFRKLYDQGDIYKGEYVGKYCTPCESFFTDSQLVDGKCPD---CGR--PVQEAKEEAYFFKLSKYQDRLMKHIEQNPDFIQPESRKNEMINNFI-KPGLQDLCVSRTSFKWGIPVDFDDKHVIYVWIDALSNYITGLGYDVDGNNDELYKKYWPAD----LHLIGKDILRFHTIYWPIMLMALGVPLPKQIFGHPWLIQNDGKMSKSKGNVMYADDMVRLFGVDAVRFFVLHEMPFENDGIISWELVVERINSELANTLGNLVNRTISMSNKYFGGVVTNTGVTE-----EVDEDLKNVVLNCRIKVAECMDKLKVADAISEIFTLFKRCNKYIDETMPWALAKDETKQDRLNTVLYNLVESIVIGASLLEPYMPDTSVKILNQLNAAKRK-----VTELGRFGLYPSGNKVTETPEILFARLDVKE 514
>gi|15606482|ref|NP_213862.1| methionyl-tRNA synthetase alpha subunit [Aquifex aeolicus VF5] >gi|7388279|sp|O67298|SYM_AQUAE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|78101749|pdb|2CSX|A Chain A, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) >gi|78101750|pdb|2CSX|B Chain B, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) >gi|78101753|pdb|2CT8|A Chain A, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) And Methionyl- Adenylate Anologue >gi|78101754|pdb|2CT8|B Chain B, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) And Methionyl- Adenylate Anologue >gi|2983692|gb|AAC07256.1| methionyl-tRNA synthetase alpha subunit [Aquifex aeolicus VF5] (497 aa)
Score = 842, Expect = 1.3e-87, Identities = 183/481 (38%), Positives = 285/481 (59%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-----EEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSIS--RSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALK 1047
           +MKKFY+TTPIYY +  PH+GHA+TT+ AD + RY +   Y+ FF+TG DEHG KI++KA+EL + P+ELVD+ A+ F  LW+ L IEY+ FIRTT  YH   VQ+ F E  K+  IYLG ++G YCV CEE          +++ +L      P+ QK     +E SYF ++ +++ K +  + K+P  + P  R NE+  SF+      DLS++  RS   WGI +  +P+H +YVW DAL NY+S L      +   + +W +     + L+ K+I RFH +YWP  L  LG   P K  +HGW   E  KMSK+LGNV+DP   +  YG D  RY+LL+E+   +D  FS+K ++N  N +LAN +GNL++R + M +K+  G +        + + E+ K  ++        +EK+N  K +  ++   +  N ++++ +PW L KE  +++L   L  +++ +  + + L P+  +  KEAL+
  S:     3 LMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYEGWYCVGCEEF---------KSEAELAEDHTCPIHQKKCEYIKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEII-SFVKQ-GLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISAL------EDKVEIYWPAD----LHLVGKDILRFHTVYWPAFLMSLGYELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEVSG------ARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQ 464
>gi|186680640|ref|YP_001863836.1| methionyl-tRNA synthetase [Nostoc punctiforme PCC 73102] >gi|186463092|gb|ACC78893.1| methionyl-tRNA synthetase [Nostoc punctiforme PCC 73102] (534 aa)
Score = 841, Expect = 1.6e-87, Identities = 191/515 (37%), Positives = 287/515 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS---NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKY-RDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNID-----SSKFDIKFVTD-----FSSLDNQKINTPEPIYLRIE 1083
           K F +TTP+YY +  PHIG A+TT+ ADV+ R+ + LG++   ITG DEHGQKI+  A+ L   PQE  D+    F +LW+LL I+Y  F RTTA  H+ +V+E F  + +   IY G  +G YCVSCEE         KE  D L   +      KE     E++YF ++ +++  ++ F +  PN + P +R NE+  SF+N     D SISR N  WG  +  +PKH +YVW DALL Y++ L     + +     + +W       + L+ K+I RFH +YWP ML   GL  P +   HG++  +  KM KSLGN LDP+  +  YG DA RYY LKE+   +D  F+E   IN  N DLAN++GNL NR++ M+ KY  D  +P      +S     +    +  +++    ++L   +    ++ L    N FI++  PW L K+  ++ ++  L  +L +V+   Y L P++ + S +  +Q  F ID      S     F T       SS   Q++ T +P++ RIE
  S:     9 KTFALTTPLYYVNDVPHIGSAYTTIAADVVARFHRLLGHQVLLITGTDEHGQKIQRSAESLGKAPQEFCDEVVPSFISLWQLLDIKYDRFSRTTAPRHEAIVKEFFERVWESGDIYQGQQQGWYCVSCEE--------FKEERDLLEGHRCPIHTNKEVEWRDEQNYFFRLSKYQNKLTEFYQSKPNFIQPESRRNEVL-SFVNQ-GLQDFSISRVNLDWGFPVPVDPKHTLYVWFDALLGYVTALLEPDAEPTLANALETWWPIN----LHLIGKDILRFHAVYWPAMLLSAGLPLPERVFGHGFLTKDGQKMGKSLGNTLDPVSLVQRYGSDAVRYYFLKEIEFGKDGDFNEVRFINVLNADLANDLGNLLNRTLSMVKKYCVDNNVPSIGNEGISDENPLKTIGLRLGEQVKEAYKELAFSQACGAILSLAQASNKFIDEQAPWSLYKQGQQESVEKVLYAVLESVRLAAYLLSPIIPNISSDIYQQLGFGIDFNDQIQSSVTAPFATHATWGILSS--KQQLGTFQPVFKRIE 529
>gi|86606068|ref|YP_474831.1| methionyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab] >gi|86554610|gb|ABC99568.1| methionyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab] (516 aa)
Score = 841, Expect = 1.7e-87, Identities = 179/478 (37%), Positives = 270/478 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEND--DKLYCAQLHP---LIQKEEESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTII----EKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ 1048
           F ITTPIYY +  PHIG A+TTL AD + RY +  G +   +TG DEHGQKI+  A+E  L PQ+  D+ A  F  LW+LL I Y  FIRTT   HK +V+E F  +  +  I++G  +G YCV+CEE        + E++  +  +C  LHP   +  K+EE+YF ++ ++++ + + + + P  + P +R NE+ N         D SISR + SWGI    +P   +YVW DAL+NYLS     + +   ++  +++W +     V L+ K+I RFH IYWP ML   GL  P +   HG++  +  KM KSLGN LDP   +  YG DA RYY L E+ L +D  FSE   I   N DLAN++GNL NR++ M+ KY+    P Y  P  +  I  +  LK   + +   +    E+L+      + + L    N ++++  PW L K+   + +   L  +L +V+ V   L P++ + S + L+Q
  S:     6 FVITTPIYYVNAAPHIGSAYTTLAADAIARYHRLRGKDVLMVTGTDEHGQKIQRTAEERGLPPQQHCDEIAAQFAQLWQLLDIRYDRFIRTTDPRHKAIVREFFQRVWDRGDIFVGRQQGWYCVACEE-------FKDESELLEGGFCP-LHPNKKVEWKDEENYFFRLSRYQEKLEALYAEHPEFIQPESRRNEVIN--FVKQGLRDFSISRPSVSWGIPFPADPSQTLYVWFDALINYLSAAVDPEDEPTLENALRRYWPAD----VHLVGKDIVRFHAIYWPAMLMSAGLPLPRQIFGHGFLTKDGLKMGKSLGNTLDPFELVQRYGADAVRYYFLTEIELGKDGDFSEGRFIEVLNADLANDLGNLLNRTLNMLKKYQ----PDYRIP--AVEIPADHPLKTLAERLAPTVADAYERLDPSSAARKALSLAQASNKYLDEQAPWTLHKQGQSEQVAQILYAVLESVRWVAVALSPIIPNLSLKILQQ 476
>gi|17227729|ref|NP_484277.1| methionyl-tRNA synthetase [Nostoc sp. PCC 7120] >gi|25009375|sp|Q8Z068|SYM_ANASP Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|17135211|dbj|BAB77757.1| methionyl-tRNA synthetase [Nostoc sp. PCC 7120] (530 aa)
Score = 840, Expect = 2.2e-87, Identities = 189/525 (36%), Positives = 292/525 (55%)
  Q:   559 LKITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQ----KFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTII----EKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ------FNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIE 1083
           + + +K E  K F +TTP+YY +  PHIG A+TT+ AD + R++K LG +   ITG DEHGQKI+  A+ L   PQE  D+    F +LW+LL I+Y  F RTTA  HK +V E F+ + +   IY G  KG YCVSCEE + +   + + N   ++  +   +  ++E++YF ++ +++  +  F +  P+ + P +R NE+ N    +    D SISR N  WG  +  +PKH +YVW DALL Y++ L    +D+   +    K+W       + L+ K+I RFH +YWP ML   GL  P +   HG++  +  KM KSLGN +DP+  +  YG DA RYY LKE+   +D  F+E   I+  N DLAN++GNL NR++ M+ KY       Y+    + +I  E  LK    ++   +    E L   +    V+ L+   N FI+   PW L K+  +++++  L  +L +V+   Y L PV+ + S    +Q      FN  +          +  L N Q++  P+PI+ RIE
  S:     1 MNLVNKAE--KTFALTTPLYYVNDVPHIGSAYTTMAADAVARFQKLLGRDVLLITGTDEHGQKIQRSAESLGKAPQEFCDEIVPSFMSLWRLLNIQYDRFSRTTAVRHKAIVDEFFARVWEAGDIYQGQQKGWYCVSCEE-FKEERELLEGNRCPIHVNK--EVEWRDEQNYFFRLSKYQTQLEEFYQSHPDFIQPESRRNEVLN--FVSQGLQDFSISRVNLDWGFPVPNDPKHTLYVWFDALLAYVTAL-LDPEDEPTLENALGKWWPIN----LHLIGKDILRFHAVYWPAMLLSAGLPLPDRVFGHGFLTKDGQKMGKSLGNTVDPVGLVQQYGSDAVRYYFLKEIEFGKDGDFNEVRFIHVLNADLANDLGNLLNRTLNMVKKY----CANYALSITNEDIPAENTLKALGVDLGAKVKQAYEVLAFNQACGVVLSLVQASNKFIDDQAPWSLYKQERQQEVETVLYTVLESVRLAAYLLSPVIPNISSNIYQQLGFGINFNEQTDITPFAIHAQWGLLSNKQQLGQPQPIFKRIE 525
>gi|33303707|gb|AAP22261.1| methionyl-tRNA synthetase [Bacillus cereus] (418 aa)
Score = 839, Expect = 2.4e-87, Identities = 173/417 (41%), Positives = 262/417 (62%)
  Q:   585 HIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFIEQ 1001
           HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +     N+ EF++ L  F  +    +   +E +     L  +  L++  N +I++
  S:     1 HIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKE-----NVTEFDETLVAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDK 418
>gi|33303699|gb|AAP22257.1| methionyl-tRNA synthetase [Bacillus cereus] (416 aa)
Score = 838, Expect = 3.2e-87, Identities = 173/415 (41%), Positives = 257/415 (61%)
  Q:   585 HIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFI 999
           HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L++  N +I
  S:     1 HIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYI 416
>gi|33303709|gb|AAP22262.1| methionyl-tRNA synthetase [Bacillus cereus] (416 aa)
Score = 838, Expect = 3.3e-87, Identities = 173/415 (41%), Positives = 259/415 (62%)
  Q:   585 HIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE----ITTIIEKLNIQKILSRVIDLINECNFFI 999
           HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY  G IP + K  ++   EF++ L  F  +    +   +E +     L  +  L++  N +I
  S:     1 HIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFSGEIPAF-KANVT---EFDETLVAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYI 416
>gi|33303705|gb|AAP22260.1| methionyl-tRNA synthetase [Bacillus cereus] (411 aa)
Score = 837, Expect = 4.6e-87, Identities = 169/394 (42%), Positives = 251/394 (63%)
  Q:   585 HIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI-EFEKQLKQFDDEITTIIEK 978
           HIGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++ ++   +  F +D P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY   ++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +     N+ EF++ L  F  +    +E+
  S:     1 HIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKE-----NVTEFDETLVAFAQDTLKKVEE 391
>gi|167755124|ref|ZP_02427251.1| hypothetical protein CLORAM_00628 [Clostridium ramosum DSM 1402] >gi|167705174|gb|EDS19753.1| hypothetical protein CLORAM_00628 [Clostridium ramosum DSM 1402] (643 aa)
Score = 836, Expect = 6.2e-87, Identities = 187/518 (36%), Positives = 296/518 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYC-AQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSN--FQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI-----------IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD--NQKINTPEPIYLRIESED 1086
           K +Y+TT I Y SG PHIG+ +  ++AD + R+K++ GY  +F TG DEHGQKIE KAKE  + P++ VD+ A     +W L+   Y  F+RTT +YHK+ VQ+ F +L  +  IYLG ++G YC +CE  +T++  V  +  D   C  ++H     +EE+YF K+ ++  + I      P  + P++R NE+ N+FL      DL +SR++F+W I +  +PKHVVYVW+DAL NY++GLGY    +    +QK+W +     + L+ K+I RFH IYWPIML  L +  P +   H W++  + KMSKS GNV+     ++ +G DA RYY+L E+    D   +  LL+   N DLAN +GNL NR+I M NKY  GI+   + PK++         +  DDE+  I           +++      L  +  L+   N +I++  PW L K+  ++D L   L  ++ +++     L P +   + + L Q N D    D+  +  F +     +    PE ++ R++ ++
  S:     5 KDYYLTTAITYTSGKPHIGNTYEIILADAIARFKRQEGYNVYFQTGTDEHGQKIELKAKEAGIPPKQFVDEKAGEVKRIWDLMDTTYDRFMRTTDDYHKSQVQKIFKKLYDQGDIYLGHYEGKYCTACESFFTESQLVDGKCPD---CGGEVH---DAKEEAYFFKLSKYADRLIEHIETHPEFIQPVSRKNEMMNNFL-KPGLQDLCVSRTSFTWSIPVDFDPKHVVYVWIDALSNYITGLGYDVDGNHGELYQKYWPAD----LHLIGKDIVRFHTIYWPIMLMALDIPLPKQVFGHPWLLQGESKMSKSKGNVIYADDLVDIFGVDAVRYYVLHEIPYDNDGSITWDLLVERINSDLANVLGNLVNRTIAMSNKYFGGIV---NNPKVT---------EAVDDELIEIALAMPKKVIGKMDEFKSSDALDAIFTLLRRTNKYIDETMPWALAKDETKRDRLATVLYNLIESIRFAAIALIPYMPSTANKILDQINTDQR--DLLALDTFGTYKEGTKVAEKPEMLFARLDPKE 515
>gi|16331573|ref|NP_442301.1| methionyl-tRNA synthetase [Synechocystis sp. PCC 6803] >gi|2501033|sp|Q55729|SYM_SYNY3 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|1001640|dbj|BAA10371.1| methionyl-tRNA synthetase [Synechocystis sp. PCC 6803] (532 aa)
Score = 836, Expect = 6.6e-87, Identities = 182/513 (35%), Positives = 286/513 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL---YCAQLHPLIQKE---EESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQ----KFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ----FNIDSSKFDIKFVTDFSSLD-------NQKINTPEPIYLRIE 1083
           F +TTP+YY +  PH+G A+TT++AD L R+K+  GY+   ITG DEHGQKI+  A+   L PQ   D+    F  LW+ L I Y  F RTT   H  +V++ F  +  K  IYL   +G YCV+CEE         KE  D L   +C  LHP  + E   EE+YF ++ +++  +   + + P  + P +R NE+ N         D SISR N  WG  +  +P H +YVW DALL Y++ L   + ++ N      K+W       + L+ K+I RFH +YWP ML    L  P +   HG++  +  KM KSLGN +DP+  IN YG DAFRYY LKE+   +D  F+E+  +N  N DLAN++GNL NR++GM+ KY  G  P+     L+ +   +       +E+++  E+L+       +  L+   N +I+ + PW L K+ ++K+++  L  +L +++   Y L P++   S +  +Q    ++ D  +  ++   +F+          NQ +   +PI+ ++E
  S:     9 FSVTTPLYYVNDVPHLGSAYTTVVADTLARFKRLQGYDVLMITGTDEHGQKIQRTAEAQELDPQTHCDRTVVKFKELWRSLNILYDRFSRTTDPRHLAIVKDFFQRVWDKGDIYLAQQQGWYCVACEE--------FKEKRDLLEDNHCP-LHPNRKAEWRDEENYFFRLSRYQHPLEELYAQRPEFIQPSSRRNEVLNFVAQG--LQDFSISRVNLDWGFPLPNDPNHTIYVWFDALLGYVTAL-LDEDEEPNLTNALVKWWPIN----LHLIGKDILRFHAVYWPAMLMSAELAIPAQVFGHGFLTKDGQKMGKSLGNTVDPLDLINRYGEDAFRYYFLKEIEFGKDGDFNEQRFVNVLNADLANDLGNLLNRTLGMVKKYCQGQGPQVMATDLAPDNPLKALGSHLGEEVSSAYERLSFTDACEAIFTLVRAGNKYIDDMAPWKLFKQGSQKEVEDVLYSVLESIRLSAYLLSPIVPRLSTKIYQQLGFTWDFDQWRSPLEQAEEFNRHQSWGQLGANQNLPPAQPIFTKLE 527
>gi|158523214|ref|YP_001531084.1| methionyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] >gi|158512040|gb|ABW69007.1| methionyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] (640 aa)
Score = 833, Expect = 1.3e-86, Identities = 187/513 (36%), Positives = 280/513 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKL-SFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSS----LDNQKINTPEPIYLRIE 1083
           FYITTPIYY +  PH+GHA+TT++ADV  R+    G + FF+TG DEHG KI + A    + P+   D  + +F +LW  L I YSHFIRTT E HK VV    + + +   IY   ++GLYC  CE  YT+   V  +  D        P  + +E +YF K+ ++++++   + D P+ + P     E+  SFL  +  DDL ISR  S   WGI +  + ++V YVW DALLNY+S LGY   DD  +  FW +    +  L +K+I + H IYWPIML+  G+        HG+   E  KMSKSLGNV++P+   NTYG DAFRY+L +E+S   D+ FSE+ L+   N DLAN++GNLF+R + M  KY    +P      L   +I+     +         +   ++ + L+ V DLI+  N FI+   PW L K+  + D L   +  +L  ++ V   + PV+    K  +    +D    ++  + DF      + +  +  P  ++ R+E
  S:     5 FYITTPIYYVNAKPHLGHAYTTIMADVAARFHAMAGKKVFFLTGTDEHGDKIMKAAAARGVSPKAYADTISALFRDLWTELDIGYSHFIRTTDENHKQVVSRVLAAIYEAGDIYFSEYEGLYCFGCERFYTERELVNGKCPD-----HDTPPERIQEANYFFKMSKYQQWLIDHITDNPDFIRPEGYRTEIL-SFL-KEPLDDLCISRPTSRLDWGIPLPFDDRYVTYVWFDALLNYVSALGY--PDDDRYMTFWPA----VQHLTAKDIIKPHGIYWPIMLKAAGIPLYNHLNVHGFWQIESCKMSKSLGNVVNPLDMKNTYGTDAFRYFLCREMSFGLDAGFSEEALVQRINADLANDLGNLFSRVLAMTAKYFKNRVPAADDANLPPCDIDIGALARTTVAAYEAQMATFHMNRALAAVWDLISAMNRFIDYSAPWTLAKDPAKADALAAVIYTLLEGLRIVAGLVYPVMPGTGKTMMAHLGLDGPDSELFRLEDFKQWGRLVPDTVVAKPASLFPRVE 513
>gi|119512207|ref|ZP_01631297.1| methionine-tRNA ligase [Nodularia spumigena CCY9414] >gi|119463173|gb|EAW44120.1| methionine-tRNA ligase [Nodularia spumigena CCY9414] (533 aa)
Score = 831, Expect = 2.5e-86, Identities = 191/515 (37%), Positives = 286/515 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS---NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKY--RDGII-----PKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNID-SSKFDIKFVTDFSS-------LDNQKINTPEPIYLRIE 1083
           K+F +TTP+YY +  PH+G A+TT+ ADV+ R+ + LG+E   ITG DEHGQKI+  A+ L   PQE  D+    F  LW+LL I+Y  F RTTA  H+ +V+E F  + +K  IY G  KG YCVSCEE         KE  D L   +      KE     E++YF  + +++  +  F +  P+ + P +R NE+  SF++     D SISR N  WG ++  + +H +YVW DALL Y++ L     + +     + +W       + L+ K+I RFH +YWP ML   GL  P +   HG++  +  KM KSLGN LDPI  + +YG DA RYY LKE+   +D  F+E   IN  N DLAN++GNL NR++ M+ KY   DG+           P  +  +   +Q+KQ         + L   +     + L+  CN FI++  PW L K+  +++++  L  +L +V+   Y L PV+ + S     Q  F ID + +     +  F++          Q +  P P++ RIE
  S:     9 KRFALTTPLYYVNDVPHVGSAYTTIAADVVARFHRLLGHEVLLITGTDEHGQKIQRSAESLGKPPQEFCDQIVPSFIKLWQLLNIQYDRFSRTTASRHEAIVKEFFMRVWEKGDIYQGKQKGWYCVSCEE--------FKEERDLLEGKRCPIHTNKEVEWRDEQNYFFSLSKYQTQLEEFYQSRPDFIQPESRRNEVL-SFVSQ-GLQDFSISRVNLDWGFRVPVDSQHTLYVWFDALLAYVTALLEADAEPTLANALETWWPIN----LHLIGKDILRFHAVYWPAMLMSAGLPLPDQVFGHGFLTKDGQKMGKSLGNTLDPIGLVESYGSDAVRYYFLKEIEFGKDGDFNEVRFINVLNADLANDLGNLLNRTLNMVKKYCSNDGLTIGNEAINDENPLKAIGLGLGEQVKQ-------SYQALAFNQACEATLLLVRTCNKFIDEQAPWSLYKQGKQQEVETVLYAVLESVRLAAYLLSPVIPNISNAIYLQLGFGIDFNDQVKTSMLAPFATHAQWGLLSSEQSLGKPLPVFKRIE 528
>gi|91202480|emb|CAJ72119.1| strongly similar to methionyl-tRNA synthetase [Candidatus Kuenenia stuttgartiensis] (520 aa)
Score = 830, Expect = 2.9e-86, Identities = 184/483 (38%), Positives = 274/483 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK-EEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEK-DLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           + FY+TTPIYY +  PHIGH++TT+ ADVL RY++   Y+ FF+TG DEHGQKI++ A+  N  P + VD     F +LW+ L I    FIRTT E H   V++ F +L +   IYLG ++G YCV CE  +T+         D+  C +    ++K +E++YF ++ +++K  I  + K P  + P +R NE+     ++   +D+SISRS  +WGIQ+  +    +YVW+DALLNY++ LGY   D   FQK+W +     V ++ KEI  FH   WP +L  L +  P K  +HGW   E  K+SKSLGN +DP+  I  YG DA+RY++L+E+    D  FS   L N  N DL N++GNL  R++ MI KY D +IP+YS+         +  L + + E    ++ L   K L  + + +   N  IE+ KPW L K +  K  L   +S +  A+K +   + P + +   E  KQ  I
  S:     4 QSFYLTTPIYYVNDIPHIGHSYTTIAADVLARYRRLQQYDVFFLTGSDEHGQKIQKAAEACNKTPNDFVDMVVGKFKDLWENLNISNDDFIRTTDERHVKRVKKIFQKLFENGDIYLGEYEGRYCVPCESFWTET------QLDEGRCPECRRNVEKVKEKNYFFRLSKYQKPLIEHYDKHPEFIQPESRRNEILQRITSH--IEDISISRSAVTWGIQVPMDTTQTIYVWIDALLNYITALGY-DDDMELFQKYWPAN----VHIIGKEILWFHGAIWPAILMSLKIELPFKIFTHGWWTIEGQKISKSLGNAIDPLNIIQIYGTDAYRYFILREVPFGSDGNFSYTALTNRINSDLGNDLGNLLQRTLTMIEKYFDAVIPEYSEKDDVLKEISQNTLSKINKE----LDNLQFSKALEAIWEFVGSANKCIEEKKPWVLAKTSAYKPQLKNVISSLAKAIKDISIVIYPFMPNTCIEIQKQLGI 472
>gi|71083692|ref|YP_266412.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1062] >gi|71062805|gb|AAZ21808.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1062] (513 aa)
Score = 830, Expect = 3.4e-86, Identities = 196/517 (37%), Positives = 295/517 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE---ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQK-INTPEPIYLRIESE 1085
           K +YITTPIYYPS  PH+GHA+++++AD   R+K+  G+   F+TG DEHG KI+  A+   + PQ   D+ ++ F +L K L +  + FIRTT E HK  VQ  ++EL K D IYL  + G Y VS E  Y+      KEN  K+  +    +   EEESYF ++ +++ + +  + K+P+ + P +R NE+  SF+      DLSISR  FSWGI++  +  HV+YVWLDAL NYLS L Y   +D  F+KFW +     V L+ K+I RFH +YWP  L    +  P K   HGWI++   KMSKS GN+LDP+  I  YG D  RYYL+KE+S   D   S+  L +  N DLANN GNL  R      K    ++P  +K    FN E    L +F D    I T I+  NI   ++ ++  + E N +    +PW  KK++++  L+  +   L  ++++ + L P++    ++ALK FN++    +++ +     L + K IN  + ++ +IE +
  S:     3 KNYYITTPIYYPSARPHMGHAYSSIVADFFARFKRIDGFNVHFLTGTDEHGLKIQRAAERKKIDPQTFCDEISQTFRDLSKTLNLSNTDFIRTTEERHKKTVQHLWNELEKNDDIYLSKYSGWYSVSDEAYYSDEEISEKEN-VKIAISSGSSVEWIEEESYFFRLSKWQDELLKYYEKNPDFISPKSRKNEVI-SFVKG-GLKDLSISRKAFSWGIKVPNSQDHVIYVWLDALTNYLSALNYPDTNDELFKKFWPAS----VHLIGKDILRFHSVYWPAFLMAAKIPLPKKVYGHGWILSGDEKMSKSKGNILDPLDIIEIYGLDPLRYYLIKEVSFGNDGNISQDRLEDCINSDLANNYGNLCQRVTAFAEKNCSSLVPDNTK----FNDEDLVMLNKFTDNLDLIRTEIDNQNINYYINFIVSALFEANKYFNDQEPW--KKKDDKDRLNTIVYTSLEMIRKISFMLYPIIPSSIEKALKIFNLNIDAINLESIAKHDYLISGKPINKIDILFKKIEKK 511
>gi|158604929|gb|ABW74748.1| methionyl-tRNA synthetase [Campylobacter concisus 13826] (644 aa)
Score = 829, Expect = 3.7e-86, Identities = 190/517 (36%), Positives = 290/517 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNL-VYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +K YITTPIYY +  PHIGHA+TT+IAD L R+ +  G ET+F+TG DEHGQKIE+ A+     P+E  D+ +  F +LW    I Y HFIRTT E HK  VQ  F ++     IY G ++G YCVSCE  + +   +  E++    C ++  L++  EESYF K+ +++  +  + ++  L V P  + NE+  SF+      DLS++R++F WGI++ +   + KHV+YVWLDAL+NYL+ LGY +  D+    FW         ++ K+I RFH +YWP  L  LGL  P    +HGW   +  KMSKS GNV++P    N YG + FRY+LL+E+   +D  +S+K LI   N +L N +GNL +R +GM  KY D  I   SK  + F+     + K + DE    +E L   + L  +  ++   N  + + +PW L K     + +  ++L  N + +V   L P +     +      F+ID++ ++   + +   + N       P++ RIE E
  S:     3 EKAYITTPIYYVNDVPHIGHAYTTIIADTLARFNRLQGKETYFMTGTDEHGQKIEQAARARGKTPKEYADEISAKFRSLWDEFEISYDHFIRTTDEEHKQTVQNVFEKMQVNGDIYKGEYEGFYCVSCETFFNQRDLL--EDNRCPDCGRVTSLVK--EESYFFKLSKYEDALLKWYENDELCVIPKGKKNEVV-SFVKG-GLKDLSVTRTSFDWGIKLPKSANDDKHVMYVWLDALINYLTTLGYSR--DNARMDFW----PHTTHIVGKDILRFHAVYWPAFLMSLGLPLPKHVAAHGWWTIDGEKMSKSKGNVINPREVANAYGLENFRYFLLREVPFGQDGDYSQKALIERINSELGNGLGNLLSRIVGMSAKYSDYKID--SKDVIKFHKAELDEAKGYLDEAIKNLENLATNRYLEDLWKVVTLANAAVAKYEPWSLVKAGKSDEANALVALCANLLAKVAILLSPAMPKTCAKIADTLGFSIDTASYESLVLKN--EISNFTAKATGPLFPRIEKE 509
>gi|86609674|ref|YP_478436.1| methionyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558216|gb|ABD03173.1| methionyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)] (518 aa)
Score = 827, Expect = 6.6e-86, Identities = 179/479 (37%), Positives = 269/479 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ---KEEESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD-----SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTII----EKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           F ITTPIYY +  PHIG A+TTL+AD + RY +  G +   +TG DEHGQKI+  A+E  + PQ+  D+ A  F  LW+LL I Y  FIRTT   HK +V+E F  +  +  I++G  +G YCV+CEE   K+ A   E     +C  LHP  +   K+EE+YF ++ ++++ + + + + P  + P +R NE+ N         D SISR + SWGI    +P   +YVW DAL+NY+S       DD     +  +++W +     V L+ K+I RFH IYWP ML   GL  P +   HG++  +  KMSKSLGN +DP   +  YG DA RYY L E+ L +D  FSE   ++  N DLAN++GNL NR++ M+ KY+      Y  P  +  I  +  LK   + +   +    E+L+      + + L    N ++++  PW L K+   + +   L  +L +V+ V   L P++   S + L+Q 
  S:     6 FVITTPIYYVNAAPHIGSAYTTLVADAIARYHRLRGKDVLMVTGTDEHGQKIQRTAEERGIPPQQHCDEIAAQFAQLWQLLDIRYDRFIRTTNPRHKAIVREFFQRVWDQGDIFIGRQQGWYCVACEE--FKDEAELLEGG---FCP-LHPTKKVEWKDEENYFFRLSRYQEKLEALYAEHPEFIQPESRRNEVIN--FVKQGLRDFSISRPSVSWGIPFPADPGQTLYVWFDALINYISAA--LDPDDEPTLANALRRYWPAD----VHLVGKDIVRFHAIYWPAMLMSAGLPLPKQVFGHGFLTKDGLKMSKSLGNTVDPFELVQQYGADAVRYYFLTEIELGKDGDFSEGRFVDVLNADLANDLGNLLNRTLNMLRKYQS----DYRVP--AVGIPADHPLKTLAERLAPAVADAYERLDPSSAARKALSLAQASNKYLDEQAPWTLHKQGQNERVAQILYAVLESVRWVAVLLSPLIPALSLKILQQL 477
>gi|33303703|gb|AAP22259.1| methionyl-tRNA synthetase [Bacillus cereus] (410 aa)
Score = 825, Expect = 1.2e-85, Identities = 170/408 (41%), Positives = 253/408 (62%)
  Q:   586 IGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLIN 993
           IGHA+TT+  D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L++
  S:     1 IGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEQMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLVS 409
>gi|113475475|ref|YP_721536.1| methionyl-tRNA synthetase [Trichodesmium erythraeum IMS101] >gi|110166523|gb|ABG51063.1| methionyl-tRNA synthetase [Trichodesmium erythraeum IMS101] (530 aa)
Score = 825, Expect = 1.3e-85, Identities = 188/513 (36%), Positives = 291/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ------FN----IDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           F ITTP+YY +  PHIG A+TT+ AD L R+++  G     ITG DEHGQKI+  A+     P+E  D   + F++LW+ L I+Y  FIRTTA  H+ +V+E F  + +K+ IYL   KG YCVSCEE   +    R+  +DK      +  ++ ++E++YF ++ ++++ + +F +D    + P +R NE+  SF+N     D SISR N  W  ++  +  H +YVW DALL Y++ L     +   ++   K+W       + L+ K+I RFH +YWP ML    L  P +   HG++  +  KM KSL N LDP   I  YG DA RYY LKE+    D  F+E   IN  N DLAN++GNL NR++ M +KY +G IPK +  ++      +K      +++T     L+  ++   V+ L+   N +I++  PW L K+   + L   L  +L +V+ V Y L P++ + S    +Q      FN    I+SS+  +K V+  +   NQ +  P+PI+ RI+
  S:    11 FAITTPLYYVNDLPHIGSAYTTIAADTLARFQRLQGRSVLMITGTDEHGQKIQRTAENKGRNPKEHCDSVVRGFESLWEQLNIQYDRFIRTTAPNHEKIVKEFFQRVWEKEDIYLSQQKGWYCVSCEEFKEE----RELTEDKHCVIHTNQKVEWRDEQNYFFRLSRYQERLQAFYQDRQEFIQPQSRRNEVL-SFVNQG-LQDFSISRVNVDWAFKLPVDSSHTIYVWFDALLGYVTALLDPDSEPTLENALSKWWPIN----LHLIGKDILRFHAVYWPAMLMSADLPLPERVFGHGFLTKDGKKMGKSLNNTLDPFELIQKYGSDAVRYYFLKEIEFGVDGDFNENRFINVLNADLANDLGNLLNRTLKMAHKYFNGQIPKINVQEVEVTHPLKKIGMGLGEKVTQAYTSLDFSQVCEAVLILVRTGNKYIDETAPWSLYKQGQLEALTEVLYSVLESVRLVAYLLSPIIPNISNAIYQQLGFSNNFNDKSAINSSETFVKQVSWGALPGNQLLGQPQPIFQRID 528
>gi|163868324|ref|YP_001609533.1| methionyl-tRNA synthetase [Bartonella tribocorum CIP 105476] >gi|161017980|emb|CAK01538.1| metS [Bartonella tribocorum CIP 105476] (519 aa)
Score = 824, Expect = 1.6e-85, Identities = 174/516 (33%), Positives = 295/516 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR--IESED 1086
           +YITTPI+YP+G+PHIGHA++ + +DVL R+++  G + FF++G DEHG K+++ A  L++ PQ+L D+ + VF  +  +L      FIRTT E H    QE + ++ +   IYLG + G Y V  E  Y +       ++ +       P+   EEESYF ++ +++K +  +  K P+ + P+ R NE+  SF+ +    D+SISR++F+WG+ + ENPKHV+YVW+DAL NYLS + +  K +S  + FW +       ++ K+I RFH +YWP  L   G+  P    +HG+++    KMSKS+GNV+DP   I+ YG D  RY+LL+E+   +D  ++ + L+N  N DLAN++GNL  RS+ MI K  D  +PK +    +F ++ ++ L+Q    + T+ + ++   +   LS +   + + N +    +PW L+K + E+     L + +  ++R+   L P +   + + L    +      +  +      +   +  PEPI+ R  ++ ED
  S:     5 YYITTPIFYPNGHPHIGHAYSAIASDVLARFQRLNGKKVFFLSGTDEHGLKMQQTAAALDMTPQQLADRNSAVFQKMLAVLNCSNDDFIRTTEERHYQACQEIWKKMEENGDIYLGRYTGWYSVRQEAYYEEKDTEVGPDNIRREKELGSPVEWNEEESYFFRLSRYEKALLEYYEKHPDFIAPLERRNEII-SFIKS-GLKDISISRASFNWGVAVPENPKHVMYVWVDALTNYLSAIDFFNK-NSKKRNFWPAN----THIIGKDIIRFHAVYWPAFLMSAGIELPKNIFAHGFLLNRGAKMSKSVGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYNHESLVNRINADLANDLGNLAQRSLSMIAKNCDAKVPKPA----AFLVQDKQLLEQSLQVLETVHQAMSFHSMHLALSAIFSTVADANRYFANEQPWSLRKSDPER-FSTVLYITVEILRRIGIMLLPFIPQSAAKLLDSLAVAEDDRLLYHIAHAKIQEGLDLPPPEPIFPRYILKKED 514
>gi|170079299|ref|YP_001735937.1| methionyl-tRNA synthetase [Synechococcus sp. PCC 7002] >gi|169886968|gb|ACB00682.1| methionyl-tRNA synthetase [Synechococcus sp. PCC 7002] (530 aa)
Score = 823, Expect = 1.9e-85, Identities = 184/514 (35%), Positives = 274/514 (53%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL---YCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGL---GYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID---SSKFDIKFVTDFSS-------LDNQKINTPEPIYLRIE 1083
           +F +TTP+YY +  PHIG A+TT++AD + R+ +  G +  FITG DEHGQKI+  A+E  + PQ   D+    F +LW+   I+Y  F RTTA  H  +V E F  +     IYL   +G YCV+CEE         KE  D +   +CA +H   Q E   EE+YF ++ +++  + +   D P+ + P +R NE+ N         D SISR N  WG  +  +  H +YVW DALL Y++ L   G     ++  +K+W       + L+ K+I RFH +YWP ML    L  P K   HG++     KM KSLGN +DPI  +N YG DA RYY LKE+ L +D  F+E   +N  N DLAN++GNL NR++GM+ KY    IP      +  +   +   +   D      + LN      +V+ LI   N +I+   PW L K   +  ++  L  IL +V+   Y L PV+ + S +  +Q       +   D+  +  F+S          + +   +PI+ R+E
  S:     6 RFALTTPLYYVNDVPHIGSAYTTMVADAIARFHRLKGDDVLFITGTDEHGQKIQRTAQEKGVDPQVHCDEIIGSFKDLWQHYNIQYDRFSRTTAPNHAKIVAEFFQRVWDNGDIYLAQQQGWYCVACEE--------FKEEKDLIKDHHCA-IHTNKQAEWRDEENYFFRLSKYQAQLEALYSDNPDFIQPASRRNEVIN--FVKQGLQDFSISRVNLDWGFPVPTDENHTIYVWFDALLGYVTALLEDGEAATLENALKKWWPIN----LHLIGKDILRFHAVYWPAMLMSANLPLPDKVFGHGFLTKNGLKMGKSLGNTIDPIALVNQYGADALRYYFLKEVELGKDGDFNETRFVNVVNADLANDLGNLLNRTLGMLKKYCKSEIPNLDLGTIPVDHPLKALGETLGDRTCAAYDNLNFTAACQQVLALIQASNKYIDDRAPWALFKAGEQAQVEEILLTILESVRLAAYLLSPVIPNLSNQIYRQLGFPGDFNRPEDLVNLAPFASHSRWGLPWSERTLTKAQPIFARLE 524
>gi|49474218|ref|YP_032260.1| methionyl-tRNA synthetase [Bartonella quintana str. Toulouse] >gi|49239722|emb|CAF26101.1| Methionyl-tRNA synthetase [Bartonella quintana str. Toulouse] (519 aa)
Score = 822, Expect = 2.3e-85, Identities = 174/511 (34%), Positives = 288/511 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR 1081
           +YITTPI+YP+  PHIGHA++ + +D L R+++  G   FF++G DEHG K+++ A  L + P++L D+ + VF  +   L      FIRTT E H    QE + ++     IYLG +KG Y V  E  Y +      E++ +       P+   EEESYF ++ +++K  +  + K P+ + P+ R NE+  SF+ +    D+SISR++F WGI +  NPKHV+YVW+DAL NYLS +G+    +S  + FW +     + ++ K+I RFH +YWP  L   G+  P +  +HG+++    KMSKS+GNV+DP   I+ YG D  RY+LL+E+   +D  +    ++N  N DLAN++GNL  RS+ MI K  D  +P+ +    +F I+ E+ LKQ    +    + ++ Q++   LS +  ++ + N +    +PW+L+K N E+     L + +  ++R+   L P +   + + L    I  +   +  ++     +   +  PEPI+ R
  S:     5 YYITTPIFYPNSTPHIGHAYSAIASDALARFQRLDGKNVFFLSGTDEHGLKMQQTATALGMTPKQLADRNSAVFKKMLAALNCSNDDFIRTTEERHYQACQEIWKKMQADGDIYLGCYKGWYSVRQEAYYEEKETEVGEDNIRREKELGSPVEWNEEESYFFRLSRYEKALLEHYEKHPDFIAPLERYNEVI-SFVKS-GLKDISISRASFHWGICVPGNPKHVMYVWVDALTNYLSAIGFFD-GNSKKRDFWPAN----IHIIGKDIIRFHAVYWPAFLMSAGIALPKRVFAHGFLLNRGAKMSKSIGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYGHDNVVNRINADLANDLGNLALRSLSMIAKNCDAKVPRPA----AFLIQDEQLLKQSLQALDITRQAMSSQEMHLALSAIFSVVADANRYFANEQPWNLRKNNPER-FSTVLYITVEILRRIGIMLLPFMPQSAAKLLDSLAISENDRLLYHISHSKIQEGLDLPPPEPIFPR 507
>gi|91763268|ref|ZP_01265232.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1002] >gi|91717681|gb|EAS84332.1| methionyl-tRNA synthetase [Candidatus Pelagibacter ubique HTCC1002] (513 aa)
Score = 822, Expect = 2.3e-85, Identities = 196/517 (37%), Positives = 295/517 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDE---ITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF--NIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           K +YITTPIYYPS  PH+GHA+++++AD   R+K+  G+   F+TG DEHG KI+  A+   + PQ   D+ ++ F +L K L +  + FIRTT E HK  VQ  ++EL K D IYL  + G Y VS E  Y+    + KEN  K+  +    +   EEESYF ++ +++ + +  + K+P+ + P +R NE+  SF+      DLSISR  FSWGI++  +  HV+YVWLDAL NY+S L Y   +D  F+KFW +     V L+ K+I RFH +YWP  L    +  P K   HGWI++   KMSKS GN+LDP+  I  YG D  RYYL+KE+S   D   S+  L +  N DLANN GNL  R      K    ++P      + FN E    L +F D    I T I+  NI   ++ ++  + E N +    +PW  KK++++  L+  +   L  ++++ + L P++    ++ALK F  NID+  F+     D+  +  + IN  + ++ +IE +
  S:     3 KNYYITTPIYYPSARPHMGHAYSSIVADFFARFKRIDGFNVHFLTGTDEHGLKIQRAAERKKIDPQTFCDEISQTFRDLSKTLNLSNTDFIRTTEERHKKTVQHLWNELEKNDDIYLSKYSGWYSVSDEAYYSDEEIIEKEN-VKIAISSGSSVEWIEEESYFFRLSKWQDELLKYYEKNPDFISPKSRKNEVI-SFVKG-GLKDLSISRKAFSWGIKVPNSQDHVIYVWLDALTNYISALNYPDTNDELFKKFWPAS----VHLIGKDILRFHSVYWPAFLMAAKIPLPKKVYGHGWILSGDEKMSKSKGNILDPLDIIEIYGLDPLRYYLIKEVSFGNDGNISQDRLEDCINSDLANNYGNLCQRVTAFAEKNCSSLVPD----NIKFNDEDLVMLNKFTDNLDIIRTEIDNQNINYYINFIVSSLFEANKYFNDQEPW--KKKDDKNRLNTIVYTSLEMIRKISFMLYPIIPSSIEKALKIFDLNIDAINFESIAKHDY-LISGKPINKIDIMFKKIEKK 511
>gi|111022628|ref|YP_705600.1| methionyl-tRNA synthetase [Rhodococcus sp. RHA1] >gi|110822158|gb|ABG97442.1| methionine--tRNA ligase [Rhodococcus sp. RHA1] (519 aa)
Score = 822, Expect = 2.6e-85, Identities = 169/496 (34%), Positives = 283/496 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSS 1066
           FY+TT I YP+G PHIGHA+  + +D L R+K+  G++ +F+TG DEHG K+++ A +  +  +EL  + + VF+ + K L I +  FIRTT   H+   +  +  +L    IYL  + G Y V  E  YT+     +++  +L      P+   EE +YF K+ +++ K +  + ++P+ + P TR NE+  SF+      DLSISR+ F WG+ + ++P+HV+YVW+DAL NYL+G GY   D   F KFW +     + ++ K+ITRFH +YWP  L   G+  P +   HG++  +  KMSKS+GNV+DP+  +  YG DA R++LL+E+S  +D  +S + ++   N DLAN +GNL  RS+ M+ K  D  +P   +       +    L Q D  +  +  + ++Q +   L  +  ++ E N +  + +PW L+K + E+ +   L + L  V+ V   ++PV+ D +++ L   ++   K D +  +D S+
  S:    13 FYLTTAIAYPNGVPHIGHAYEYISSDALARFKRLDGFDVYFMTGTDEHGLKMQQTAAKEGIDVRELAARNSDVFEAMDKTLNISFDRFIRTTDADHEEASKAIWRRMLDNGDIYLDTYSGWYSVRDEAFYTEAETTLQDDGSRLSTETGTPVEWTEESTYFFKLSEYQDKLLRLYEENPDFIAPATRRNEIV-SFVKG-GLKDLSISRTTFDWGVPVPDHPEHVMYVWVDALTNYLTGAGYPDTDSEQFGKFWPAN----LHIIGKDITRFHTVYWPAFLMSAGIELPKRVFVHGFLYNKGEKMSKSVGNVVDPVAMVEQYGLDAVRFFLLREISYGQDGSYSHEAIVTRINADLANELGNLAQRSLSMVAKNCDAQVPTPGE----LTEDDTAMLAQADALLGRVRAEYDVQALHLALEAIWSVLGETNRYFSKQEPWVLRKTDPER-MATVLYVTLEVVRIVGILVQPVMPDAAEKIL---DLLGQKADARQFSDLST 498
>gi|116747604|ref|YP_844291.1| methionyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] >gi|116696668|gb|ABK15856.1| methionyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] (636 aa)
Score = 821, Expect = 3.8e-85, Identities = 177/496 (35%), Positives = 278/496 (56%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQ-LMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEF----EKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTD 1063
           M +FYITTPIYY +  PHIGHA+TT++ADV+ R+ K +G+ TFF+TG DEHG KI + A +    P+E  D+ + +F   W  L I   HFIRTT   H  VVQ    ++     I    ++GLYCV CE  YT+    R+  D K       P I++EE +YF ++ +++ ++   ++ +P+ + P    NE+  +FL  +  +DL ISR     +WGI +  + ++V YVW DAL+NY+S LGY   D   F +FW      +VQ  ++K+I + H IYWP +++  G         HG+    +GKMSKS G V+ P+  I  YG DAFRY+LL+E+    D+ FSE  L+   N DLAN++GNLF+R++ M  KY DG +P +       + +     E+ + +F +E+          K L  + + +N  N +I+ V PW L K+ +    L+  + ++L   K +   + P +   S++ L++  +     D++   D
  S:     1 MNRFYITTPIYYVNAEPHIGHAYTTIVADVMNRFHKLMGFGTFFLTGTDEHGDKIVQAAADAGTAPKEYADRISGMFKEAWSKLNISNDHFIRTTDPEHIRVVQHILQQVYDSGDITFSTYRGLYCVGCERFYTE----RELVDGKCPDHDKEP-IEREEANYFFRMSKYQNWLIEHIESNPDFIRPERYRNEVL-AFL-REPLEDLCISRPKERLAWGITLPFDERYVTYVWFDALINYVSALGY--PDGPLFGEFW-----PVVQHTIAKDILKPHGIYWPTIIKAAGFPVYRHLNVHGYWKINEGKMSKSRGTVVRPLDMIPLYGLDAFRYFLLREMVFGLDANFSEDALVQRLNSDLANDLGNLFSRTLAMTLKYFDGKVPPFGSEPDDMDRDLISRVERTVAEFREELPVFC----FHKALMSIWECLNAANKYIDTVGPWGLAKDPSRHGRLETVIRILLELNKTMAVLISPFMPSTSEKMLERLGVVKRSIDLRLAED 487
>gi|190570583|ref|YP_001974941.1| methionyl-tRNA synthetase [Wolbachia pipientis] >gi|190356855|emb|CAQ54226.1| methionyl-tRNA synthetase [Wolbachia pipientis] (509 aa)
Score = 820, Expect = 4.5e-85, Identities = 186/518 (35%), Positives = 295/518 (56%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           E  + FYITTPIYY +  PHIGHA+T+LI DV  R+ K  G    F TG DEHGQKIE+ AK   ++P+E  D+ +  F  L +L+  +Y  FIRTT E H+  V   ++ L ++  IYL  + G Y V  E  Y ++  +            +      +EESYF ++  ++ K +  +   PN ++P +R NE+  SF+ +    DLSISR++F+WGI++ EN KHV+YVW+DAL NYL+ +G+   +D  ++KFW   ++  V ++ K+I RFH +YWP +L    L  P +   HGW + E  K+SKSLGNV+DPI     +G D  RY+LL+E S  +D  FS+K +I+  N +LANN+GNL  R+I  ++K   G++P   +  L  + E     K   D++   + K    +I+  +I++ ++ N +I++  PW L K + E+ +D  +  +L  ++ +   L+P++   +K  L Q  I   + D+K + +        +  P PI+LR +
  S:     2 EQFESFYITTPIYYVNDKPHIGHAYTSLICDVAARFMKLAGKNVKFTTGTDEHGQKIEKAAKTKGIEPKEFTDEISVTFRKLAELMNFDYDDFIRTTEERHEKAVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELIYGRAPTGAEVQWI------KEESYFFRLSSWQNKLLELYENQPNFIFPESRKNEVV-SFVKS-GLTDLSISRTSFNWGIKVPENDKHVIYVWIDALTNYLTSIGFPNIEDEEYKKFWT--NSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPINLAEEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCFGVVPVVDRNLLK-DDESLPNCKAIIDQVMDHLSKYEFNQIILLIINISSKANAYIDKSAPWTLSKTDRER-MDLVIYKLLEYIRMIGILLQPIVPKSAKMILDQLQIPKEQRDLKSLCNACVSLGITLPKPTPIFLRFD 508
>gi|196239494|ref|ZP_03138266.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 7425] >gi|196216308|gb|EDY10955.1| methionyl-tRNA synthetase [Cyanothece sp. PCC 7425] (531 aa)
Score = 819, Expect = 6.1e-85, Identities = 182/514 (35%), Positives = 281/514 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQ-KEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGL---GYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-------------DNQKINTPEPIYLRI 1082
           K F +TTP+YY +  PH+G A+TT+ ADV+ R+ +  G     ITG DEHGQKI+  A+ L   PQE  D+    F  LW+ L I Y  F RTT   H  +VQE F  L ++  IYLG  +G YCV CEE + +   + K++    YC   +H   + ++E++YF ++  ++  +  +  K P  + P +R NE+  SF+      D SISR N  WG  +  +P+H +YVW DALL Y++ L   G     D   Q++W       + L+ K+I RFH I WP ML   GL  P +   HG++  +  KM KSLGN LDP+  ++ +G +A RYY +KE+    D  FSE   IN  N DLA+++GNL NR++ M  KY  G IP  +   L  +   +   +   + +     +L+  +     ++L+ + N F+++  PW L K+   + ++  L  +L +V+   Y L P++   + E   Q   D S F+ +   D+S+L             D Q +  P+PI+ +I
  S:     7 KTFALTTPLYYVNDLPHMGSAYTTIAADVIARFYRLQGEAVLLITGTDEHGQKIQRTAERLGRTPQEHCDQVVNGFVELWQKLNITYDRFSRTTDPRHAVIVQEFFHRLWERGDIYLGQQQGWYCVDCEE-FKEERELLKDH----YCPIHIHRQAEWRDEQNYFFRLSHYQDILLDYYNKHPEFIQPESRRNEVL-SFVERG-LKDFSISRVNMDWGFPVPVDPRHTLYVWFDALLGYVTALLEPGEEPGLDRALQQWWPIN----LHLIGKDILRFHTISWPAMLLSAGLPLPDRVFVHGFLTKDGQKMGKSLGNTLDPVDLVDRFGAEAVRYYFIKEIEFGRDGDFSEPRFINILNADLADDLGNLLNRTLKMAFKYCQGQIPTGTADSLPADHPLQALGQSVGERVAQSYAELDFTQACEIALELVRKGNKFVDEQAPWSLYKQGQYQQVNQILYSVLESVRLAAYLLSPIIPAIATEIYYQLGFDDS-FNHQ---DYSTLPAYAAHARWGVLPDGQPLRQPQPIFQKI 524
>gi|94969057|ref|YP_591105.1| methionyl-tRNA synthetase [Acidobacteria bacterium Ellin345] >gi|94551107|gb|ABF41031.1| methionyl-tRNA synthetase [Acidobacteria bacterium Ellin345] (671 aa)
Score = 818, Expect = 8.2e-85, Identities = 175/486 (36%), Positives = 259/486 (53%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD--DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD---LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           KFYITTPIYY +  PHIGH +TT+  D + R K+ LG +TFF+TG DEHGQKIE  A       Q+ VD+ +  F  LW  +G+ Y  FIRTT   H   VQ     L  + +IY G + G YCV  +E Y   + V         C +  P     EE+YF K+   ++  +  +  DPN + P  R NE+  SF+      DLSISR+ F WGI + ++P HV+YVW+DAL NY++ LG+   D   + KFW +     V ++ KEI RFHC++WP +L   GL  P   ++HGW++ E+ KMSKS GN++     ++  G DA RY+L++E+   +D  FS   L+  FN DLAN +GNL +R++ MI +Y  G +P  S        +           ++     ++    K L     L+   + +I + +PW L ++ +E+    L   L     A++ V     PV+ D + +   Q  +   K
  S:     5 KFYITTPIYYVNARPHIGHTYTTVACDAIARRKRMLGVDTFFLTGTDEHGQKIERSAMASGKSDQQFVDEVSAEFRGLWDRMGLSYDKFIRTTDPEHIRGVQALIKRLQDRGYIYKGKYSGQYCVY-DELY---VDVDTPGAPCPECGR--PTETVHEENYFFKLSAMEEPLLKLYASDPNFIRPEARRNEVI-SFVRG-GLKDLSISRTTFKWGIPVPDDPAHVIYVWIDALCNYITALGFGSDDTKLYDKFWPAD----VHMVGKEIVRFHCVFWPAVLMAAGLPLPKSIVAHGWLLFEESKMSKSRGNIVRTETILDVLGADALRYFLMREVVFGQDGSFSFDALVQRFNADLANGLGNLASRTLSMITRYFKGEVPYPSSAATRTAADDAIAKIAAKTIEDFGAAFDQYQFSKALEAAWGLVAAVDKYIVENEPWALAEKQDEQSRARLATVLYTAAEALRIVTALAYPVIPDSTAKIWSQLGLGDIK 484
>gi|163795498|ref|ZP_02189464.1| Methionyl-tRNA synthetase, class Ia [alpha proteobacterium BAL199] >gi|159179097|gb|EDP63630.1| Methionyl-tRNA synthetase, class Ia [alpha proteobacterium BAL199] (515 aa)
Score = 818, Expect = 8.6e-85, Identities = 172/519 (33%), Positives = 279/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKY-------SKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI--DSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           + +Y+TTPIYY +  PHIGHA+TTL  D L R+K+  GY+  F+TG DEHGQK+E  A    + PQ   D+ ++ F +L  ++      FIRTT   H   VQ  +  L +K  IYLG + G Y V  E  Y +        + +       P+   EE SYF  + ++++ + +F + +P+ + P +R NE+  SF+      DLS+SR++F WG+ + ++  H++YVWLDAL NY++  GY    D  + K W +     + ++ K+I RFH +YWP  L   GL  P +  +HGW   E  KMSKSLGN +DP   ++TYG D FRY++L+EL    D  FS + +IN  N +LAN++GNL  R + M+ K   G +P+             + +   E Q   +D +           K L  + D++   N ++++  PW L+K +  + +   L  ++  ++ V   L+P++    +  L Q  +  D+  FD +   D+  +    +  PE ++ R  +E++
  S:     3 RSYYVTTPIYYVNDKPHIGHAYTTLACDALARFKRLDGYDVMFLTGTDEHGQKVEAAADAAGVDPQSFTDRVSQNFRDLIGVMNCSTDDFIRTTEPRHVTAVQALWRRLKEKGHIYLGSYAGWYSVRDEAFYVETELTTVNGEKRAPSGA--PVEWVEEPSYFFDLSKWQEPLLAFYEANPDFIAPESRRNEVL-SFVRG-GLRDLSVSRTSFKWGVPVPDDDAHIMYVWLDALTNYITAAGY-PDTDGQYSKRWPAD----LHMVGKDILRFHAVYWPAFLMGAGLEVPKRVFAHGWWTVEGQKMSKSLGNAIDPAALVDTYGLDQFRYFMLRELPFGNDGDFSHRAMINRMNSELANDLGNLSQRVLSMVAKNCAGAVPQPGAFAAADEALLGAADALLESQRAAYDTQA--------FHKALDAIFDVVGRANRYVDEQAPWTLRKTDPAR-MATVLYTLVETIRHVAILLQPIVPGSCERMLDQLAVPADARDFD-RLTPDYRLVPGTPLPKPEGVFPRWVAEEE 512
>gi|150396508|ref|YP_001326975.1| methionyl-tRNA synthetase [Sinorhizobium medicae WSM419] >gi|150028023|gb|ABR60140.1| methionyl-tRNA synthetase [Sinorhizobium medicae WSM419] (516 aa)
Score = 817, Expect = 9.9e-85, Identities = 175/511 (34%), Positives = 280/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLN---IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + R+++  G E FF+TG DEHGQK+++ AK+  + PQEL  + +  F N+ +LL      FIRTT + H    Q  ++ + +   +Y   + G Y V  E  Y +N    +E D   Y  Q  P+   EEESYF ++  ++ + +  + ++P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  GY         KFW +     + ++ K+I RFH +YWP  L   GL  P +  +HG+++ +  KMSKSLGNV+DP   +  +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP           E +  L   D  I T  E++    I + L+  I +++E + +    +PW LKK +  + +   L +    V++V   L+P + D + + L    + + + D   + +   L     +  P+P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQTAKKEGISPQELAARNSAEFQNMARLLNASNDDFIRTTEKRHHEASQAIWTRMGEAGDLYKDSYAGWYSVRDEAYYQENETELRE-DGLRYGPQGTPVEWVEEESYFFRLSAYQDRLLKHYEENPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYVTATGYLTDPTGPRAKFWPAN----IHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGNLASRSLSMIVKNCDGQIPVCG----PLTDEDKAMLAAADSLIETAREEMGRQLIHRALAATIAIVSETDRYFAGQEPWALKKTDPNR-MATVLYVTAEVVRQVAILLQPFMPDSAGKLLDLVAVPADRRDFAHLGEGGRLVSGTPLEAPKPVFPR 510
>gi|157737467|ref|YP_001490150.1| methionyl-tRNA synthetase [Arcobacter butzleri RM4018] >gi|157699321|gb|ABV67481.1| methionyl-tRNA synthetase [Arcobacter butzleri RM4018] (650 aa)
Score = 817, Expect = 1.1e-84, Identities = 195/518 (37%), Positives = 292/518 (56%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN---PKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF--NIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           E  K  YITTPIYY +   HIGHA+TT+IAD+L RY +  G  TF +TG DEHGQKI + A+  N  P+E  D+ +  F  LW    I Y  FIRTT E HK  VQ+ F  + KK  IY G ++G YCV CE  + ++  V ++      C +   L++  EESYF ++ ++ +K +  + ++ + + P ++ NE+ N         DLSISR++FSWG+++ E+   PKHV+YVWLDALLNY++ LGY   DD N   FW +     + L+ K+I RFH IYWP  L  L L  P    +HGW   +  KMSKS GN+++P    + YG DAFRY++L+E+   +D  FS+K LI+  N DL N++GNL NR  GM  KY D  +      K  F+ +   ++ +  D +   I  + I + L  +  ++   N  I   +PW+L K+    +    ++LI N + +V   L+ V+ +  K   +    NI++  F+   + +   L +  I   E ++ RIE
  S:     3 ESCKNVYITTPIYYVNDVAHIGHAYTTIIADMLARYSRLTGSNTFLLTGTDEHGQKIAQSAEIRNKTPKEYADEISGKFRTLWDDFDITYDKFIRTTDEEHKIGVQKAFEIMYKKGDIYKGEYEGFYCVPCETFFPESQLVDEQFCPD--CGRATTLVK--EESYFFELSKYEEKLLKWYEENEDCILPRSKKNEIVN--FVKGGLKDLSISRTSFSWGVKLPESMNEPKHVMYVWLDALLNYITALGY-GTDDKNMN-FWPAN----IHLVGKDILRFHSIYWPAFLMSLDLPLPKHIAAHGWWTRDGEKMSKSKGNIVNPKEVADAYGLDAFRYFMLREVPFGQDGDFSQKALIDRINSDLGNDLGNLLNRISGMSGKYFDYKVSSVDVEK--FHKKELDEVNEILDGVQKYIYNMQINRYLEEIWKVLTIANKAINDYEPWNLIKDGKNAEAMALVALITNIMAKVALLLDSVMPEKIKLIAQSLGMNINTETFN-NLIINKELLADTVITKVEQLFPRIE 511
>gi|163760146|ref|ZP_02167229.1| methionyl-tRNA synthetase [Hoeflea phototrophica DFL-43] >gi|162282545|gb|EDQ32833.1| methionyl-tRNA synthetase [Hoeflea phototrophica DFL-43] (514 aa)
Score = 815, Expect = 1.9e-84, Identities = 181/513 (35%), Positives = 285/513 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK---YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           ++FYITTPI+YP+G PHIGHA+T +  DVL R+++  G + FF++G DEHGQK+++ A++  +KP  L DK + VF ++ + L      FIRTT E HK  VQE +  +     IYLG + G Y V  E  + +      E  D +    L  P+   EEESY+ ++  +  K +  F K+P  V P  R NE+  SF+ +    DLSISR+ F WG+ +  N KHV+YVW+DAL NY++  G+    D   +K WN   A  + ++ K+I RFH +YWP  L   GL  P K  +HG+++ +  KMSKS+GNV+DP   I+ YG D  RY+ ++E+   +D  +S + +    N DLAN +GNL +R + MINK  DG +P+    + P  +     +K ++    ++        I K L+ +ID++ + + +    +PW LKK +  + ++  L +    V+++   L P +   + + L      + K D   + +   L     I+ P PI+ R
  S:     4 ERFYITTPIFYPNGVPHIGHAYTAIATDVLARFQRLDGKDVFFLSGTDEHGQKMQQTAEQEGIKPIALADKNSAVFRDMLERLDCSNDDFIRTTEERHKASVQELWKRMEANGDIYLGKYGGWYSVRQEAYFDEGETTLGE--DGIRREPLGSPVEWVEEESYYFRLSAYGDKLLELFEKNPEFVAPAERRNEV-ASFVKS-GLKDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYITAAGF---PDETSEK-WNYWPA--IHMIGKDIVRFHAVYWPAFLMSAGLELPAKVFAHGFLLVKGEKMSKSIGNVVDPFALIDHYGLDQVRYFFMREVPFGQDGSYSPEAIATRINSDLANGIGNLTSRCLSMINKNCDGKVPECGVLTDPDKAMLETADKVIESARADMA----DFQIHKALTSIIDVVADGDRYFASQEPWALKKTDPAR-METVLYITAETVRQISILLLPFMPQSAGKLLDLVAAPADKRDFAALGETGRLAPGTPIDKPTPIFPR 507
>gi|162447002|ref|YP_001620134.1| methionyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] >gi|161985109|gb|ABX80758.1| methionyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] (516 aa)
Score = 814, Expect = 2.2e-84, Identities = 189/519 (36%), Positives = 307/519 (59%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQK-FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKY--SKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           KK+YI+T I Y S  PHIG+ +  ++AD + R+K+  GY+ +F TG DEHGQKIE  A+  NL+  + VD  +     +++L+ ++Y  FIRTT  YHK VVQ  F +LL++  IYLG ++G Y V+ E    K   V     D L  +   P +   E++YF K+ +++  I   +KD P+ + P  R NE+  SFL ++   DLS+SR++F WGI +K NP+HV+YVW+DAL NY++GLGY    +S+  K FW +     + L+ K+I RFH +YWP +L  LGL  P K   H W++ ++ KMSKS+GN L     +  +G DA RYY+L E+    D   + +L+I   N DLAN +GNL NR+IGM+NKY++G++ K   ++P   F+   + + +   D+++T++ +L +   +  ++ +    N +I+  +PW+L K    + L   L  ++  ++ +  +L+  + + + +  +Q NI++S  D   V  F     Q+I T + ++ R + E K
  S:     4 KKYYISTAIAYASAIPHIGNVYEIILADAIARFKRLEGYDVYFQTGTDEHGQKIENNARNQNLETSDYVDMISNEIKRIFELVNVKYDKFIRTTDTYHKEVVQNIFEKLLEQGDIYLGKYEGWYSVADEAFLNKADIV-----DGLAPSGDIP-VWMSEDTYFFKLSKYQDRIVKHIKDNPSFIEPENRRNEVLQSFL-SEKLPDLSVSRTSFKWGIPVKSNPEHVIYVWIDALSNYITGLGYNLDSNSDAMKDFWPAD----LHLIGKDIMRFHAVYWPALLLALGLPLPKKIFGHPWVLVDKNKMSKSVGNTLYTDNLVKHFGVDALRYYVLHEIPFAADGNITYELMIERNNSDLANTLGNLVNRTIGMVNKYQNGLVKKVIINEP---FDYSLKNKCEALLDKVSTLMNELRVGDAIEELMIVARAANKYIDLSEPWNLNKNGETEKLSHVLYSLVETIRFLAVFLQSYMPETALKIFEQLNIEASGLDS--VKTFGLYPEQQIGTAKVLFERFDLEKK 510
>gi|57241194|ref|ZP_00369141.1| methionyl-tRNA synthetase [Campylobacter lari RM2100] >gi|57018115|gb|EAL54890.1| methionyl-tRNA synthetase [Campylobacter lari RM2100] (629 aa)
Score = 814, Expect = 2.3e-84, Identities = 191/512 (37%), Positives = 286/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +   HIGHA+TT+IAD L R+ +  G +TFF+TG DEHGQKIE+ A   N  P+E  D+ +  F  LW    I Y +FIRTT E HK  VQ+ F ++  K  IY G ++G YCVSCE  +T+   +     ++ +C       Q  +EESYF K+ +++  I  + K+   + P  + NEL N         DLSI+R++F WGI++ +   + KHVVYVWLDAL+NY+S LG+   D++N   FW +     +  + K+I RFH +YWP  L  L L  P    +HGW   +  KMSKS GNV+ P    +T+G +AFRY+LL+E+    D  FS+K LI   N +L+N +GNL NR IGM  KY   II       L FN E   + K++ D     +E +   + L  +   ++  N  I + +PW+L K +  +  +  ++L  N + +V   L   + + + +  K  N + S  + + +   + L + K +  E ++ +IE
  S:     3 YITTPIYYVNDVAHIGHAYTTIIADTLARFYRLQGEKTFFLTGTDEHGQKIEQAASAKNFTPKEYADEISTKFKKLWDEFEISYDYFIRTTDENHKLSVQKAFKKMFDKGDIYKGTYEGFYCVSCESYFTQTQLI-----NECHCPDCGKKTQLLKEESYFFKLSKYQDQILKWYKEKEPILPKNKANELIN--FVESGLKDLSITRTSFEWGIKLPKELNDDKHVVYVWLDALMNYVSALGW-GNDEANMD-FWPAH----IHFVGKDILRFHAVYWPAFLMSLDLPLPKFIAAHGWWTKDGEKMSKSKGNVVAPKEVADTFGLEAFRYFLLREVPFGNDGDFSQKALIARINAELSNELGNLLNRIIGMSAKYSQNII-DCKDVNLYFNQEL-NECKEYLDNAINALENIQPNRYLEELFKALSLANLSISKYEPWNLIKNDQMQKANALVALCANILAKVAILLSAAMPNTALKIAKALNFEISNENYQKLILNNQLCDLKSSPCEALFPKIE 503
>gi|119487032|ref|ZP_01620904.1| methionine--tRNA ligase [Lyngbya sp. PCC 8106] >gi|119455961|gb|EAW37095.1| methionine--tRNA ligase [Lyngbya sp. PCC 8106] (534 aa)
Score = 812, Expect = 3.4e-84, Identities = 178/513 (34%), Positives = 283/513 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ---KEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNID-SSKFDIKFVTDFSSL-------DNQKINTPEPIYLRIE 1083
           F +TTP+YY +  PH+G A+TT+ AD + R+++  G     ITG DEHGQKIE  A+ LN  PQE  D+    F++LW  L I+Y  F RTT   H  +V+E F  +  ++ IYL   +G YCV+CEE         +E  D+ YC  +H   Q   ++E++YF ++ +++K + +  ++ P+ + P +R NE+ N    +    D SISR N  WG  +  +P   +YVW DALL Y++ L    ++   ++   K W       + L+ K+I RFH +YWP ML    +  P +   HG++  +  KM KSLGN LDP+  +  +G DA RYY LKE+   +D  F+    INT N DLAN++GNL NR++ M +KY +G IP  S   +  +   +         +    E+L   ++   +++L+   N +I++  PW L K+     ++  L  +L +V+   Y L P+  + S     Q  F+ID + K  I+    F++          Q +  P+P++LR+E
  S:    10 FTLTTPLYYVNDVPHVGSAYTTMAADAVARFQRLQGKSVLLITGTDEHGQKIERTAESLNRSPQEHCDQIVSSFESLWHKLDIQYDRFSRTTDSRHAAIVKEFFGRVWDQEDIYLSQQQGWYCVACEE-----FKEERELIDEKYCP-IHTNKQVEWRDEQNYFFRLSKYQKQLEALYQEQPDFIQPESRRNEVLN--FVSQGLQDFSISRLNVDWGFPVPVDPNQTIYVWFDALLGYVTALLDPDREATLENALSKGWPIS----LHLIGKDILRFHAVYWPAMLMSADIPLPGRIFGHGFLTKDGKKMGKSLGNTLDPVELVRQFGSDAVRYYFLKEIEFGQDGDFNLTRFINTVNADLANDLGNLLNRTLRMAHKYFEGRIPHVSGAVIPEDNPLKSYGVTLGQTVAQGYERLAFSEVCDAILNLVQAGNKYIDEQAPWALYKQEKLDLVESVLYSVLESVRLAAYLLSPITPNLSNGIYHQLGFSIDFNDKTAIETAATFATHALWGFLPPEQVLAEPQPVFLRLE 527
>gi|157826102|ref|YP_001493822.1| methionyl-tRNA synthetase [Rickettsia akari str. Hartford] >gi|157800060|gb|ABV75314.1| methionyl-tRNA synthetase [Rickettsia akari str. Hartford] (512 aa)
Score = 812, Expect = 3.6e-84, Identities = 181/515 (35%), Positives = 291/515 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIESE 1085
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G +  F+TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L  ++ I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++    +   D L      P+   +E SYF  + Q++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + S++ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  IN +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  RS   + K  +G +P  ++  +   + +   K   +F ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L+P +   + + L Q  I   +   K  + D++      I  P  I+ R E +
  S:     5 YYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRGLDVIFLTGTDEHGQKVEKAAINKNIDPQKFTDQTSESFRHLMAVMHISNDDFIRTTENRHKEAVAVFWQKLLDNGTIYEGFYEGWYAVRDEAFFDES----ELTSDGL-APTGAPVEWVKEPSYFFNLSQWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGY-PDEQSSYGKFWPAD----LHVVGKDILRFHTVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLINEFGIDQIRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRSTAFVYKNNEGKVPLLTQSVIDKIYELPILKTASKFAEQNILLMDKTEINKILDNIINLAEEANIYIDSEAPWNLKKTDPDKMLEVLYTL-LEVLRYIAIMLQPFIPSSANKMLNQLGISKEERLFKHLIRDYALRAGSNILEPTIIFPRFEGD 510
>gi|42520232|ref|NP_966147.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42409970|gb|AAS14081.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila melanogaster] (545 aa)
Score = 812, Expect = 3.6e-84, Identities = 186/522 (35%), Positives = 300/522 (57%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEI------------------------------VQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           E  + FYITTP+YY +  PHIGHA+T+L+ DV+ R+ K  G    F TG DEHGQKIE+ AK   ++P+E  D+ +  F  L K +  EY  FIRTT E HK  V   ++ L ++  IYL  + G Y V  E  Y ++  +    D K         I+  EESYF ++  +++ +    K+ P+ ++P +R NE+  SF+ +    DLSISR++F+WGI++  N KHV+YVW+DAL NYL+ +G+   +   +++FW   + +I                              V ++ K+I RFH +YWP +L    L  P +   HGW + E  K+SKSLGNV+DPI     +G D  RY+LL+E S  +D  FS+K +I+  N +LANN+GNL  R+I  ++K   GI+P   +  L    E     K   D++   + K     I+  +I++ +E N +I++  PW L K + E+ ++  +  +L  ++ +   L+P++   ++  L Q  I   + D+K + D        +  P P++LR++++++
  S:     2 EQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEKAAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELI----DGKAPTGAEVQWIK--EESYFFRLSNWQEKLLELYKNQPSFIFPESRRNEVI-SFVRS-GLIDLSISRTSFNWGIKVPGNGKHVIYVWIDALTNYLTSIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSAANLADNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQSLLKGE-ESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRER-MNLVIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKSLCDACVSSGITLPKPTPVFLRVDAKEE 544
>gi|68171729|ref|ZP_00545082.1| Methionyl-tRNA synthetase, class Ia [Ehrlichia chaffeensis str. Sapulpa] >gi|88657921|ref|YP_507787.1| methionyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas] >gi|67998851|gb|EAM85550.1| Methionyl-tRNA synthetase, class Ia [Ehrlichia chaffeensis str. Sapulpa] >gi|88599378|gb|ABD44847.1| methionyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas] (506 aa)
Score = 811, Expect = 4.5e-84, Identities = 188/515 (36%), Positives = 283/515 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF-----NIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRI 1082
           M   YITTPIYY +  PHIGH +TTLI+D++ R+ +  G+   FITG DEHGQKIE+ A+E N+   +  D  + VF  L  ++   Y  FIRTT   HK  V   +  L     IYLG + G Y V  E  Y +   V    D K         I  EE SYF ++  F++ + +F ++ P+ V P  R NE+  SF+ +    DLS+SR N  WGI++  + KHV+YVW+DAL NYL+ LG+  ++  ++Q +W S  + ++Q++ K+I RFH +YWP +L    L  P K ++HGW   E  K+SKSLGNV+ P   +  +G D  RY+L+KE+ +  D  F    LIN  N DLANN+GNL  R++ ++ K   GI+P  S   L    E     ++  +++   + + N+ +++  +  L +  N +I    PW L K ++ K ++  L  +L  +K +   L+PV+   S + L Q      N D S+F I          N  +  PEPI+ +I
  S:     1 MNNIYITTPIYYVNDVPHIGHVYTTLISDIIARFMRLDGHSVKFITGTDEHGQKIEKAAQERNMSLLDFTDNTSAVFRQLADVMNYSYDDFIRTTETRHKKTVVALWQRLCDNGAIYLGSYSGWYSVRDETFYQEKELV----DGKAPTGADVEWI--EEPSYFFRLSNFQERLLAFYEENPDFVIPKYRYNEVI-SFVKSG-LKDLSVSRQNVLWGIKVPNDDKHVIYVWVDALANYLTVLGFPDENHKDYQAYWASDSSSVLQVVGKDILRFHAVYWPAILMAAELPLPKKILAHGWWTNEGQKISKSLGNVIKPFDLVEEFGVDQLRYFLIKEMPIGNDGDFKRNSLINCINYDLANNIGNLVQRTVSLLYKECGGIVPTVSGNLLQGE-EVLPDYQEILEKVRDCVMRCNLNEMIHIIEQLSSAANEYIASRAPWRLSK-SDPKIMEAVLYKLLEYIKCIGLLLQPVMPKLSSKILDQIGLPECNRDFSRFSIPINM------NTVLPKPEPIFAKI 505
>gi|169335812|ref|ZP_02863005.1| hypothetical protein ANASTE_02238 [Anaerofustis stercorihominis DSM 17244] >gi|169258550|gb|EDS72516.1| hypothetical protein ANASTE_02238 [Anaerofustis stercorihominis DSM 17244] (651 aa)
Score = 811, Expect = 4.8e-84, Identities = 176/489 (35%), Positives = 288/489 (58%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQ--KDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIE-FEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFD 1057
           K +YI+T I Y SG PHIG+ +  ++AD + RYK+  GY+ +F TG DEHGQKIE KA E  + PQ+ VD  ++    +W ++   Y  F+RTT  YH+  VQ+ F +L ++  IY   ++G+YC  CE  +T++  +  +  D   C +   +  ++EE+YF K+ ++   +  +++  P  + P +R NE+ N+FL      DL +SR++F WGI +  +P HVVYVW+DAL NY++ LGY      + N+ K+W +     V L+ K+I RFH +YWPIML  L L  P +   H W++  +GKMSKS GNV+     ++ +G D+ RYYLL+E+   +D   + + LI+  N +L N +GNL NR+I M  KY D I+   S PK   +IE  + +L +  ++   ++E    +L +   ++ +I L    N +I++  PW L KE +++D L   L  +L +++ +   + P L +  +  +K  N  +S ++
  S:     4 KPYYISTAIAYTSGKPHIGNTYEIVLADSIARYKRLTGYDVYFQTGTDEHGQKIETKANEAGITPQKFVDNVSEEIHRIWDIMNTSYDKFVRTTDPYHEKKVQQIFKKLYEQGDIYKDEYEGMYCEPCESFFTESQLIDGKCPD---CGR--EVSYEKEEAYFFKLSKYADRLMEYIETHPEFIQPESRKNEMVNNFL-KPGLKDLCVSRTSFKWGIPVDFDPGHVVYVWIDALSNYITFLGYDPDGNHEENYNKYWPAD----VHLIGKDILRFHTLYWPIMLMALDLPLPKQIFGHPWLLLGEGKMSKSKGNVIYADDLVDLFGVDSVRYYLLREMPFAQDGTLTYEQLIDRINGELVNILGNLVNRTIAMSKKYFDSIV---SNPK---DIEDIDNELIELTEKTPLLVEEKMNELKVADAINLIIALARRSNKYIDETMPWVLAKEEDKQDRLRTVLYNLLESIRVIGVLITPFLPETGENIIKMLNTKNSSYE 485
>gi|157804069|ref|YP_001492618.1| methionyl-tRNA synthetase [Rickettsia canadensis str. McKiel] >gi|157785332|gb|ABV73833.1| methionyl-tRNA synthetase [Rickettsia canadensis str. McKiel] (510 aa)
Score = 811, Expect = 5.0e-84, Identities = 180/513 (35%), Positives = 288/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK----EEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++++DV+ R+ +  G+E   +TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  Y         ++ +L    L P        +E SYF  + +++ K +  +  +P+ + PI+R NE+ N         DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  DG +P  ++  +   + +   K   +  ++   ++EK  + KIL  +I+L  E N +I+   PW+LKK +++K L+   +L L  ++ +   L+P +   + + L Q  ++  +   K  V D++      I  P  I+ RIE
  S:     5 YYITTPIYYVNNVPHIGHAYTSVVSDVIARFMRLCGFEVILLTGTDEHGQKVEKAAINKNIDPQQFTDQISENFRHLMTSMHISNDDFIRTTENRHKEAVAVFWQKLLDNGTIYKGFYEGWYAVRDEAFY---------DESELTSDGLAPTGASVEWVKEPSYFFNLSKWQDKLLELYELNPDFIRPISRRNEVIN--FVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGY-PDEQSNYGKFWPAA----LHVVGKDILRFHAVYWPAFLMAAKIPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTAFVYKNNDGKVPLLTQSVIDKIYTLPILKAAIKCAEQNILLMEKTEVNKILENIINLAEEANIYIDNKAPWNLKKTDHDKMLEVLYAL-LEVLRYIAIMLQPFVPTSANKMLDQLGVNKKERLFKHLVRDYALTVGAAILEPTIIFPRIE 508
>gi|116671079|ref|YP_832012.1| methionyl-tRNA synthetase [Arthrobacter sp. FB24] >gi|116611188|gb|ABK03912.1| methionyl-tRNA synthetase [Arthrobacter sp. FB24] (519 aa)
Score = 810, Expect = 6.5e-84, Identities = 172/476 (36%), Positives = 264/476 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD---DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           FYITT I YP+G PHIGHA+  +  D + R+K+  GY+ FF+TG DEHG KI + A +  + P+ELVD+ A+++      LGI Y  FIRTT E H    Q  + ++     IYL  ++G Y V  E  Y ++  V KE+  +        L    EESYF ++  ++ K ++ +   P    P +R NE+  SF+     +DLSISR+ F WG+ +  N KHV+YVW+DAL NYL+G+GY   +  +F+K+W +     V ++ K+I+RFH IYWP  L   GL  P + + HG++     KMSKSLGNV+ P  F+  YG D  R++ L+E+    D  +S + ++   N DLANN GNL  RS+ M+ K  +G +P       +F  E    L+Q +   +      EK    + L  +  ++ + N +  +  PW L+K + E+ ++  L + L  ++ V   ++PV+   S   L
  S:     9 FYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVFFLTGTDEHGMKIAQTADKEGITPKELVDRNAEIYKAAHAALGISYDRFIRTTDEDHYAASQAIWKKMEANGDIYLSKYEGWYSVRDEAYYVEDETVVKEDGLRYSRETDTELTWTAEESYFFRLSAYQDKLLALYEAHPEFGAPQSRFNEVI-SFVKR-GLEDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYLTGVGYPDTESDSFKKYWPAD----VHVIGKDISRFHAIYWPAFLMSAGLELPKRIMIHGFLNNNGVKMSKSLGNVVAPSDFVAQYGLDQVRFFFLREVPFGADGSYSHEAIVGRMNSDLANNFGNLAQRSLSMVAKNCEGRVPVPG----AFTAEDSALLEQANGLLEAARAAFEKQEFSRALEAIWGVLGDTNAYFAEQAPWVLRKTDVER-MNTVLYVTLEVLRIVAILVQPVMPKASAALL 477
>gi|57237679|ref|YP_178927.1| methionyl-tRNA synthetase [Campylobacter jejuni RM1221] >gi|57166483|gb|AAW35262.1| methionyl-tRNA synthetase [Campylobacter jejuni RM1221] (628 aa)
Score = 810, Expect = 7.1e-84, Identities = 198/512 (38%), Positives = 287/512 (56%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY-CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   ND     C +   +++  EESYF K+ +++  I  + ++ + + P  + NEL N F+ N    DLSI+R++F WGI++ +   + KH+VYVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +  +  ++L  N + +    L P L    ++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDEFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKQTRILK--EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN-FVQN-GLKDLSITRTSFDWGIKLPQEINDDKHIVYVWLDALFIYVSSLDFQSKGENT--KFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNISKEGVLKF-YNAEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCQKVALALNFEISSTNYAKMILDNKLLDF-KANPCEALFPKVE 503
>gi|15792176|ref|NP_281999.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86150271|ref|ZP_01068498.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597490|ref|ZP_01100724.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|25009405|sp|Q9PP85|SYM_CAMJE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|85839387|gb|EAQ56649.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190082|gb|EAQ94057.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360172|emb|CAL34966.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] (628 aa)
Score = 810, Expect = 7.2e-84, Identities = 197/512 (38%), Positives = 287/512 (56%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY-CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   ++  F ++ +K  IY   ++G YC+SCE  +T++  +   ND     C +   +++  EESYF K+ +++  I  + ++ + + P  + NEL N F+ N    DLSI+R++F WGI++ +   + KH++YVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N E   Q K+  +     +E L   + L  +   ++  N  I + +PW L KEN  +  +  ++L  N + +    L P L   S++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDEFEITYDIYARTTDTRHIEFIKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKQTRILK--EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN-FVQN-GLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYVSSLDFQNKGEN--AKFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNISKEGVLKF-YNAEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWSLIKENKHEQANALVALCANILAKTSLLLSPTLPKSSQKVALALNFEISSANYTKMILDNELLDF-KANPCEALFPKVE 503
>gi|157827625|ref|YP_001496689.1| methionyl-tRNA synthetase [Rickettsia bellii OSU 85-389] >gi|157802929|gb|ABV79652.1| methionyl-tRNA synthetase [Rickettsia bellii OSU 85-389] (509 aa)
Score = 809, Expect = 8.9e-84, Identities = 182/513 (35%), Positives = 293/513 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK----EEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVT-DFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G+E  F+TG DEHGQK+E+ A + N+ PQ+  D+ ++ F +L   + I    FIRTT E HK  V   + +LL    IY G ++G Y V  E  Y         ++ +L   +L P        +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  + KHV+YVWLDAL NY+S LGY  + +SN+ KFW +     +Q++ K+I RFH IYWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I  +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  DG +P  ++  ++  + +   K       +   ++EK  I KIL  +I+L  E N +I+   PW+LKK + EK L+   +L L  ++ +   L+  +   + + L Q  +++ +   K ++ +F+      I  P  ++ R E
  S:     5 YYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAAIDKNIDPQKFTDQTSQSFRHLMTAMHISNDDFIRTTEERHKKAVAIFWQKLLDNGSIYEGFYEGWYAVRDEAFY---------DESELTADKLAPTGAAVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNDNKHVIYVWLDALANYISALGYPDQ-NSNYGKFWPAN----LQVVGKDILRFHAIYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIEEFGVDQVRYFLMREITFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDGKVPAITQDAINKIYELPLLKTAINSAKQNILLMEKTEINKILDNIINLAEEANIYIDSEAPWNLKKTDPEKMLEVLYAL-LETLRYIAVMLQAFMPSSAGKMLDQLGVNTEERLFKHLSLEFALTSASDILEPVIVFPRFE 508
>gi|54026880|ref|YP_121122.1| methionyl-tRNA synthetase [Nocardia farcinica IFM 10152] >gi|54018388|dbj|BAD59758.1| putative methionyl-tRNA synthetase [Nocardia farcinica IFM 10152] (518 aa)
Score = 807, Expect = 1.3e-83, Identities = 165/468 (35%), Positives = 262/468 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDL---DCFLSLILNAVKRVIYYLEPVL 1038
           FY+TT I YP+G PHIGHA+  + AD + R+K+  GY+ FF+TG DEHGQK+++ A    +  Q+L  + + VF+ L K L + Y  FIRTT   H+      +  +L    IYL  + G Y V  E  YT+      E+  ++      P+   EE ++F ++ +++ + ++ + + P  + P TR NE+ +         DLSISR+ F WG+ +  +P HV+YVW+DAL NYL+G+G+   D   F+KFW +     V ++ K+ITRFH +YWP  L   G+  P +   HG++  +  KMSKS+GNV+DP+  ++ YG DA R++LL+E+S  +D  +S   ++   N DLAN  GNL  RS+ M++K  D  +P           EF  + +   D    ++E+     + Q++   L  +   + E N +    +PW L+K   E DL      L + L  V+ V   ++PV+
  S:     8 FYVTTAIAYPNGAPHIGHAYEYISADAIARFKRLDGYDVFFMTGTDEHGQKMQQAAAAEGIPVQDLAARNSDVFERLDKALDVSYDRFIRTTDADHRAASVAIWERMLANGDIYLDNYAGWYSVRDEAFYTEEETTLLEDGSRISTETKTPVTWTEESNFFFRLSKYQDRLLAHYEEHPEFIAPATRRNEIVSYV--KAGLKDLSISRTTFDWGVPVPGHPDHVMYVWVDALTNYLTGVGFPDTDSPAFRKFWPAD----VHIIGKDITRFHTVYWPAFLMSAGVPLPKRVFVHGFLYNKGEKMSKSVGNVVDPLELVDEYGLDAVRFFLLREISYGQDGSYSHDAIVARINADLANEFGNLVQRSLTMVHKNCDAAVPTPG--------EFTAEDRALLDRAAGLLERCRAEFDAQQMHLALEAIWLTLGETNRYFSAQQPWALRKSGTEADLARMATVLYVTLEVVRIVAILVQPVM 472
>gi|121612346|ref|YP_001000523.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005457|ref|ZP_02271215.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|87249443|gb|EAQ72403.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81-176] (628 aa)
Score = 807, Expect = 1.4e-83, Identities = 191/512 (37%), Positives = 284/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY-CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   ND     C +   +++  EESYF K+ +++  I  + ++ + + P  + NEL N         DLSI+R++F WGI++ +   + KH++YVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N+E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +  +  ++L  N + +    L P L    ++     N + S  +   +   + L + K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDDFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKQTRILK--EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYISSLDFQSKGEN--AKFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPEFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNISKEGVLKF-YNVEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCQKVALALNFEISSTNYAKIILDNELLDFKANPCEALFPKVE 503
>gi|91205053|ref|YP_537408.1| methionyl-tRNA synthetase [Rickettsia bellii RML369-C] >gi|123388147|sp|Q1RJZ5|SYM_RICBR Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|91068597|gb|ABE04319.1| Methionyl-tRNA synthetase [Rickettsia bellii RML369-C] (509 aa)
Score = 807, Expect = 1.4e-83, Identities = 181/513 (35%), Positives = 293/513 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK----EEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVT-DFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G+E  F+TG DEHGQK+E+ A + N+ PQ+  D+ ++ F +L   + I    FIRTT E HK  V   + +LL    IY G ++G Y V  E  Y         ++ +L   +L P        +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  + KHV+YVWLDAL NY+S LGY  + +SN+ KFW +     +Q++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I  +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  DG +P  ++  ++  + +   K       +   ++EK  I KIL  +I+L  E N +I+   PW+LKK + EK L+   +L L  ++ +   L+  +   + + L Q  +++ +   K ++ +F+      I  P  ++ R E
  S:     5 YYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAAIDKNIDPQKFTDQTSQSFRHLMTAMHISNDDFIRTTEERHKKAVAIFWQKLLDNGSIYEGFYEGWYAVRDEAFY---------DESELTADKLAPTGAAVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNDNKHVIYVWLDALANYISALGYPDQ-NSNYGKFWPAN----LQVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIEEFGVDQVRYFLMREITFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDGKVPAITQDAINKIYELPLLKTAINSAKQNILLMEKTEINKILDNIINLAEEANIYIDSEAPWNLKKTDPEKMLEVLYAL-LETLRYIAVMLQAFMPSSAGKMLDQLGVNTEERLFKHLSLEFALTSASDILEPVIVFPRFE 508
>gi|49475612|ref|YP_033653.1| methionyl-tRNA synthetase [Bartonella henselae str. Houston-1] >gi|49238419|emb|CAF27646.1| Methionyl-tRNA synthetase [Bartonella henselae str. Houston-1] (519 aa)
Score = 807, Expect = 1.6e-83, Identities = 175/511 (34%), Positives = 290/511 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR 1081
           +YITTPI+YP+G PHIGHA++ + +DVL R+++  G   FF++G DEHG K+++ A  L + P++L D+ + VF  +   L    + FIRTT + H    QE + ++     IYL  + G Y V  E  Y +      E++ +       P+   EEESYF K+ +++K  +  + K P+ + P  R NE+  SF+ +    D+SISR++F+WGI +  + KHV+YVW+DAL NYLS +G+   ++S  + FW +     V ++ K+I RFH IYWP  L   G+  P +  +HG+++    KMSKS+GNV+DP   I+ YG D  RY+LL+E+   +D  +S    +N  N DLAN++GNL  RS+ MI K  D  +P  +    +F ++ E+ L++    + T+ + ++ Q+I   LS +  ++ + N +    +PW L+K N E+     L + L  ++R+   L P +   + + L    I      ++ +++    +   +  PEPI+ R
  S:     5 YYITTPIFYPNGAPHIGHAYSAIASDVLARFQRLDGKNVFFLSGTDEHGLKMQQTAVALGITPKQLTDRNSAVFQKMLAALNCSNNDFIRTTEKRHYQACQEIWKKMKANGDIYLSRYTGWYSVRQEAYYEEKDTEVGEDNIRREKELGSPVEWNEEESYFFKLSRYEKALLEHYEKHPDFIAPPERRNEVI-SFIKSG-LKDISISRASFNWGICVPNDSKHVMYVWVDALTNYLSAIGFFD-ENSKKRAFWPAS----VHIIGKDIIRFHAIYWPAFLMSAGIALPKRIFAHGFLLNNGVKMSKSIGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYSHDSFVNRINADLANDLGNLAQRSLSMIAKNCDAKVPLPA----AFLVQDEQLLEKSLQTLDTMRKAMSSQEIHLALSAIFSVVADANRYFANEQPWSLRKNNPER-FSTVLYITLEILRRIGIMLLPFMPQSAAKLLDSLKISQEDRLLQHISNSKIQEGLDLPPPEPIFPR 507
>gi|158335466|ref|YP_001516638.1| methionyl-tRNA synthetase [Acaryochloris marina MBIC11017] >gi|158305707|gb|ABW27324.1| methionyl-tRNA synthetase [Acaryochloris marina MBIC11017] (532 aa)
Score = 806, Expect = 2.0e-83, Identities = 177/515 (34%), Positives = 281/515 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL---YCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ--FNIDSSKFDIKFVTDFSSLD-----------NQKINTPEPIYLRIE 1083
           ++F +TTP+YY +  PHIG A+TT+ AD + R+ +  G+E   ITG DEHGQKI+  A++    PQ+  D+    + +LW+ L I+Y  F RTT+  H  +V E F  +  K  I  G  +G YCV CEE         KE  D L   +C     P+  ++E++YF ++ +++  +     D P+ + P +R NE+  SF+      D SISR N  WG  +  + +H +YVW DALL Y++ L     +   D    ++W       + L+ K+I RFH +YWP ML    L  P +   HG++  +  KM KSLGN LDP+  ++ YG DA RYY LK L    D  FSE   I+  N DLAN++GNL NR++ M  KY +G +P      +  +    +  ++  D++    + LN  +  +  + L+   N FI++  PW L K+  +  ++  L  +L +V+   Y L PV+ + S +  +Q  F +D    ++    D ++L            NQ + TP+P++ ++E
  S:     7 RRFALTTPLYYVNDLPHIGSAYTTMAADAIARFHRLQGHEVLLITGTDEHGQKIQRTAEQRGKAPQDHCDEIVAGYKDLWQRLNIQYDRFSRTTSPRHGQIVAEFFQRVWDKGDICQGHQQGWYCVGCEE--------FKEERDLLEDNHCPIHKRPVEWRDEQNYFFRLSKYQDDLLQLFADQPDFIQPTSRRNEVL-SFVER-GLQDFSISRVNLDWGFPVPADDQHTLYVWFDALLGYVTALLDEDTEPTLDQALSQWWPIN----LHLIGKDILRFHAVYWPAMLMSADLPLPDRVFGHGFLTKDGQKMGKSLGNTLDPVELVDRYGTDAVRYYFLKALEFGRDGDFSETRFIDVVNADLANSLGNLLNRTLKMAVKYCNGQVPDIDIQSIPEDHPLAQLGRKAGDQVAKAYQNLNFSQACNISLGLVKAGNQFIDEQAPWSLYKKGEQGLVNEILYTVLESVRLSAYLLTPVIPNLSTQIYQQLGFKLD---LNVNHDGDETTLHSIHSNWGGLPANQILGTPQPVFQKLE 525
>gi|67458627|ref|YP_246251.1| methionyl-tRNA synthetase [Rickettsia felis URRWXCal2] >gi|75536907|sp|Q4UMX2|SYM_RICFE Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|67004160|gb|AAY61086.1| Methionyl-tRNA synthetase [Rickettsia felis URRWXCal2] (512 aa)
Score = 805, Expect = 2.4e-83, Identities = 178/515 (34%), Positives = 290/515 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIESE 1085
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D  ++ F +L  ++ I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++    +   D L      P+   +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL +Y+S LGY  K  SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   L+   N +L+N +GNL  R+   + K  DG +P   +  +   + +   K   +F ++   ++EK  I K+L  +I+L  E N +I+   PW+LKK + EK  +   +L L  ++ +   L+P +   + + L Q  ++  +   K  + D++      I  P  I+ R E +
  S:     5 YYITTPIYYVNDVPHIGHAYTSVASDVIARFIRLCGFDVMFLTGTDEHGQKVEKAAINKNIDPQKFTDHTSESFRHLMNVMNISNDDFIRTTESRHKEAVAIFWQKLLDNGTIYEGFYEGWYAVRDEAFFDES----ELTSDGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALASYISALGYPDK-QSNYGKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLVTRINSELSNKIGNLLQRTTAFVYKNNDGKVPLLMQGIIDKIYELPILKTASKFAEQNILLMEKTEINKVLENIINLSEEANIYIDSEAPWNLKKTDPEKMSEVLYTL-LEVLRYIAIMLQPFIPSSANKMLDQLGVNKEERLFKHLIRDYALRAGSSILEPAIIFPRFEGD 510
>gi|167358485|ref|ZP_02293140.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074699|gb|EDR78520.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] (516 aa)
Score = 804, Expect = 3.0e-83, Identities = 174/511 (34%), Positives = 278/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + RY++  G + FF+TG DEHGQK+++ A+   +  Q L D+ +  F  +  LL      FIRTT E H    +  +  +     IY   + G Y V  E  Y +N       D   Y  Q  P+   EE SYF K+ +++ K ++ +  +P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++ ++P HV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP+  +N +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP+      + + E +  L + D    +  E++  Q+I   L+ +I +++E + +     PW LKK + E+ +   L +    V+++   L P + D S + L      + K D   + +   L     +  P P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGKDVFFLTGTDEHGQKMQQTARAEGITAQALADRNSGEFQAMATLLNASNDDFIRTTQERHHETSRNIWKLMADNGDIYKDSYAGWYSVRDEAYYQEN-ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHYEANPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPDDPAHVMYVWVDALTNYITATGYIEDKNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGNLASRSLSMIVKNCDGKIPECG----ALSDEDKAMLAEVDALHASTREEMGKQQIHRALASIISVVSETDRYFAGQAPWALKKTDPER-MGTVLYVTAEVVRQIAILLRPFMPDSSGKLLDLVAAPADKRDFAALGEAGRLTAGTTLEAPTPVFPR 510
>gi|157964833|ref|YP_001499657.1| methionyl-tRNA synthetase [Rickettsia massiliae MTU5] >gi|157844609|gb|ABV85110.1| Methionyl-tRNA synthetase [Rickettsia massiliae MTU5] (508 aa)
Score = 804, Expect = 3.3e-83, Identities = 178/513 (34%), Positives = 290/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D+ +++F +L   + I    FIRTT   HK  V   + +LL+   IY G ++G Y V  E  + ++    +   D L      P+   +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY  K  SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   + HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  D  +P  ++  +   + +   K   +F ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L P +   + + L Q  ++  +   K  + D++      I  P  I+ + E
  S:     5 YYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQQFTDQTSEIFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLENGTIYEGFYEGWYAVRDEAFFDES----ELTSDGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVSNNEKHVIYVWLDALANYISALGYPDK-QSNYGKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMVHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEANIYIDSEAPWNLKKTDPDKTLEVLYAL-LEVLRYIAIMLLPFIPSSANKMLDQLGVNKEERLFKHLIRDYTLTAGSNILEPTIIFPKFE 508
>gi|167751097|ref|ZP_02423224.1| hypothetical protein EUBSIR_02082 [Eubacterium siraeum DSM 15702] >gi|167656015|gb|EDS00145.1| hypothetical protein EUBSIR_02082 [Eubacterium siraeum DSM 15702] (605 aa)
Score = 804, Expect = 3.4e-83, Identities = 167/443 (37%), Positives = 252/443 (56%)
  Q:   606 GYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQ 1048
           GY+  F+TG DEHGQKIE KA E  + P+E VD+    F  LW+ + I Y  FIRTT +YH   VQ+ F +L +K +IY G +KG YC  CE  +T++  V  +  D   C +   + +  EE+YFL++  F   I  FL + + + P +R+NE+ N+F+     +DL +SR++F+WGI +  + KHVVYVW+DAL NY+S LGY  +  ++F+K+W +     + + +KEI RFH I WPI+L ML L  P     HGWI     KMSKS GNV+DP      YG DA RY +L+++    D  F+ +L++   N DLAN++GNL +R++ M +KY  G +P   +     + +     +   D +T +IE+    K L  +  +I+  N +I++  PW L K E+N   L   L  +L  ++     L P +     E  +Q
  S:     3 GYDVMFLTGTDEHGQKIELKAAEKGVTPKEYVDEIVANFKRLWETMHISYDRFIRTTDDYHIETVQKIFKKLYEKGYIYKGTYKGKYCTPCESFWTESQLVDGKCPD---CGR--EVKEANEEAYFLRLSDFADKIEKFLTETDYLQPKSRVNEMVNNFIK-PGLEDLCVSRTSFTWGIPVDFDSKHVVYVWVDALSNYISALGYGNEKYNDFEKYWPAD----MHMTAKEIVRFHSIVWPIILMMLDLPLPKHLYGHGWINFNGDKMSKSKGNVVDPFVLCERYGVDAVRYQILRDMPYGSDCNFTNELMLTRINADLANDLGNLVSRTVAMADKYFGGTLPT-DRVSDDLDDQLIGMAQSLCDTVTPLIEQAQHSKALEEIFKVISRANKYIDETAPWVLAKDESNNARLATVLYNLLETIRICSALLSPFMPATMPEVWEQ 435
>gi|86357775|ref|YP_469667.1| methionyl-tRNA synthetase [Rhizobium etli CFN 42] >gi|86281877|gb|ABC90940.1| methionyl-tRNA synthetase protein [Rhizobium etli CFN 42] (516 aa)
Score = 804, Expect = 3.5e-83, Identities = 175/511 (34%), Positives = 277/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + RY++  G + FF+TG DEHGQK+++ A+   + PQ L D+ +  F  + KLL      FIRTT E H    +  ++ +     IY   + G Y V  E  Y +N       D   Y  Q  P+   EE SYF K+ +++ K ++ +  +P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP+  +N +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP+          E +  L Q D    +  E +  Q+I   L+ +I +++E + +     PW LKK +  + +   L +    V+++   L+P + + S + L      + K D   + +   L     +  P P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQTARAEGIAPQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMADNGDIYKDSYAGWYSVRDEAYYQEN-ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHYEANPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYITATGYIEDRNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMSAKLPLPQRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGNLASRSLSMIVKNCDGKIPECG----PLTDEDKAMLAQADALHASTREDMGKQQIHRALASIIAVVSETDRYFAGQAPWALKKTDPAR-MGTVLYVTAEVVRQIAILLQPFMPESSGKLLDLVAAPADKRDFAALGEAGRLVAGTPLEAPTPVFPR 510
>gi|116252220|ref|YP_768058.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] >gi|115256868|emb|CAK07962.1| putative methionyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] (516 aa)
Score = 803, Expect = 3.9e-83, Identities = 174/511 (34%), Positives = 276/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + RY++  G + FF+TG DEHGQK+++ A+   +  Q L D+ +  F  +  LL      FIRTT E H    +  +  +     IY   + G Y V  E  Y +N       D   Y  Q  P+   EE SYF K+ +++ K ++ +  +P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP+  +N +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP+      + N E    L + D    +  E +  Q+I   L+ +I +++E + +     PW LKK + E+ +   L +    V+++   L+P + + S + L      + K D   + +   L     +  P P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGKDVFFLTGTDEHGQKMQQTARAEGITAQALADRNSGEFQAMATLLNASNDDFIRTTQERHHETSRNIWKLMADSGDIYKDSYAGWYSVRDEAYYQEN-ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHYEANPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYITATGYIEDKNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIRTRINSDLANGIGNLASRSLSMIVKNCDGKIPECG----ALNDEDRAMLAEVDALHASTREDMGKQQIHRALASIISVVSETDRYFAGQAPWALKKTDPER-MGTVLYVTAEVVRQIAILLQPFMPESSAKLLDLVAAAADKRDFAALGEAGRLVAGTALEAPTPVFPR 510
>gi|190891834|ref|YP_001978376.1| methionyl-tRNA synthetase protein [Rhizobium etli CIAT 652] >gi|190697113|gb|ACE91198.1| methionyl-tRNA synthetase protein [Rhizobium etli CIAT 652] (516 aa)
Score = 803, Expect = 4.3e-83, Identities = 175/511 (34%), Positives = 279/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + RY++  G + FF+TG DEHGQK+++ A+   +  Q L D+ +  F  + KLL      FIRTT E H    +  ++ + +   IY   + G Y V  E  Y +N       D   Y  Q  P+   EE SYF K+ +++ K ++ +  +P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP+  +N +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP+      + + E +  L Q D    +  E +  Q+I   L+ +I +++E + +     PW LKK +  + +   L +    V+++   L+P + D S + L      + K D   + +   L     +  P P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQTARAEGITAQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIYKDSYAGWYSVRDEAYYQEN-ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQDKLLAHYEANPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYITATGYIEDRNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMAAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVNHFGLDQVRYFFLREVSFGQDGSYSEEAIGTRINSDLANGIGNLASRSLSMIVKNCDGKIPECG----ALSDEDKAMLAQADALHASTREDMGKQQIHRALASIIAVVSETDRYFAGQAPWALKKTDPVR-MGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDLVAAPADKRDFAALGEAGRLVAGTPLEAPTPVFPR 510
>gi|86152046|ref|ZP_01070258.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85840831|gb|EAQ58081.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 260.94] (628 aa)
Score = 802, Expect = 5.8e-83, Identities = 195/512 (38%), Positives = 284/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY-CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   ND     C +   +++  EESYF K+ +++  I  + ++ + + P  + NEL N         DLSI+R++F WGI++ +   + KH++YVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +  +  ++L  N + +    L P L    ++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDDFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKQTRILK--EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYISSLDFQSKGEN--AKFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNILKEGVLKF-YNTEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCQKVALALNFEISSTNYAKMILDNELLDF-KANPCEALFPKVE 503
>gi|139438655|ref|ZP_01772139.1| Hypothetical protein COLAER_01139 [Collinsella aerofaciens ATCC 25986] >gi|133775735|gb|EBA39555.1| Hypothetical protein COLAER_01139 [Collinsella aerofaciens ATCC 25986] (533 aa)
Score = 802, Expect = 6.0e-83, Identities = 185/512 (36%), Positives = 291/512 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDD-----KLYCAQLH-PLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD---SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG------KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT----TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSL-ILNAVKRVIYYLEPVLIDGSKEALKQFNI--DSSKFDIKFVTDFSSL-DNQKINTPEPIYLRI 1082
           F+ITTPIYY + +PH+G A++T+IADV  RY++  GY   F+TGMDEHG+K+ E A + N+ PQE  D  A  F  LW  L I    FIRTT     + VQ  +  + +  ++Y G + G YCV  +E Y  +  V+K +++     +  C   H PL + +EESYF K+  F+ K +  + + P+ V P  R+NE+  SF+     +DLS+SR++F WGIQ+  +  HV YVW DALLNY++ +GY    D   +     W +Q      ++ K+I RFHC+ WP ML  +G   P    +HG++           KMSKS GN + P   I+  G + +RYY + ++    D   S   +   +N DLAN+ GNL +RS+ M  KY DG  P  +KP  SF+  F+  L +  D +       ++ L+       V++LI+  N +IE  +PW L K+  + D   F+   +L A++   + L P++   S EAL++ +   +++  D+K +  +  L   Q +   +P++ R+
  S:     8 FFITTPIYYVNADPHLGTAYSTIIADVQARYRRSAGYNVKFLTGMDEHGEKVAEAAAKHNMTPQEWTDSQAPHFKELWNKLEISNDDFIRTTEPRQHHAVQYLWERMKESGYLYKGSYDGWYCVP-DETYFTDTQVQKGDEEYGSVGQHLCPDCHRPLERVQEESYFFKLSAFQDKLLKLYDEHPDFVEPAFRMNEV-RSFVEG-GLNDLSVSRTSFDWGIQVPFDEGHVTYVWFDALLNYMTAVGYGVDTDEARAELSYRWPAQ----FHIVGKDIIRFHCVIWPAMLMAIGEALPEHVFAHGFLTVRNAETGKAEKMSKSRGNAIAPQDVIDMLGVEGYRYYFMTDVVPGTDGAISFDRMEQVYNADLANSWGNLISRSLNMSAKYFDGCAP--AKPA-SFD-AFDNPLAKIADGLVERYMAKMDVLDYGGAKDEVMELIHAANHYIEDSEPWALAKDEAKADELAFVIYNLLEAIRIAAHLLMPLMPQTSAEALRRLSCEDEAASDDLKGICAWGLLAGGQPVEKGDPLFPRL 532
>gi|153952241|ref|YP_001398097.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. doylei 269.97] >gi|152939687|gb|ABS44428.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. doylei 269.97] (628 aa)
Score = 801, Expect = 6.2e-83, Identities = 193/512 (37%), Positives = 282/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  +K +  F  LW  L I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   N     C +   +++  EESYF ++ +++  I  + ++ + + P  + NEL N         DLSI+R++F WGI++ +   +PKH++YVWLDAL  Y+S L ++ K +    KFW +     V L  K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  ++ E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +     ++L  N + +    L P L    ++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDMPHLGHAYTTIIADTLARFYRLQGHETKFLTGTDEHGQKIEEAAKLRNSTPQEYANKISFEFKKLWDELEISYDIYARTTNTMHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI--NNCSCPDCGKNTTILK--EESYFFRLSKYQDKILQWYEEKDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIKLPQEMNDPKHIIYVWLDALFIYISSLDFQSKGEK--AKFWPAH----VHLAGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYFQGNISKEGVLKF-YDAEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANIAISKYEPWNLIKENKHEQAHALVALCANILAKTSLLLSPTLPKSCQKVALALNFEISSTNYTKIILDNELLDF-KANPCEALFPKVE 503
>gi|15965354|ref|NP_385707.1| methionyl-tRNA synthetase [Sinorhizobium meliloti 1021] >gi|25009383|sp|Q92PX0|SYM_RHIME Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|15074534|emb|CAC46180.1| Probable methionyl-tRNA synthetase (methionine--tRNA ligase) [Sinorhizobium meliloti 1021] (516 aa)
Score = 801, Expect = 6.4e-83, Identities = 172/511 (33%), Positives = 277/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLN---IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + R+++  G E FF+TG DEHGQK+++ AK+  + PQEL  + +  F N+ +LL      FIRTT + H    Q  +  + +   +Y   + G Y V  E  Y +N       D   Y  Q  P+   EEESYF ++  ++ K +  + ++P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  G          KFW +     + ++ K+I RFH +YWP  L   GL  P +  +HG+++ +  KMSKSLGNV+DP   +  +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG +P           E +  L   D  I T  E++    I + L+ +I +++E + +    +PW LKK +  + +   L +    V++V   L+P + + + + L    + + + D   + +   L     +  P+P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQTAKKEGISPQELAARNSAEFQNMARLLNASNDDFIRTTEQRHHEASQAIWMRMGEAGDLYKDSYAGWYSVRDEAYYQEN-ETELRGDGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLKHYEENPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPSHVMYVWVDALTNYVTATGCLTDPTGPRAKFWPAN----IHVIGKDIIRFHAVYWPAFLMSAGLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPFNLVEHFGLDQIRYFFLREVSFGQDGSYSEEGIATRINSDLANGIGNLASRSLSMIVKNCDGQVPLCG----PLTDEDKAMLAAADSLIGTAREEMGKQLIHRALAAIIAVVSETDRYFAGQEPWALKKTDPSR-MATVLYVTAEVVRQVAILLQPFMPESAGKLLDLVAVPTDRRDFAHLGEAGRLVSGTPLEAPKPVFPR 510
>gi|154253553|ref|YP_001414377.1| methionyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1] >gi|154157503|gb|ABS64720.1| methionyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1] (520 aa)
Score = 801, Expect = 6.5e-83, Identities = 168/470 (35%), Positives = 259/470 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSIS--RSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLK---QFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           K FYITT I YP+G PHIGHA+  +  DV+ RYK+  GY+  F+TG+D+HGQK+ + AK     PQ L D+ A  F  + + L I    FIRTT   H+   Q  + ++  K  IY G + G Y V  E  Y ++     E   KL      P+   EEE+YF ++  ++ K ++ +   P+ + P +R NE+  +F+     +DLSIS  R+   WG+ +  +P HV+YVW+DAL NY++GLGY   D   F+++W +     + ++ K+I RFH + WP ML    +  P +   HG++     KMSKS+GNV+DP    +TYG D  RY+  +E++   D  +S   ++N  N DLAN++GNL  RS+ MI K   G +P Y     +F  E +  L       ++    +E+L I   +  V  +++E N +    +PW LKK + E+ +   L +    V+R    L+PV+
  S:     5 KAFYITTAISYPNGPPHIGHAYEVITTDVIARYKRLDGYDVRFLTGVDDHGQKMAQTAKAKGTTPQALADEMAPKFLAMDERLNISNDDFIRTTEARHEKACQHLWEKIAAKGDIYTGTYSGWYSVRDEAFYDEDELTTGEGGQKLAPGTGTPVEWMEEETYFFRLSAYQEKLLALYESQPDFIQPASRRNEIL-AFVKR-GLNDLSISRARTKLDWGVGVPGDPNHVMYVWIDALTNYITGLGYPDMDGDLFKRYWPAD----MHIIGKDIVRFHAVIWPAMLMAAEVALPKRVFGHGFLNVRGEKMSKSVGNVIDPFTITDTYGVDPIRYFFCREVTYGADGSYSHDTVVNRINADLANDIGNLAQRSLSMIAKNCGGEVPAYG----AFTAEDKAVLDAAAALPEKTREQMERLEIHSYVGEVFAVVSEANRYFAGQEPWALKKTDPER-MGTVLYVTAEVVRRCALMLQPVM 469
>gi|157415105|ref|YP_001482361.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81116] >gi|157386069|gb|ABV52384.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni 81116] (628 aa)
Score = 801, Expect = 7.2e-83, Identities = 196/512 (38%), Positives = 282/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   ND        +  I K EESYF K+ +++  I  + ++ + + P  + NEL N         DLSI+R++F WGI++ +   + KH++YVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +  +  ++L  N + +    L P L    ++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDEFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKNTTILK-EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYISSLDFQSKGEN--AKFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNILKEGVLKY-YNTEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCEKVALALNFEISSTNYAKMILDNELLDF-KANPCEALFPKVE 503
>gi|86153308|ref|ZP_01071512.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843034|gb|EAQ60245.1| methionyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni HB93-13] (628 aa)
Score = 801, Expect = 7.6e-83, Identities = 195/512 (38%), Positives = 284/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY-CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNID-SSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET F+TG DEHGQKIEE AK  N  PQE  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  +T++  +   ND     C +   +++  EESYF K+ +++  I  + ++ + + P  + NEL N         DLSI+R++F WGI++ +   + KH++YVWLDAL  Y+S L ++ K ++   KFW +     V L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L+N  GNL NR IGM  KY  G I K    K  +N E   Q K+  +     +E L   + L  +   ++  N  I + +PW+L KEN  +  +  ++L  N + +    L P L    ++     N + SS    K + D   LD  K N  E ++ ++E
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDDFEITYDIYARTTDTRHIEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFTQSQLI---NDCSCPDCGKQTRILK--EESYFFKLSKYQDKILQWYEEKDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIKLPQEINDDKHIIYVWLDALFIYISSLDFQSKGEN--AKFWPAH----VHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLINRINAELSNEFGNLLNRIIGMSTKYSQGNILKEGVLKF-YNTEL-NQAKEHLNLAVEFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKENKHEQANALVALCANILAKTSLLLSPTLPKSCQKVALALNFEISSTNYAKMILDNELLDF-KANPCEALFPKVE 503
>gi|163782331|ref|ZP_02177329.1| methionyl-tRNA synthetase alpha subunit [Hydrogenivirga sp. 128-5-R1-1] >gi|159882364|gb|EDP75870.1| methionyl-tRNA synthetase alpha subunit [Hydrogenivirga sp. 128-5-R1-1] (493 aa)
Score = 801, Expect = 7.8e-83, Identities = 178/508 (35%), Positives = 283/508 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSIS--RSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTP 1075
           MKKFY+TTPIYY +  PHIGHA+TT+ AD + R+ +  GY+ FF+TG DEHG KI++ A+E  + P+EL D+ ++ F  LW+ LGIEY+ FIRTT   H  +V+E F++  +   IYLG ++G YCV CEE +   + + + N   ++   + P     E SYF ++ +++ K +  + + P  V P  R NE+  SF+      DLS++  RS   WGI +  +  H +YVW DAL NY+S L      +    ++W +     + ++ K+I RFH +YWP  L  +G   P    +HGW   E  KMSKSLGNV+ P   +  YG D  RY+LL+E+   +D  FS++ ++N  N +LAN +GNLF+R + M  KY  G      K +   +  + +      +     + ++N  + L  V+ L +  N ++++  PW+L K  +E   D   +L+ + +  + Y L P + +  K A++   ++    ++K F     SL  +KI  P
  S:     1 MKKFYVTTPIYYVNDVPHIGHAYTTIAADTVARFYRLRGYDVFFLTGTDEHGLKIQKSAEERGVSPKELADRNSENFKRLWEFLGIEYTKFIRTTDPEHVELVKEVFTKSYENGDIYLGEYEGWYCVGCEE-FKSEMELAEGNSCPIH---MKPCEYIREPSYFFRLSKYQDKLLELYEEHPEFVRPDYRRNEII-SFVKQ-GLKDLSVTRPRSRVRWGIPVPFDEGHTIYVWFDALFNYISAL------NGQVDRYWPAD----LHIVGKDILRFHTVYWPAFLFSVGYEVPETVFAHGWWTVEGKKMSKSLGNVISPYEVVEEYGLDEVRYFLLREVPFGQDGDFSKEAILNRINGELANEIGNLFSRVVSMSKKYLGG------KVEGRGDDAYRELAGDVVERYEGYMREVNFYRALEEVLRLSSFLNKYVDEKAPWELAKRGDENLRDVLYTLV-DGLFLLAYLLTPFMPNKMKLAMEMLGVERMPEEVKPFTFGSYSLGERKILFP 489
>gi|33240420|ref|NP_875362.1| methionyl-tRNA synthetase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33237947|gb|AAQ00015.1| Methionyl-tRNA synthetase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (507 aa)
Score = 800, Expect = 1.1e-82, Identities = 186/511 (36%), Positives = 272/511 (53%)
  Q:   573 ITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF-LSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIE 1083
           ITTP+YY +  PH+G  +TT+  D   RYKK  G    FITG+DEHGQKIE  AK  N+ P +   K A  ++ LWK   I    FIRTT+  HK +V++ F  + +   I LG  +G YCV CEE Y  +    K   D +      PL  ++EE+ F  + +++  I + +  PN V PI+R NE+ N    +    D SISR N SWGI +     H  YVW DALL YLSGL  + K +    +  N      V ++ K+I RFH +YWP ML   GL  P +   HG++  E  KM KSLGNVLDP   ++ YG D  R+YLL ++   +D  F EK  I+  N DLAN +GNL NR+  M  K+    +P   K   + N E +    +   ++    E+L+ ++    ++DL +  N ++   +PW L K+N+E++L  + L  +L + + V   + PVL + S++ L Q     S    +    +  L+  Q++  P PI  R+E
  S:     5 ITTPLYYVNDKPHLGSTYTTIACDAFARYKKLNGNNVVFITGVDEHGQKIERTAKANNISPSDHCSKIASQYEMLWKKWSISNDKFIRTTSSQHKTLVEKFFHRVDQNGDIRLGRQQGWYCVGCEE-YKDDPPGAK---DPICSTHKMPLEWRDEENLFFCLSKYQTKIENLISQPNFVQPISRRNEIIN--FVSKGLKDFSISRVNISWGIPVPGFKGHTFYVWFDALLGYLSGL--QTKGEVELDELNNYGWPADVHVIGKDILRFHAVYWPAMLMSAGLDLPHRVFGHGFLTREGNKMGKSLGNVLDPELLLDKYGEDPVRWYLLSDIKFGQDGDFQEKRFIDLTNNDLANTIGNLLNRTSSMSRKWFSNCVPNIHKE--NENNELKLLASKTISDVINYYEQLSFKEACKAILDLASSSNLYLNDNEPWKLIKQNSERELVSYHLYNVLESCRIVATLIAPVLPNLSRKILNQLGFFDSLQSWEHQLVWGVLEKGQELPEPSPIIPRLE 507
>gi|58038507|ref|YP_190471.1| methionyl-tRNA synthetase [Gluconobacter oxydans 621H] >gi|58000921|gb|AAW59815.1| Methionyl-tRNA synthetase [Gluconobacter oxydans 621H] (516 aa)
Score = 799, Expect = 1.1e-82, Identities = 174/521 (33%), Positives = 285/521 (54%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI----IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN-----QKINTPEPIYLRIESED 1086
           ++ ++F ITTPI+Y +G PHIGHA+T++ ADVL R+ +  G E  F++G DEHGQK+E+ A    + PQ   D+ +  F  + K + I    FIRTT E HK   +  + ++     IYLG ++G Y    +E +     + K+ D         P+ + +E SYF ++  F+  +    +D P+ + P+    E+  SF+      DLS+SR++F WG+ +  +P HV+YVW DAL NYL+ +GY   +D    KFW +     V ++ KEI RFHC+YWP  L   G+  P    +HGW   E  KMSKSLGNVLDP    + +G DA R++L++E+    DS FS + +I   N +LAN++GNL  R++  + +   G++P+  +  L+   E ++ +      + TI    IE+  I   L  V  +I   N +I++  PW LKK + E+  D  L ++++ ++ +   L+P + +     L Q  +   +        F++L+      + +  PE ++ R   E+
  S:     5 DMTRRFIITTPIFYVNGAPHIGHAYTSIAADVLARFHRLNGEEVLFVSGTDEHGQKVEQTAVAKGMDPQAYADEVSASFRQMQKDMAISTDEFIRTTEERHKGAAKALWEKVAANGHIYLGAYEGWYSTR-DEAFIGEDELVKKPDGTFVAPSGAPVERVKEPSYFFRLSDFQDRLLKLYEDNPDFIGPVGPRREI-ESFVRQ-GLRDLSVSRTSFKWGVPVPNDPDHVMYVWFDALANYLTAVGYPDLNDPR-AKFWPAD----VHIVGKEIARFHCVYWPAFLMAAGIDLPKSVFAHGWWTVEGEKMSKSLGNVLDPKALADEFGLDALRFFLMREVPFGGDSNFSRRSMITRTNVELANDLGNLCQRTLSQVARNLGGVLPE--RGTLT---EDDQAMLAMVTLLPTIMSEQIERKAITDALEEVWKVIRAANSYIDRQAPWALKKTDPERMADV-LRVLVDMIRGIATMLQPYMPNTMDRMLTQLGVQDDE------RTFAALETPLPAGRTLPKPEGLFPRFVEEE 515
>gi|83311547|ref|YP_421811.1| methionyl-tRNA synthetase [Magnetospirillum magneticum AMB-1] >gi|82946388|dbj|BAE51252.1| Methionyl-tRNA synthetase [Magnetospirillum magneticum AMB-1] (516 aa)
Score = 799, Expect = 1.2e-82, Identities = 172/515 (33%), Positives = 278/515 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           FY+TTPIYY +  PHIGHA+TTL  DVL R+K+  G++  F+TG DEHGQK+E+ A+   + PQ L D+ +  F  L K+LG     FIRTT   HK   Q  + +L+ K  IYLG ++G Y V  E  Y ++  V+  +  KL      P+   +E SYF ++  ++  +  + +D P+ V P +R NE+  SF+      DLS+SR++F WGI +  +  H++YVWLDAL NY++ +GY      +F ++W      ++ ++ K+I RFH +YWP  L    L  P +  +HGW   E  K+SKS+GNV+DP+  I TYG D  RY+LL+E+    D  FS + ++   N +LAN+ GNL  RS+ MI K   G+ P +  P    + E          ++   +++    + +  +  ++   N ++++  PW LKK +  + +   L ++   ++ +    +P +   S   L Q  +  ++    F     +L     + TP+ ++ R   E
  S:     7 FYVTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVEKSAEAFGVTPQALADQNSANFRELAKILGCTNDDFIRTTEARHKAACQALWDKLVAKGDIYLGAYEGWYSVRDEAFYAEDELVKGADGAKL-APTGAPVEWVKEPSYFFRLSAWQDRLLRWYEDNPDCVAPQSRRNEVM-SFVKG-GLQDLSVSRTSFKWGIPVPGDDAHIMYVWLDALTNYITAVGY-PDTTGDFARYW----PNVIHMVGKDIVRFHAVYWPAFLMAADLPAPKRVFAHGWWTNEGQKISKSVGNVIDPLSLIETYGLDQVRYFLLREVPFGNDGDFSHRAMMGRMNSELANDYGNLVQRSLSMIGKNCGGVTPAH-LPDTDEDKEMLGAAYGMLAKVRDAMDRQLYHEAIEAIWVVVRAANAYVDKQAPWALKKTDPAR-MGTVLWVLAETIRCLALLTQPFMPAASARILDQLMVPEAERSFAFFGPGHALKAGISLPTPQGVFPRYVEE 513
>gi|94987625|ref|YP_595558.1| methionyl-tRNA synthetase [Lawsonia intracellularis PHE/MN1-00] >gi|94731874|emb|CAJ55237.1| Methionyl-tRNA synthetase [Lawsonia intracellularis PHE/MN1-00] (651 aa)
Score = 797, Expect = 2.0e-82, Identities = 180/485 (37%), Positives = 279/485 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQK--EEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP---KYSKPKLSFNIEFEKQLKQFDDEIT----TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           +YI+TPIYY +  PH+GHA++T++ADVL R+   LG +TFF+TG DEHG+KI + A+      QE VD  ++ F NLW  L I Y  FIRTT   HK  VQ+    +     IY G + G YC+ CE  YT+     KE +D  +C Q H    +  EE++YF K+ ++  ++  +L+  PNL+ P    NE+  S L +   +DL ISR  +   WGI++  +  +V YVW DAL++Y+S L +   +   ++ FW  +      L++K+I + H ++WP ML+  GL        HG+ +    KMSKSL N +DPI  I  YG DAFRY+L++E++   D+ FSE+ L +  N DLAN++GNLFNR + M  KY   ++P   +Y++P +        QL+Q  +        +++ + + + +  + +LI   N +I+   PW L KE     L   + L L  +++V   L P++ + +   LKQ  I +SK
  S:     5 YYISTPIYYVNARPHLGHAYSTIVADVLQRFYSILGEKTFFLTGTDEHGEKIIQAAEAAGYSTQEFVDSISRQFQNLWPQLNITYDAFIRTTDLQHKEAVQKFLQHIYDAGDIYFGEFGGYYCLGCERFYTE-----KELEDG-FCPQ-HKTKPEFIEEQNYFFKMSKYLSWLIEYLQQHPNLIRPERYKNEVL-SLLESGALEDLCISRPKTRLPWGIELPFDTNYVCYVWFDALISYISALNWPTGE--YYKTFWPGE-----HLIAKDILKPHAVFWPTMLKSAGLPMYKHLNVHGYWLNRDTKMSKSLNNAIDPITLIQQYGLDAFRYFLIREMNFGSDANFSEESLKHRINSDLANDLGNLFNRVLSMSTKYFKSLLPEAKEYTEPDM--------QLRQLTENAQYNYIQLMKNMRLSQAVEALWELIRALNKYIDTQAPWKLFKEGQTDRLKTVIRLTLECMRKVAISLWPIMPEITITMLKQLGISTSK 478
>gi|15892969|ref|NP_360683.1| methionyl-tRNA synthetase [Rickettsia conorii str. Malish 7] >gi|25009381|sp|Q92GS6|SYM_RICCN Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|15620165|gb|AAL03584.1| methionyl-tRNA synthetase [EC:6.1.1.10] [Rickettsia conorii str. Malish 7] (508 aa)
Score = 797, Expect = 2.1e-82, Identities = 178/513 (34%), Positives = 289/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++   R    D L      P+   +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  D  +P  ++  +   + +   K   +F ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L P +   + + L Q  ++  +   K  + D++      I  P  I+ + E
  S:     5 YYITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKKAVAVFWQKLLDNGTIYEGFYEGWYAVRDEAFFDESELTR----DGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLD-EQSNYNKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEANIYIDSEAPWNLKKTDPDKMLEVLYAL-LEVLRYIAIMLLPFIPSSANKMLDQLGVNKEERLFKHLIRDYTLTAGSNILEPTIIFPKFE 508
>gi|167472180|ref|ZP_02336884.1| methionyl-tRNA synthetase [Rickettsia africae ESF-5] (508 aa)
Score = 797, Expect = 2.2e-82, Identities = 177/513 (34%), Positives = 288/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTP+YY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++   R    D L      P+   +E SYF  + +++  +  F +  P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  D  +P  ++  +   + +   K   +F ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L P +   + + L Q  ++  +   K  + D++      I  P  I+ + E
  S:     5 YYITTPVYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGWYAVRDEAFFDESELTR----DGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEAHPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLD-EQSNYNKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDAKVPLLTQGVIDKIYELPILKTASKFVEQNILLMDKTEINKILENIINLAEEANIYIDSEAPWNLKKTDPDKTLEVLYAL-LEVLRYIAIMLLPFIPSSANKMLDQLGVNKEERLFKHLIRDYTLTAGSNILEPTIIFPKFE 508
>gi|58698674|ref|ZP_00373565.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534805|gb|EAL58913.1| methionyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila ananassae] (548 aa)
Score = 795, Expect = 3.1e-82, Identities = 185/522 (35%), Positives = 298/522 (57%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEI---------------------------------VQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           E  + FYITTP+YY +  PHIGHA+T+L+ DV+ R+ K  G    F TG DEHGQKIE+ AK   ++P+E  D  +  F  L K +  EY  FIRTT E HK  V   ++ L ++  IYL  + G Y V  E  Y ++  +    D K         I+  EESYF ++  ++ K +  +   P+ ++P +R NE+  SF+ +    DLSISR++F+WGI++  N KHV+YVW+DAL NYL+ +G+   +   +++FW   + +I                                 V ++ K+I RFH +YWP +L    L  P +   HGW + E  K+SKSLGNV+DPI     +G D  RY+LL+E S  +D  FS+K +I+  N +LANN+GNL  R+I  ++K   GI+P   +  L    E     K   D++   + K     I+  +I++ +E N +I++  PW L K + E+ ++  +  +L  ++ +   L+P++   ++  L Q  I   + D+K + +        +  P P++LR++++++
  S:     2 EQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEKAAKAKEMQPKEFTDDVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELI----DGKAPTGAEVQWIK--EESYFFRLSNWQDKLLELYKNQPSFIFPESRRNEVI-SFVRS-GLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLTSIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSTGMTPNLADNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQILLKGE-ESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRER-VNLVIYKLLEYIRIIGILLQPIVPKSAEMILNQLQIPKEQRDLKSLCNACVSLGITLPKPTPVFLRVDAKEE 547
>gi|15888821|ref|NP_354502.1| methionyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] >gi|25009368|sp|Q8UFA2|SYM_AGRT5 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|15156579|gb|AAK87287.1| methionyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] (516 aa)
Score = 795, Expect = 3.6e-82, Identities = 171/511 (33%), Positives = 280/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLN---IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + R+++  G + FF+TG DEHGQK+++ A+   + P+EL  + +  F  + KLL      FIRTT E H    +  ++ +     IY   + G Y V  E  Y ++       D   Y  Q  P+   EEESYF K+ +++ K +  + ++P+ + P  R NE+  SF+ +    DLSISR+ F WGI++ ++PKHV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP   +  +G D  RY+ ++E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP       +FN + +  L   D  +    E++    I + L+ +I +++E + +    +PW LKK + E+ +   L +    V+++   L+P +    ++ L      +   D   + +   L     +  P+P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQTARAEGISPEELAQRNSDQFREMGKLLNASNDDFIRTTEERHHETSRNIWNLMADSGDIYKDSYAGWYSVRDEAYYAED-ETEVRADGVRYGPQGTPVEWVEEESYFFKLSEYQEKLLKLYEENPDFIGPAERRNEII-SFVKSG-LKDLSISRTTFDWGIKVPDDPKHVMYVWVDALTNYITATGYIEDRNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVYAHGFLLNKGEKMSKSLGNVVDPANLVAHFGLDPVRYFFMREVSFGQDGSYSEEGIATRINADLANGIGNLASRSLSMIVKNCDGQIPTPG----AFNDDDKAMLASADGLLAVCREEMGKQLIHRALAAIIAVVSETDRYFASQEPWALKKTDPER-MGTVLYVTAEVVRQIGILLQPFMPQSCEKLLDLVAAPADGRDFTALGEAGRLAPGTPLEAPKPVFPR 510
>gi|154175104|ref|YP_001407916.1| methionyl-tRNA synthetase [Campylobacter curvus 525.92] >gi|112803429|gb|EAU00773.1| methionyl-tRNA synthetase [Campylobacter curvus 525.92] (636 aa)
Score = 795, Expect = 3.7e-82, Identities = 193/517 (37%), Positives = 286/517 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLY--CAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNL-VYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQI---KENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESE 1085
           +K YITTPIYY +  PHIGHA+TT+IAD   R+K+  G+ T+F+TG DEHGQKIE+ AK     P+E  D+ +  F  LW    I Y HFIRTT E HK   Q  FS++     IY G ++G YCVSCE  +T    +    DD     C +   +++  EESYF ++ +++  +  + K+  L V P  + NE+  SF+      DLSI+R++F WG+++     +PKHV+YVWLDAL+NYL+ LGY  +DD+    FW +       ++ K+I RFH +YWP  L  L L  P    +HGW      KMSKS GNV+DP      YG + FRY++L+E+   +D  FS+K LI   N +L N +GNL NR IGM  KY +  I   +  K  +N E E+        I   +E L   + L  +  ++   N  I + +PW + KE    + +  ++L  N + +V   L P +   + +  +  + + ++   K +   + + N      EP++ RIESE
  S:     3 EKVYITTPIYYVNDVPHIGHAYTTIIADTFARFKRLQGHPTYFMTGTDEHGQKIEQAAKARGKTPKEYADEISAKFRTLWDEFEISYDHFIRTTDEEHKLTAQNVFSKMQANGDIYKGEYEGFYCVSCETFFTATQLL----DDNCCPDCGRKTSIVK--EESYFFRLSKYQDALLKWYKNDELCVIPRGKKNEVV-SFVKG-GLKDLSITRTSFDWGVKLPASANDPKHVMYVWLDALVNYLTTLGY-SRDDA-LMDFWQNT----THIVGKDILRFHAVYWPAFLMSLNLALPKHVAAHGWWTRNGEKMSKSKGNVIDPREVAKAYGLENFRYFMLREVPFGQDGDFSQKALIERINSELGNGLGNLLNRIIGMSGKYSEFKIDASNVAKF-YNAELEEAHAHLKSAIEN-LEVLATNRYLEELWKVVTLANGVIAKYEPWAMIKEGKTTEANALVALSANLLAKVAVLLSPAMPKTAGKIAEALSFEINERSFKDLVLDNGVQNFISKPTEPLFPRIESE 509
>gi|116622455|ref|YP_824611.1| methionyl-tRNA synthetase [Solibacter usitatus Ellin6076] >gi|116225617|gb|ABJ84326.1| methionyl-tRNA synthetase [Solibacter usitatus Ellin6076] (641 aa)
Score = 794, Expect = 4.1e-82, Identities = 181/514 (35%), Positives = 267/514 (51%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD---LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVT-DFSSLD-NQKINTPEPIYLRIE 1083
           K+Y+TTP+YY +  PHIGH +TT+ A+ + R+K+  GY+    TG DEHGQK+E  A+     PQE  D  A+ F   W+ L I     IRTT   H  VVQ  F   +   +IY G + G YCV  +E Y  +    K  D    C ++   +   EE+YF K+  F +K +  +   P+ + P  R NE+  SF+     +DLSISR+   WGI +     HV YVW DAL+ Y+S +        + +  W +     + LM KEITRFH ++WP  L   G+  P + ++HGW++ E  KMSKS GN++         G DA RY+LL+E+   +D  FS   LI  +N DLAN +GNL +R++ MIN+YR G +P+ S      + E      Q    +    ++    K L  V  LI+  + FI Q  PW L ++N+++    L   L     A++     L PVL   + +   Q  +  S   ++F T ++ SL   QKI     ++ RIE
  S:     2 KYYLTTPLYYVNAAPHIGHTYTTMAAETIARFKRMQGYDAVMFTGTDEHGQKVERSAEAAGKTPQEFTDTIAREFQQQWEKLNIRVDRTIRTTDPRHHKVVQRLFQMCMDNGYIYKGSYSGQYCVY-DELYANDA---KPGDPCPICGRITETVT--EENYFFKLSAFTEKLLELYESQPDFIQPEARRNEVI-SFVKQ-GLNDLSISRTTIKWGIPLPVEGNHVFYVWFDALIGYMSAV--------DGEDLWPAD----LHLMGKEITRFHAVFWPAFLMAGGVPLPKRIVAHGWLLFENDKMSKSRGNIVRSEPIRQVMGADALRYFLLREIVFGQDGSFSYDALIGRYNSDLANGLGNLASRTLTMINQYRGGAVPEGS------DAEIAGIANQTIRTVQETFDRFEFSKGLEAVWGLISAVDKFIVQNAPWKLARQNDQESQTLLSTTLYTAAEALRVATALLSPVLPQSAPKIWAQLGLPESIEAVRFATLEWGSLQPGQKIGEIAGVFPRIE 495
>gi|158423799|ref|YP_001525091.1| methionyl-tRNA synthetase [Azorhizobium caulinodans ORS 571] >gi|158330688|dbj|BAF88173.1| methionyl-tRNA synthetase [Azorhizobium caulinodans ORS 571] (526 aa)
Score = 792, Expect = 7.2e-82, Identities = 172/490 (35%), Positives = 270/490 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK--FDI 1058
           + FYITT I YP+G PH+GHA+  +  D + R+K+  GY+  F+TG DEHG K+ + A++  L P+EL+D+    F  +     +    FIRTT E H    Q  +  +  K  IY   + G Y V  E  Y ++     E + +L   Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF++     DLSISR+ F WGI +  +P H++YVW+DAL NY++ LGY   D   F+KFW +     + ++ K+I RFH +YWP  L   GL  P +   HG++     KMSKS+GNV+DP   + TYG DA RY+ L+E+S  +D  +S + ++N  N DLAN++GNL  RS+ MI+K  DG++P+        + E E  L   D  +    E + +Q I   L+ V  ++ E N +     PW L+K  + K ++  L      +++V    +PV+ + + + L    + + +  FD+
  S:    11 RPFYITTAIAYPNGVPHMGHAYEAIATDCIARFKRLDGYDVRFLTGTDEHGIKMLQTAQKAGLTPRELLDRNVPAFKAMGPAFNLSNDDFIRTTEERHIKSSQAIWERMAAKGDIYKSTYSGWYSVRDEAYYAEDETTVNEQNVRL-GPQGTPVEWVEEESYFFRLSAYQQKLLDFYAANPGFIMPEARRNEVV-SFVSGG-LQDLSISRTTFDWGIPVPGDPAHIMYVWVDALTNYITALGYPDTDAELFRKFWPAD----LHVIGKDIIRFHAVYWPAFLWSAGLEPPKRVFGHGFLFNRGEKMSKSVGNVVDPFGLVETYGVDATRYFFLREVSFGQDGSYSHEAIVNRMNADLANDLGNLAQRSLSMISKNLDGVVPEPG----PLSPEDEAILALADGMLEKAREAMEVQAIHQYLAAVWAVVAEANRYFAAQAPWALRK-TDPKRMETVLWTTAEVIRQVAILAQPVMPESAGKMLDLLVVPAEQRGFDV 494
>gi|184200670|ref|YP_001854877.1| methionyl-tRNA synthetase [Kocuria rhizophila DC2201] >gi|183580900|dbj|BAG29371.1| methionyl-tRNA synthetase [Kocuria rhizophila DC2201] (517 aa)
Score = 791, Expect = 1.1e-81, Identities = 172/479 (35%), Positives = 257/479 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDD---EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           FY TT I YP+G PHIGHA+  + AD L R+++  G  T F TG DEHGQK+++ A++L   P+EL D  +  F  +   LGI Y  FIRTT E H    QE +  +     IYL  + G Y V  E  Y ++    + +  +        L   EEESYF ++ +++  +    +  + V P TR +E+  SF+      DLSISR+ F WG+ +  NP HV+YVW+DAL NYL+GLG+   D   F++FW +     V L+ K+I RFH +YWP  L   G+  P K  +HG++  +  KMSKS+GNV+DP   +  YG D  R++LL+E+   +D  +S   +    N DLAN++GNL  RS+ M+ K   G +P+  +    F  E    L Q +D   E  +  E L   + L  V  +I   N +    +PW L+K + E+ +   L +    ++ V   ++PV+       L+Q 
  S:     7 FYATTAISYPNGAPHIGHAYEAIAADTLVRFQRLDGVATRFQTGTDEHGQKMQQTAEKLGTTPRELADANSARFREMDDELGISYDRFIRTTDEDHAAASQELWKRMEANGDIYLDTYAGWYSVRDEAYYAEDETEVRADGQRYSIGTGTELTWTEEESYFFRLSRYQDRLLELYRT-DFVQPETRSHEI-ASFVGGG-LQDLSISRTTFDWGVPVPGNPDHVMYVWVDALTNYLTGLGFPDTDAPLFREFWPAS----VHLIGKDIARFHAVYWPAFLMSAGIELPRKVFAHGFLFNQGEKMSKSVGNVIDPHAMVEEYGLDQLRFFLLREVPFGQDGNYSHDAIAGRINSDLANDLGNLAQRSLSMVAKNLGGEVPEPGE----FTAEDLAMLAQAEDVVAEYRSAFEALAFHRGLESVWRVIASANRYFTAQEPWVLRKTDPER-MATVLYVTAEVLRIVAVLVQPVMPGSMARLLEQL 476
>gi|58584456|ref|YP_198029.1| methionyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418772|gb|AAW70787.1| Methionyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of Brugia malayi] (540 aa)
Score = 791, Expect = 1.1e-81, Identities = 185/518 (35%), Positives = 293/518 (56%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEI------------------------------VQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           E  + FYITTPIYY +  PHIGHA+T+LI DV  R+ K  G    F TG DEHGQKIE+ AK   + P+E  DK +  F  L + +  +Y  FIRTT E H+  V   +  L ++  IYL  + G Y VS E  Y ++  +    D K         ++  EESYF ++  ++ K +  +   PN ++P +R NE+  SF+ +    DLSISR +F+WGI++  N KH++YVW+DAL NYL+ +G+   ++  ++KFW    + I                              + ++ K+I RFH +YWP +L    L  P + + HGW + E  K+SKSLGNV+DPI     +G D  RY+LL+E S  +D  FS+K +I+  N +LANN+GNL  R+I  ++K   G++P   K  L    E     +   +++   + K     I+  +I++ +E N +I++  PW L K + E+ ++  +  +L  ++ +   L+P++   ++  L Q  I   + D+K +          ++ P P++LRIE
  S:     2 EQFENFYITTPIYYVNDKPHIGHAYTSLICDVTARFMKLAGKNVKFTTGTDEHGQKIEKAAKTKGMHPKEFTDKVSVSFRKLAEFIDFQYDDFIRTTEERHEKAVVALWDRLEERGQIYLDSYSGWYSVSDEAFYQESELI----DGKAPTGAEVEWVK--EESYFFRLSSWQNKLLELYKNQPNFIFPESRKNEVI-SFVKSG-LTDLSISRISFNWGIKVPRNDKHIIYVWVDALTNYLTSIGFPNTENEEYKKFWAESQSVIQVADTWIQKEIQISASRARMTSNLADNSFNIHVIGKDILRFHAVYWPAILLAADLPLPKQIVVHGWWLNEGKKISKSLGNVIDPIALAKEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKRCFGVVPTVDKSLLKGE-EGLPNYRAIFNQVMDHLSKYEFNHIILLIINISSEANAYIDKSAPWILSKTDRER-MNLVIYKLLEYIRIIGILLQPIVPRPAEVILDQLQIPKEQRDLKSLCGAYVSSGTTLHKPTPVFLRIE 540
>gi|196234927|ref|ZP_03133731.1| methionyl-tRNA synthetase [Thermus aquaticus Y51MC23] >gi|196220883|gb|EDY15498.1| methionyl-tRNA synthetase [Thermus aquaticus Y51MC23] (619 aa)
Score = 790, Expect = 1.2e-81, Identities = 167/470 (35%), Positives = 268/470 (57%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY T+F+TG DEHG+ +   A+     P+  VD+ ++ F   W+LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ ++ E +YF +++++++++  +LK  P+L+ P    +E+ +    ++   DLSISR  S   WGI +  + +HV YVW DALLNY+S L Y   D   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP      YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G +P+     +L   +    +L+       T++ +L     L  V+  +   N +I + +PW+L K+ + K+    L  ++  ++     L P +
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARFHRLDGYRTYFLTGTDEHGETVYRAAERAGEDPKAFVDRVSERFKKAWELLGIAYDDFIRTTEERHKRVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELSEGLCPIHGRPVERRREGNYFFRMEKYREWLLDYLKAHPDLIRPEGYRSEVLSML--SEPIGDLSISRPKSRVPWGIPLPWDEEHVTYVWFDALLNYVSALDY--PDGEKYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFSLAERYGRDALRYYLLREIPYGQDTPVSEEALRTRYESDLADDLGNLVQRTRAMLFRFAEGRVPEPVPGEELEEGVGLPGRLR-------TLVRELKFHVALEEVMAYVKALNRYINEKRPWELYKK-DPKEAQAVLYRVVEGLRIASILLTPAM 456
>gi|119962681|ref|YP_948227.1| methionyl-tRNA synthetase [Arthrobacter aurescens TC1] >gi|119949540|gb|ABM08451.1| methionyl-tRNA synthetase [Arthrobacter aurescens TC1] (519 aa)
Score = 790, Expect = 1.4e-81, Identities = 179/513 (34%), Positives = 284/513 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL-YCAQLHPLIQ-KEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITT---IIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSK---EALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           FYITT I YP+G PHIGHA+  +  D + R+K+  G+E FF+TG DEHG K+++ A++  L  ++L D+ +  F  + + LGI +  FIRTT + H    Q  + ++     IYL  ++G Y V  E  Y ++  V K  DD L Y  +   L+    EESYF ++  ++ K ++ + + P    P +R NE+  SF+     +DLSISR+ F WG+ +  + KHV+YVW+DAL NYL+G+GY   +  +F+KFW +     V ++ K+I+RFH IYWP  L   GL  P + + HG++     KMSKSLGNV+ P  F+  YG D  RY+ L+E+    D  ++ + ++   N DLANN GNL  RS+ M+ K  +G +P+  +    F  E +  L Q  + + T     +K    + L  +  ++ + N +  +  PW L+K + E+ ++  L + L  V+ V    +PV+   S    E L Q   +S +F          +   ++  P P++ R E
  S:     9 FYITTAISYPNGVPHIGHAYEVIATDAMARFKRLDGHEVFFMTGTDEHGLKMQQSAEKEGLTAKQLADRNSAAFKQMSQDLGISHDRFIRTTDQDHYAASQAIWKKMEANGDIYLSKYEGWYSVRDEAYYVEDDTVVK--DDGLRYSKETDTLVTWTAEESYFFRLSNYQDKLLALYEEQPEFGAPQSRFNEVI-SFVRR-GLEDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYLTGVGYPDIESESFKKFWPAD----VHVIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLTNNGVKMSKSLGNVVAPQDFVAQYGLDQCRYFFLREVPFGADGNYNHEAIVGRMNSDLANNFGNLAQRSLSMVAKNCEGRVPEPGE----FTAEDKALLAQAGELLDTARAAFDKQEFSRALEAIWTVLGDTNAYFAEQAPWVLRKTDLER-MNTVLYVTLEVVRIVAILAQPVMPSSSAKLLEVLGQPEGESRQFA---AVATPIVAGTELPAPAPVFPRYE 514
>gi|73667420|ref|YP_303436.1| methionyl-tRNA synthetase [Ehrlichia canis str. Jake] >gi|72394561|gb|AAZ68838.1| methionyl-tRNA synthetase [Ehrlichia canis str. Jake] (506 aa)
Score = 790, Expect = 1.4e-81, Identities = 178/515 (34%), Positives = 282/515 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-----DSSKFDIKFVTDFSSLDNQKINTPEPIYLRI 1082
           M   YITTPIYY +  PHIGH +TTLI+D++ R+ +  GY   F+TG DEHGQK+E+ A+E N+   E  +  + VF  L  ++   Y+ F+RTT   HK  V   ++ L   D +YLG + G Y V  E  Y +   +    D K         I  EE SYF ++  F++ + +F ++ P+ + P  R NE+  SF+ +    DLS+SR N  WGI++  + +HV+YVW+DAL NYL+ LG+      ++Q +W + ++ ++ ++ K+I RFH +YWP +L   GL  P K ++HGW   E  K+SKSLGN++ P   +  +G D  RY+L+KE+ +  D  F     I   N DLANN+GNL  R++ ++ K  +G +P  +   L  N E     ++  ++    I+  N+  ++  +  L +  N +I    PW L K + E  +   L  +L  ++ +   L+PV+ + S + L Q N+     D SKF I           + +  PEPI+ +I
  S:     1 MNNIYITTPIYYVNDVPHIGHVYTTLISDIIARFMRLDGYNVKFVTGTDEHGQKVEKAAQERNISLLEFTNGTSAVFRQLADVMNYSYNDFVRTTEMRHKKAVTALWTSLCDNDMVYLGSYSGWYSVRDEAFYQEKELI----DGKAPTGAEVEWI--EEPSYFFRLSDFQEKLLTFYEEHPDFIIPKYRYNEVI-SFVKSG-LKDLSVSRKNVVWGIKVPNDDEHVIYVWVDALANYLTVLGFPDVKSKDYQTYWGNDNSTVLHVVGKDILRFHAVYWPAILMAAGLPLPKKILAHGWWTNEGQKISKSLGNIIKPFDLVEEFGVDQLRYFLIKEMPIGNDGDFKRSSFIKCINSDLANNIGNLVQRTVSLLYKECEGKVPLVNNSLLR-NEEVLPDYQEILEKARGCIKYYNLNGLIHIIEQLSSMANEYITARVPWKLSKSDREI-MKAVLYKLLEYIRCIGLLLQPVIPELSSKMLDQINLPRCNRDFSKFSIPISM------GEILPKPEPIFAKI 505
>gi|34581336|ref|ZP_00142816.1| methionyl-tRNA synthetase [Rickettsia sibirica 246] >gi|28262721|gb|EAA26225.1| methionyl-tRNA synthetase [Rickettsia sibirica 246] (508 aa)
Score = 790, Expect = 1.5e-81, Identities = 177/513 (34%), Positives = 288/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++   R    D L      P+   +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  D  +P  ++  +   + +   K   +  ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L P +   + + L Q  ++  +   K  + D++      I  P  I+ + E
  S:     5 YYITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGWYAVQDEAFFDESELTR----DGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLD-EQSNYNKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNEGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDAKVPLLTQGVIDKIYELPILKTASKVVEQNILLMDKTEINKILENIINLAEEANIYIDSEAPWNLKKIDPDKTLEVLYAL-LEVLRYIAIMLLPFIPSSANKMLDQLGVNKEERLFKHLIRDYTLTAGSNILEPTIIFPKFE 508
>gi|169199280|ref|ZP_02858564.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169085954|gb|EDS66671.1| methionyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] (516 aa)
Score = 789, Expect = 1.7e-81, Identities = 173/511 (33%), Positives = 278/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSS-LDNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D + RY++  G + FF+TG DEHGQK+++ A+   +  Q L D+ +  F  + KLL      FIRTT E H    +  ++ + +   IY   + G Y V  E  Y +N       D   Y  Q  P+   EE SYF K+ +++ K ++ +  +P+ + P  R NE+  SF+ +    DLS+SR+ F WGI++  +P HV+YVW+DAL NY++  GY +  +    K+W +     V ++ K+I RFH +YWP  L    L  P +  +HG+++ +  KMSKSLGNV+DP+  ++ +G D  RY+ L+E+S  +D  +SE+ +    N DLAN +GNL +RS+ MI K  DG IP+        + E +  L Q D    +  + +  Q+I   L+ +I +++E + +     PW LKK +  + +   L +    V+++   L+P + D S + L      + K D   + +    L    +  P P++ R
  S:     7 FYITTAISYPNGKPHIGHAYELIATDAMARYQRLDGRDVFFLTGTDEHGQKMQQTARAEGITAQALADRNSGEFQAMAKLLNASNDDFIRTTQERHHETSRNIWNLMAENGDIYKDSYAGWYSVRDEAYYQEN-ETELRADGVRYGPQGTPVEWVEEASYFFKLSEYQEKLLAHYEANPDFIGPAERRNEVI-SFVKSG-LKDLSVSRTTFDWGIKVPNDPAHVMYVWVDALTNYITATGYIEDRNGPRAKYWPAD----VHIIGKDIIRFHAVYWPAFLMSAKLPLPKRVFAHGFLLNKGEKMSKSLGNVVDPVNLVSHFGLDQVRYFFLREVSFGQDGSYSEEAIGIRINSDLANGIGNLASRSLSMIVKNCDGKIPECG----VLSDEDKAMLAQADALHASTRDDMGKQQIHRALASIISVVSETDRYFAGQAPWALKKTDPAR-MGTVLYVTAEVVRQIAILLQPFMPDSSGKLLDLVAAPADKRDFAALGESGRLLAGTPLEAPTPVFPR 510
>gi|33303697|gb|AAP22256.1| methionyl-tRNA synthetase [Bacillus cereus] (400 aa)
Score = 787, Expect = 2.7e-81, Identities = 164/398 (41%), Positives = 244/398 (61%)
  Q:   595 ADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLI 992
            D + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L+
  S:     2 GDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLV 400
>gi|157828900|ref|YP_001495142.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933624|ref|YP_001650413.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. Iowa] >gi|157801381|gb|ABV76634.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908711|gb|ABY73007.1| methionyl-tRNA synthetase [Rickettsia rickettsii str. Iowa] (508 aa)
Score = 787, Expect = 2.7e-81, Identities = 176/513 (34%), Positives = 288/513 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRIE 1083
           +YITTPIYY +  PHIGHA+T++ +DV+ R+ +  G++  F+TG DEHGQK+E+ A   N+ PQ+  D+ ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  + ++   R    D L      P+   +E SYF  + +++  +  F + +P+ + PI+R NE+  SF+ +    DLS+SR+ F+WGI++  N KHV+YVWLDAL NY+S LGY   + SN+ KFW +     + ++ K+I RFH +YWP  L    +  P   ++HGW   +  K+SKSLGN +DPI  I+ +G D  RY+L++E++   D  F+   LI   N +L+N +GNL  R+   + K  D  +P  ++  +   + +   K   +  ++   +++K  I KIL  +I+L  E N +I+   PW+LKK + +K L+   +L L  ++ +   L P +   + + L Q  ++  +   K  + D++      I  P  I+ + E
  S:     5 YYITTPIYYVNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTEHRHKEAVAVFWQKLLDNGTIYEGFYEGWYAVRDEAFFDESELTR----DGL-APTGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDFIRPISRRNEVI-SFVKS-GLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISALGYLD-EQSNYGKFWPAD----LHVVGKDILRFHAVYWPAFLMAAEVPLPKTIMAHGWWTNDGQKISKSLGNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTSFVYKNNDAKVPLLTQGVIDKIYELPILKTASKCVEQNILLMDKTEINKILENIINLAEEANIYIDSEAPWNLKKTDPDKTLEVLYAL-LEVLRYIAIMLLPFIPSSANKMLDQLGVNKEERLFKHLIRDYTLTAGSNILEPTIIFPKFE 508
>gi|88856857|ref|ZP_01131510.1| methionyl-tRNA synthetase [marine actinobacterium PHSC20C1] >gi|88813927|gb|EAR23796.1| methionyl-tRNA synthetase [marine actinobacterium PHSC20C1] (526 aa)
Score = 786, Expect = 3.6e-81, Identities = 178/468 (38%), Positives = 252/468 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKY-AKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN---IAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           FYI TPI+Y +  PHIGHA+T + ADVL R+ ++ G + + +TG DEHGQKI   A   N  PQE  D+  A  +  L + + I    FIRTT E H+  V      L     IY G ++G YCV CEE    +    A   E   +L CA    P+   +E++YF ++  F +K +  +   P+ V P +  NE+          DDLSISRS+F WG+++  +  HVVYVW DALLNY+S +GY   D+  F K W +     VQL+ K+I RFH + WP ML   GL  P     HGW++    KMSKS    + P    +T+G DAFRYY +  ++  +D  FS + L   +  +LAN  GNL +R I M+NKY DG IP   +   S       Q +  +D     I+   I + L+ V  L++E N +I + +PW L K+  N + L   L+  +N +  +   L PVL
  S:     7 FYIATPIFYVNDVPHIGHAYTEVAADVLARWHRQRGEDAWLLTGTDEHGQKILRTAVANNTTPQEWADRLVADSWQPLLETIDIANDDFIRTTDERHEKAVATFLQRLYDDGHIYAGEYEGYYCVGCEEYKQLDDLVTAPDGEYKGQLVCAIHSRPVEVLKEKNYFFRMSDFGQKLLDLYESQPDFVQPASVRNEIVQ--FVKQGLDDLSISRSSFDWGVKVPWDETHVVYVWFDALLNYVSAIGY-GVDEEQFAKRWPA-----VQLVGKDIARFHAVIWPAMLMAAGLPVPRAVFGHGWLLVGGEKMSKSKLTGIAPSQITDTFGSDAFRYYFMSAITFGQDGSFSWEDLSARYQSELANGFGNLASRVIAMVNKYFDGEIPTLGELTASDEAIIATQKRATEDS-NAFIDTFAINEALASVWQLVDELNGYITEQEPWALSKDPANRERLGTVLATTVNGLGTLAILLSPVL 472
>gi|15604526|ref|NP_221044.1| methionyl-tRNA synthetase [Rickettsia prowazekii str. Madrid E] >gi|6226189|sp|Q9ZCP0|SYM_RICPR Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|3861220|emb|CAA15120.1| METHIONYL-TRNA SYNTHETASE (metS) [Rickettsia prowazekii] (508 aa)
Score = 786, Expect = 4.2e-81, Identities = 178/485 (36%), Positives = 275/485 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           +YITTPIYY +   HIGHA+T++ +DV+ R+ +  G +  F+TG DEHGQK+E+ A   N+ PQ   DK ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  Y ++    + N+DKL      P+   +E SYF  + +++  +  F + +P+ V PI+R NE+  SF+ +    DLSISR+ F WGI++  N KHV+YVWLDAL+NY+S LGY  K  SN+ KFW +     +Q++ K+I RFH +YWP  L    +  P   + HGW   E  K+SKSLGN +DPI  I+ +G D  RY+L++E+    D+ F+   LI   N +L+N +GNL +R +  + K  D  +P      +   + +   K   +F  E   +++K  I KIL  +I+L  + N +I    PW+LK  + +K L+   SL L  ++ +   L+P + + + + L Q  +   +
  S:     5 YYITTPIYYVNDVAHIGHAYTSVASDVIARFMRFCGKDVMFLTGTDEHGQKVEKAAINQNIDPQTFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWKKLLDNGAIYEGFYEGWYSVRDEAFYDES----EINEDKL-APTGAPVEWVKEPSYFFNLAKWQDKLLEFYELNPDFVRPISRRNEVI-SFIKS-GLKDLSISRTTFHWGIKVPNNRKHVIYVWLDALVNYISALGYPDK-QSNYAKFWPAN----LQIVGKDILRFHAVYWPAFLMAAEIPLPKAIMVHGWWTNEGQKISKSLGNTIDPITLIDEFGVDQVRYFLMREVIFGADANFARNNLITRINSELSNKIGNLLHRIVSFVYKNNDAKVPLIKSGVIDKIYELPILKTAIKFAQENILLMDKTEINKILENIINLAEDANIYITNEAPWNLKTTDPDKMLEVLYSL-LEVLRYIAIMLQPFVPNSANKMLDQLGVSKEE 479
>gi|56750417|ref|YP_171118.1| methionyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81299951|ref|YP_400159.1| methionyl-tRNA synthetase [Synechococcus elongatus PCC 7942] >gi|56685376|dbj|BAD78598.1| methionyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81168832|gb|ABB57172.1| methionyl-tRNA synthetase [Synechococcus elongatus PCC 7942] (525 aa)
Score = 785, Expect = 4.6e-81, Identities = 163/481 (33%), Positives = 266/481 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEND---DKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           F +TTP+YY +  PHIG A+TT+ AD + R+ +  G     ITG DEHGQKI+  A++    PQE  +     F +LW+LL I Y  F RTT   H+ +V+  +  +  +  IY+G  +G YCV+CEE        ++E D   DK      +  ++ ++EE+YF ++ ++++ + + +  +P+ + P +R NE+  SF+      D SISR N  WG  + +NPKH +YVW DALL Y++ L     +   ++   ++W       + L+ K+I RFH +YWP ML   GL  P +   HG++  +  KM KSLGN LDP   ++ +G DA RYY LKE+    D  + E   +N  N DLAN++GNL NR++ M  +Y    IP  S    + N    +Q +   D + +  ++L   +   +++ L+   N +++Q  PW   K+  +  ++  L  +L +V+   Y+L P++   S+E  +Q  +
  S:     5 FALTTPLYYVNDVPHIGSAYTTIAADAIARFHRLQGDRVLMITGSDEHGQKIQRTAEKNGKPPQEHCNAIVARFQDLWQLLNIRYDRFSRTTDPRHQAIVEVFYRRVEAQGDIYVGRQQGWYCVACEE-------FKEERDLLEDKRCPIHTNQAVEWRDEENYFFRLSRYQEALEAHYAANPDFIQPESRRNEVL-SFVER-GLQDFSISRVNLEWGFAVPDNPKHTLYVWFDALLGYVTALLDPDAEPTLENALSQWWPIN----LHLIGKDILRFHAVYWPAMLLSAGLPLPDRVFGHGFLTKDGLKMGKSLGNTLDPFDLVDRFGSDAVRYYFLKEIEFGRDGDYQETRFVNVVNADLANDLGNLLNRTLSMAKRYCQLQIPLGSTAIAADN-PLRQQGEALTDSVKSAYDRLAFSEACGQILALVQAGNRYLDQEAPWTRFKQGEQAKVEEILYTVLESVRLAAYWLSPLVPGISQEIYRQLGL 479
>gi|90417681|ref|ZP_01225593.1| methionyl-tRNA synthetase [Aurantimonas sp. SI85-9A1] >gi|90337353|gb|EAS51004.1| methionyl-tRNA synthetase [Aurantimonas sp. SI85-9A1] (515 aa)
Score = 784, Expect = 6.2e-81, Identities = 167/518 (32%), Positives = 288/518 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI--DSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESED 1086
           ++FY+TT I YP+G PHIGHA+  +  D L R+K+  GY+ FF+TG DEHG K+ + A+E  + P EL  + +  F+ +  LLG     FIRT+ + H    Q  ++++     +Y   + G Y V  E  Y ++    +E D K Y  Q  P+    EESYF K+ +F+  + +  +D P+ + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NYL+  G+ ++ + +   +W +     + ++ K+I RFH +YWP  L   GL  P +  +HG++     KMSKS+GNV+DP   ++ YG D  RY+LL+E+   +D  +S + ++N  N +LAN++GNL  RS+ M+ K+    +P      +  +            ++ T+I++  +  +L+ +I +++E N +    +PW L+K +  + ++  L +    ++RV   L+P + + + + L    +  D+  F+ +   D        +  P+PI+ R +++ED
  S:     3 ERFYLTTAISYPNGRPHIGHAYEFIATDALARFKRLDGYDVFFLTGTDEHGIKMLQSAREQGISPAELARRNSAEFEAMAALLGGTNDDFIRTSEDRHVAASQAIWTKMAAAGDVYKDAYSGWYSVRDEAYYGEDETELRE-DGKRYGPQGSPVEWVAEESYFFKLSEFQDRLLALYEDNPDFIGPAERRNEVM-SFVRSG-LRDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYLTATGFPEEGERS--AYWPAD----LHVIGKDIVRFHTVYWPAFLMSAGLPVPRRVYAHGFLFNRGEKMSKSVGNVIDPAALVDVYGLDRLRYFLLREVPFGQDGNYSHEAIVNRTNSELANDLGNLAQRSLSMVGKHCGAKVPT-PGAFIEADTAILTAANDLLPKVRTMIDRQELHGVLAAIIAVVSEANRYFAGQEPWALRKSDPAR-METVLFVTAEFLRRVAILLQPFVPESAGKLLDILGVGPDARTFN-ELTPDVRLAPGADLPAPQPIFPRFVDAED 512
>gi|188527820|ref|YP_001910507.1| methionyl-tRNA synthetase [Helicobacter pylori Shi470] >gi|188144060|gb|ACD48477.1| methionyl-tRNA synthetase [Helicobacter pylori Shi470] (662 aa)
Score = 783, Expect = 7.9e-81, Identities = 198/520 (38%), Positives = 286/520 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQ-LHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           M+K  ITTPIYY +  PHIGHA+TTLIAD L +Y    G E FF+TG DEHGQKIE+ A+  N  P+   D  + +F + W    ++Y  FIRTT   H+  VQ  F  + +K  IY G + G YCVSCE      I+     +DK+ C   L      EEESYF ++  ++K +  F  K+P  + P+ R NE+  SF+      DLSI+R++F WGI + +   +PKHVVYVWLDALLNY S LGY    D+    F  ++      ++ K+I RFH IYWP  L  L L    +   HGW   E  KMSKSLGNVLD       YG +  RY+LL+E+   +D  FS+K LI   N +L N++GNL NR +GM  KY +  + K +K    ++ E EK + Q  D   + + K+ + K L  + ++ +  N  I + +PW L K N  + L+  LSLI N + +  + L   +   + +    F+ + +  + +       L +  +   EP++ +IE  +K
  S:     1 MQKSLITTPIYYVNDVPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAYADSISAIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGAYSGYYCVSCESYCA--ISKADNTNDKVLCPDCLRETTLLEEESYFFRLSAYEKPLLDFYAKNPEAILPVYRKNEV-TSFIEQ-GLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYASALGYLNGLDNKMAHFACAR-----HIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGVKMSKSLGNVLDAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNLLNRLLGMAKKYFNHSL-KSAKITAYYSKELEK-VHQILDNANSFVPKMQLHKALEELFNVYDFLNKLIAKEEPWVLHKNNESEKLEALLSLIANTLLQSSFLLYAFMPKSAAKLASAFHAEITPHNYERFFKAKKLQDMILQDTEPLFSKIEKIEK 514
>gi|146318899|ref|YP_001198611.1| methionyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|145689705|gb|ABP90211.1| Methionyl-tRNA synthetase [Streptococcus suis 05ZYH33] (602 aa)
Score = 783, Expect = 8.1e-81, Identities = 163/457 (35%), Positives = 267/457 (58%)
  Q:   631 LKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI---AVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDN--QKINTPEPIYLRIESEDK 1087
           + PQ  VD  A     LW LL I Y  FIRTT +YH+ VV   F +LL +D IYLG + G Y VS EE +T++      R EN           H +    EESYFL++ +++ K +  F   P+ + P  R+NE+  +F+     +DL++SR++F+WG+ +  NPKHVVYVW+DALLNY + LGY Q++  N+ KFWN     +  ++ K+I RFH IYWPIML ML ++ P + ++HGW + + GKMSKS GNV+ P   +  +G D  RYYL++ L +  D  F+ +  ++  N +LAN++GNL NR++ MINKY  G +P +      F+ +    +          +E ++  + L  V ++I+  N +I++  PW L K+  ++D L   ++ +   ++ V + ++P ++  S   ++Q  + ++ FD++ + DF+ L      +    PI+ R++ E++
  S:     1 MTPQAYVDGMAVGVKELWNLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGKVTGGIAPSGHEVAWVSEESYFLRLSKYQDKLVEFFNAHPDFIQPAGRLNEIMKNFIE-PGLEDLAVSRTSFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQEETVNYDKFWN---GTVYHMVGKDILRFHSIYWPIMLMMLDMKLPDRLVAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVDRINYELANDLGNLLNRTVAMINKYFGGQVPTFVANVTDFDADLAAVVADNLASYHKYMEAVDYPRALEAVWNIISRTNKYIDETAPWVLAKDEADRDKLAAVMAHLTAGLRVVAHLIQPFMMTTSNAIMEQLGLGTA-FDLENL-DFAGLPAGLTVVAKGTPIFPRLDMEEE 460
>gi|153009409|ref|YP_001370624.1| methionyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188] >gi|151561297|gb|ABS14795.1| methionyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188] (515 aa)
Score = 782, Expect = 1.2e-80, Identities = 173/519 (33%), Positives = 282/519 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + FF+TG DEHG K+ + A++  + P+EL D+    F  +  +L      +IRT+ E H    Q  +  +     IY G + G Y V  E  Y +     +E D   Y  Q  P+   EEESYF ++  ++ K +  + K+P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W + DA I+    K+I+RFH +YWP  L   G+  P +  +HG++     KMSKSLGNV+DP   +  YG D  RY+L++E+   +D  +S   ++N  N DLAN++GNL  RS+ MI K  +G +P   +    F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    I + K     VT    +    +  P+P++ R +E+E++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGKDVFFLTGTDEHGIKMLQSARKEGITPRELADRNTAAFRQMADVLNSSNDDYIRTSEERHYKASQAIWKAMAGNGDIYKGGYAGWYSVRDEAYYGEEETEVRE-DGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYEKNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTSDEKW-GYWPA-DAHII---GKDISRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRGEKMSKSLGNVIDPFGLVERYGLDQLRYFLMREVPFGQDGSYSHDAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPVPGE----FSDADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVIRRVGIMVQPFIPQSAEKLLDILAIPADKRQFSDVTASQLVGGADLPAPQPVFPRYVETEEQ 514
>gi|15645045|ref|NP_207215.1| methionyl-tRNA synthetase [Helicobacter pylori 26695] >gi|2501030|sp|P56127|SYM_HELPY Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|2313521|gb|AAD07483.1| methionyl-tRNA synthetase (metS) [Helicobacter pylori 26695] (650 aa)
Score = 782, Expect = 1.2e-80, Identities = 199/520 (38%), Positives = 287/520 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQ-LHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           M+K  ITTPIYY +  PHIGHA+TTLIAD L +Y    G E FF+TG DEHGQKIE+ A+  N  P+   D  + +F + W    ++Y  FIRTT   H+  VQ  F  + +K  IY G + G YCVSCE      I+     +DK+ C   L      EEESYF ++  ++K +  F  K+P  + P+ R NE+  SF+      DLSI+R++F WGI + +   +PKHVVYVWLDALLNY S LGY    D+    F  ++      ++ K+I RFH IYWP  L  L L    +   HGW   E  KMSKSLGNVLD       YG +  RY+LL+E+   +D  FS+K LI   N +L N++GNL NR +GM  KY +  + K +K    ++ E EK + Q  D   + + K+ + K L  + ++ +  N  I + +PW L K N  + L+  LSLI NA+ +  + L   +   + +    FN + +  + +       L +  +   EP++ ++E  +K
  S:     1 MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAYADSISTIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGAYSGYYCVSCESYCA--ISKADNTNDKVLCPDCLRETTLLEEESYFFRLSAYEKPLLDFYAKNPEAILPVYRKNEV-TSFIEQ-GLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYASALGYLNDLDNKMAHFECAR-----HIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGVKMSKSLGNVLDAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNLLNRLLGMAKKYFNHSL-KSTKITAYYSKELEK-VHQILDNANSFVPKMQLHKALEELFNVYDFLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAVKLANAFNTEITPDNYERFFKAKKLQDMILQDTEPLFSKMEKIEK 514
>gi|167052360|ref|ZP_02278758.1| methionyl-tRNA synthetase [Listeria monocytogenes FSL F2-515] (345 aa)
Score = 782, Expect = 1.3e-80, Identities = 163/338 (48%), Positives = 222/338 (65%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNI--AVRKENDDKLYCAQLHPLIQKE---EESYFLKIKQFKKYISSFLKDPNLVYPITRIN----ELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKEL 903
           E    FYITTPIYYPSG  HIGHA+TT+  D + RYK+  GY+ F++TG DEHGQKI+ KAKE  +  QE VD+ A+ F  LWK L I  + FIRTT + HK  V++ F +LL++  IYLG ++G Y VS EE +T+     V K+ + K+   +     + E   EESYF ++    KY    ++  N +  ++ +N    E+ N+F+     +DL++SR+ F WGI++  NPKHVVYVW+DAL NY++ LGY   +D+ FQK+W +     VQ++ KEI RFH IYWPIML  L L  P     HGWI+ + GKMSKS GNV+DP   I+ YG DA RYYLL+E+
  S:     3 EEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFKQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRM---SKYADRLVEYYNPIQNLSFLNPEKIEMINNFI-KPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPAD----VQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREV 341
>gi|149184557|ref|ZP_01862875.1| methionyl-tRNA synthetase [Erythrobacter sp. SD-21] >gi|148831877|gb|EDL50310.1| methionyl-tRNA synthetase [Erythrobacter sp. SD-21] (519 aa)
Score = 781, Expect = 1.3e-80, Identities = 168/513 (32%), Positives = 280/513 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTD---FSSL--DNQKINTPEPIYLRIE 1083
           +YITT I+YP+G PHIGHA+ T+ ADV+ R+++ +G +  F TG DEHG K+ +KA++L   P+EL D+ +  F +L+  L I Y  FIRTT E H    +  +  +  K  +YL  ++G Y V  E  Y +   V  E  + L   Q  P+   EEE++F ++ ++ + +   L  P  + P +R NE+  +F+      DLS+SR++F WG+++     HV+YVW+DAL NY++G+GY    +  + K+W +     + L+ K+I RFH +YWP  L    +  P +   HG+++    K SKS GNV DPI  I+ +G D+ RY+L+ E+   +D  +S + L+N  N +LAN+ GNL  R++ MI+K  DG +  +        +    Q +   + +    E LN    +   +  +  CN ++++  PW LKK + E+ +   L  +L A++ +   ++PV+   +   L Q  +   +     ++D   F SL      +  P P + R+E
  S:     5 YYITTAIHYPNGKPHIGHAYETVAADVIARFQRLMGRDVRFQTGTDEHGLKMAQKARDLGKTPRELADEMSGAFKDLFDRLDITYDRFIRTTDEDHHKASRAIWEAMEAKSDLYLDRYEGWYSVRDEAYYDEKELVEGEGGEML-SPQGTPVEWTEEETWFFRLSKYAEPLLELLNTPGFLEPASRRNEMI-AFVEG-GLKDLSVSRTSFDWGVKVPGADNHVMYVWVDALTNYITGVGYPDGGEM-WDKYWPAS----LHLIGKDIVRFHTVYWPAFLMSANIPLPKQVFGHGFLLNRGVKESKSAGNVTDPIELIDLFGVDSLRYFLMAEVVFGKDGSYSAEALVNKVNAELANSFGNLAQRTLSMIHKNMDGKLETFETNGDDKTLLATVQ-EACRETLPREFEALNFSVGIEAWLKAVFACNAYVDEQAPWGLKKSDPER-MKAVLQTLLLAIRDLAIAIQPVVPTKAAAVLDQLGVTPDRRSYADLSDEGWFGSLVAAGHVVEKPTPAFPRLE 512
>gi|46199235|ref|YP_004902.1| methionyl-tRNA synthetase [Thermus thermophilus HB27] >gi|46196860|gb|AAS81275.1| methionyl-tRNA synthetase [Thermus thermophilus HB27] (618 aa)
Score = 781, Expect = 1.4e-80, Identities = 169/476 (35%), Positives = 267/476 (56%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV YVW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+      K+L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|33303701|gb|AAP22258.1| methionyl-tRNA synthetase [Bacillus cereus] (397 aa)
Score = 781, Expect = 1.5e-80, Identities = 163/395 (41%), Positives = 243/395 (61%)
  Q:   598 LTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRK-ENDDKLYCAQL----HPLIQKEEESYFLKIKQFKKYISSFLK----DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLI 992
           + RYK+  GY   ++TG DEHGQKI++KA+ELN+ PQ  VD        LW+ + I Y  FIRTT + HK+VV++ F +L+ +  IYL  ++G Y V  E  YT++  V      DK+   +     H +    EESYF ++    KY+   LK    +P+ + P +R NE+ N+F+     +DL++SR++F WG+++  NPKHV+YVW+DAL NY++ LGY  +++  ++KFW +     V L+ KEI RFH IYWPI+L  L L  P K  +HGWI+ + GKMSKS GNV+DP+  I+ YG DA RYYLL+E+    D VF+ +  +   N DLAN++GNL NR++ MI+KY +G IP + +    F+       K    ++   +E +     LS +  L+
  S:     2 MARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDRGHDVELVREESYFFRMG---KYVDRLLKFYEENPHFIQPESRKNEMINNFIK-PGLEDLAVSRTSFDWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPAD----VHLVGKEIVRFHTIYWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKENVTEFDETLVTFAKDTLKKVEEAMENMEFSVALSSIWQLV 397
>gi|114327741|ref|YP_744898.1| methionyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1] >gi|114315915|gb|ABI61975.1| methionyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1] (514 aa)
Score = 781, Expect = 1.5e-80, Identities = 172/516 (33%), Positives = 279/516 (54%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLDN-QKINTPEPIYLRIESE 1085
           ++Y TTPIYY +G PHIGHA+T +  DVL R+K+  G E FF+TG DEHGQK+E+ A +  + PQ  +D  A  F  + + +   +  FIRTT   HK  V   +S L ++  IYLG ++G Y V  E  Y ++    K  D K Y     P+ +  E SYF ++ ++   +    +D P+ + P  R NE+  SF+      DLSISR++FSWG+ +  + KHVVYVWLDAL NYL+ +GY   + S    FW +     + ++ K+I RFH I+WP  L   GL  P +  +HGW   E  KMSKSLGN ++P   ++ +G D  R++LL+E+    D  FS + +I   N +LAN++GNL  R++ +I +  DG +P     +   +    +       ++   I++    + L     +I   N +I++  PW LKK + ++  D  L ++ + ++ +   ++P +   +   L Q  + +++   + F    + L+   ++  P+ I+ R   E
  S:     4 RYYCTTPIYYVNGAPHIGHAYTCVATDVLARWKRLEGREVFFLTGTDEHGQKVEKAAADAGVDPQTFIDGMADGFRAMAEKMNTSHDRFIRTTEPEHKKAVAALWSRLEERGEIYLGSYEGWYAVRDEAFYGEDELTLKP-DGKRYAPTGAPVERVTEPSYFFRLSRWGDALLKLYEDQPDFIAPQARRNEVI-SFVKQ-GLTDLSISRTSFSWGVPVPGDAKHVVYVWLDALTNYLTAVGY-PDETSPAWPFWPAD----LHMVGKDILRFHAIFWPAFLMAAGLPLPRRVFAHGWWTVEGEKMSKSLGNTIEPGALVDEFGLDPVRFFLLREVPFGNDGDFSRRAMIGRMNTELANDLGNLAQRTLSLIARNCDGALPARGA-ETGEDATLLRDAASLPAKMGAQIDRQAFHEALEEAWKVIRAANGYIDRQAPWALKKTDPDRMRDV-LRVLADVLRIIATVMQPFVPGSAARMLVQLGVREAAGEQVPFAALETHLEEGTRLPAPQGIFPRFVDE 512
>gi|47459150|ref|YP_016012.1| methionyl-tRNA synthetase [Mycoplasma mobile 163K] >gi|47458479|gb|AAT27801.1| methionyl-tRNA synthetase [Mycoplasma mobile 163K] (509 aa)
Score = 781, Expect = 1.6e-80, Identities = 193/503 (38%), Positives = 298/503 (59%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLE---PVLIDGSKEALKQFNI------DSSKFDIKFVTDFSSLDNQ 1070
           MKKFYI+TPI+YP+G+ H+GH ++  IA  +  YKK  GY+T  +TG DEHGQKI + A++ NL P+  VD+ A+ F + WK   IEY  F+RTT + H +V+++  ++L + +FIY   ++GLY +S EE  TK  A ++ N    +    H L   +EESYFLKI QF+ ++  +L+D PN +     INEL ++FL N+  +DLSISR++F WGI+   + KH+ YVW+DAL +YLS L      +  F   WN  D E + ++ KEITRFH IYWPIML+ML L  P K +SHGW+IT  GKMSKS GN+++P+  +  +  +  + YLL   S+  D VF ++ +   +N  LANN GNL +R   + ++     I          +     ++++  ++  +  +   I K +  +I L NE N +++  K W LK  +++K L   L +++N +  +  YL+   P+ I+  +    Q N       +  KFD  F+    S+ N+
  S:     1 MKKFYISTPIFYPNGDLHLGHLYSMSIAWAIRNYKKLKGYQTLLLTGSDEHGQKIMQSAEKNNLSPKNFVDQQAEKFKSFWKKFDIEYDVFVRTTDKKHNSVIEKILTKLNENNFIYKSFYEGLYSISDEEFLTKTQA-KEVNGKFFHPVSNHELKIVKEESYFLKISQFQNWLKKYLEDYPNFISSQKVINELKSTFL-NEKLEDLSISRNSFDWGIKFSFDNKHIAYVWVDALFSYLSPLELFLNQE-KFNSSWND-DVEKIHVVGKEITRFHGIYWPIMLKMLNLPLPNKILSHGWLITSTGKMSKSKGNIVNPLDLLEEFDSETIKLYLLSAFSINRDGVFDKENIKFFYNSFLANNYGNLISRVSSLFSQNFSSKISWDQNSLDKIDYSILDKIEKSKEDFMSNFDNFEIDKAVEILIKLGNELNGYVDLTKAWLLK--DDKKRLATILLILINGIYAMSAYLKIFMPLKIEKIERDFFQQNASLENIENWKKFDDIFIKKIESIFNR 507
>gi|51473863|ref|YP_067620.1| methionyl-tRNA synthetase [Rickettsia typhi str. Wilmington] >gi|81826289|sp|Q68W54|SYM_RICTY Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|51460175|gb|AAU04138.1| methionine--tRNA ligase; MetRS.; Methionine translase.; Methionyl-tRNA synthetase.; Methionyl-transfer RNA synthetase.; Methionyl-transfer ribonucleate synthetase.; Methionyl-transfer ribonucleic acid synthetase. [Rickettsia typhi str. Wilmington] (507 aa)
Score = 780, Expect = 1.8e-80, Identities = 182/512 (35%), Positives = 284/512 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS--FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK-FVTDFSSLDNQKINTPEPIYLRI 1082
           +YITTPIYY +   HIGHA+T++ +DV+ R+ +  G +  F+TG DEHGQK+E+ A   N+ PQ   DK ++ F +L   + I    FIRTT   HK  V   + +LL    IY G ++G Y V  E  Y ++    +  +DKL      P+   +E SYF  + +++  +  F + +P+ V PI+R NE+  SF+ +    DLSISR+ F+WGI++  N KHV+YVWLDAL+NY+S LGY  +  SN+ KFW +     +Q++ K+I RFH +YWP  L    +  P   + HGW      K+SKSLGN +DPI  I+ +G D  RY+L++E+    D+ F+   LI   N +L+N +GNL +R +  +    D  +P      +   + +   K   +F  E   +++K+ I KIL  +I+L  + N +I    PW+LKK + +K L+   +L L  ++ V   L+P +   + + L Q  +   +   K  V D +      I  P  I+ +I
  S:     5 YYITTPIYYVNDVSHIGHAYTSVASDVIARFMRCCGKDVMFLTGTDEHGQKVEKAAINKNIDPQSFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWQKLLDNGAIYEGFYEGWYSVRDEAFYDES----EITEDKL-APTGAPVEWVKEPSYFFNLAKWQDKLLEFYELNPDFVRPISRRNEVI-SFVKS-GLKDLSISRTTFNWGIKVPNNEKHVIYVWLDALVNYISALGYPDQ-QSNYSKFWPAN----LQVVGKDILRFHAVYWPAFLMAAEISPPKSIMVHGWWTNAGQKISKSLGNTIDPITLIDEFGVDQVRYFLMREVIFGADANFTRNNLITRINSELSNKIGNLLHRIVSFVYNNNDAKVPLIKSGVIDKIYELPILKTAMKFAQENILLMDKIEINKILENIINLAEDANIYIANEAPWNLKKTDYDKMLEVLYTL-LEVLRYVAIMLQPFVPSSANKMLDQLGVAKEERLFKHLVRDHALKAGSNILEPSIIFPKI 507
>gi|85057769|ref|YP_456685.1| methionyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789874|gb|ABC65606.1| methiony-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] (520 aa)
Score = 780, Expect = 1.8e-80, Identities = 184/517 (35%), Positives = 299/517 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYR-QKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           KF+++T I Y SG PHIG+ +  ++AD + R+K+  G++ FF TG DEHGQKI  K+ +    PQE VD+ +     ++ L+ + Y  F++TT   HK  VQ  F +L KK  IYLG ++GLY VS EE+Y   +A +   D K    ++  LI   EE+YF KI +++ ++  +L+ +P+L+ P  +  EL N  L  +   DLS+SR++F WGI++  +PKHV+YVW+DAL NYL+GLGY    ++S F ++W       + ++ K+I RFH IYWPI+L  L +  P ++++H WI+ ++ KMSKS GNVL     +  +  D+ RY++L E+   +D   + +LL+   N DLAN +GNL +R  GMI  YR   + K      L    +  KQ       +   ++   +   L ++I+L    N +I+ V+PW+L K    ++ LD  L  ++ A++ +   L+P L   + + L Q  + +S    K +  F  L +QK++    ++ R+E ++
  S:    10 KFFLSTAIAYASGIPHIGNVYECILADAIARFKRLEGFDVFFQTGTDEHGQKIAAKSLQQGKNPQEYVDQISLEIKRIYDLMQVSYDKFVKTTNPNHKQTVQAIFDKLWKKGDIYLGKYQGLYSVS-EESY---VAPKDLIDGKTSNGEIPILIS--EETYFFKISKYQSHLLKYLENNPSLIKPDAQRKELLN--LLKEPLSDLSVSRTSFKWGIRVPFDPKHVIYVWIDALSNYLTGLGYNPTSENSQFNRYWPCD----MHVIGKDILRFHLIYWPILLMALEISLPKQFLTHPWILFDKNKMSKSKGNVLYVDDLLKHFPVDSIRYFVLSEIPYAQDGNITYELLVERHNSDLANVLGNLVHRVFGMIKIYRQNNLSKTLITSNLDPKFDLSKQTLATLPSVRLKMQDYKVGDALKKIINLARFANKYIDLVEPWNLFKNPEKQQLLDHTLYSLVEALRFLGVLLQPFLPQTANKILTQ--LKASDITFKSLDTFGILPSQKLDNYHILFNRLEIDE 516
>gi|148285047|ref|YP_001249137.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong] >gi|146740486|emb|CAM81042.1| methionyl-tRNA synthetase [Orientia tsutsugamushi Boryong] (511 aa)
Score = 780, Expect = 2.0e-80, Identities = 177/514 (34%), Positives = 288/514 (56%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQ---FDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSSLDNQKINTPEPIYLRIE 1083
           K+YITTPIYY +  PHIGHA+T+++ADV  R+ + LG E  F+TG DEHGQK+E+ A    + P+E VDK A  F  L   L +    FIRTT   H   VQ+ ++ L ++  IYLG + G Y +  E  Y+++       D K         +  EE SYF  + ++ +K +  +  + +++ P    NE+ N F+ N    DLSISR+ F WGI +  +  HV+YVWLDAL+NY+S LGY   + +    FW +     + ++ K+I RFH +YWP  L   GL  P   + HGW   E  K+SKS+GNV++P+   + +G D  RY+LL+E+++  D  FS+   IN  N +L N +GNL +R++  I KY    IP+     ++   + E  L +     D +  II+  N+  IL+R+++++N+ N + +Q  PW  K  N++K +   L  ++  ++ +   L+P + + +   L    I+ ++     + + ++    + I  P+PI+++IE
  S:     4 KYYITTPIYYVNDIPHIGHAYTSILADVYARFMRLLGKEVIFLTGTDEHGQKVEKAASNAGVSPKEFVDKIASSFVKLSVDLNLSNDDFIRTTDTRHIKAVQKLWNILKQQGDIYLGKYCGWYAIKDEAFYSES---ELTTDGKAPTGAEVEWV--EESSYFFALSKWQQKLLDWYENNHDIIKPAFFRNEVIN-FIKN-GLIDLSISRTTFKWGIAVPNDSSHVIYVWLDALVNYISALGYASDNGTLMTNFWPAD----LHIVGKDILRFHAVYWPAFLMSAGLPLPKAILVHGWWTNEGQKISKSVGNVINPVELTSKFGIDQVRYFLLREITIGNDGNFSKISFINRINSELCNKLGNLVHRTLSFIYKYNKAKIPQLDGITITNLYKSESLLLKIVMLSDNLANIIDNENVTVILNRIMEIVNQANIYFDQQTPWKFKDSNSQK-IATILYTLIETIRCIAILLQPFIPESANTILDLIAIEKTERTFSCINSSYAIKPGKTILEPKPIFVKIE 510
>gi|88608152|ref|YP_506759.1| methionyl-tRNA synthetase [Neorickettsia sennetsu str. Miyayama] >gi|88600321|gb|ABD45789.1| methionyl-tRNA synthetase [Neorickettsia sennetsu str. Miyayama] (503 aa)
Score = 780, Expect = 2.0e-80, Identities = 177/467 (37%), Positives = 268/467 (57%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISS-FLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD-DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITT----IIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEP 1036
           ++Y+TTP+YY + NPHIGHA+++LIADVLTR  +  G+E  F TG DEHGQK++  AK+      + V+  ++ F +L   +  ++S FIRTT   HK  VQ  +S L K + I LG + G Y    E  YT+      E  + L      P+   +E  YF K+ QF + +   + ++P  + P +R NE+  +FLN     DLSISR+   WGI + +NP H VYVWLDAL NY+S +GY     DS F  FW+  +A I+ ++ K+I RFH IYWP  L    L+ P   ++HGW + +  K+SKSLGN++DP   I+ +G D  RY+ ++E+++ +D  FS+  L    N +LA+N+GNL +R++ +          K   PK+S   E E +L +F   + T     IE L++   L R+I L N+ N +I   +PW LK++         L  +L A++ +   L+P
  S:     2 RYYVTTPVYYVNDNPHIGHAYSSLIADVLTRALRLAGHEVRFTTGTDEHGQKVQNTAKKHGKCEIDFVNHVSRRFRDLCVAMHYDFSDFIRTTETRHKEAVQTLWSTLSKNNSISLGEYSGWYSERDEAFYTE-----AELQNSL-APTGSPVSWTKEACYFFKLSQFSEPLKKLYAENPTFIQPKSRFNEML-AFLNT-GMHDLSISRTRVQWGINVPDNPTHTVYVWLDALTNYISSVGYPNTSADSLFSAFWD--NARIIHIIGKDILRFHSIYWPAFLTAANLKTPDVILAHGWWLNDGEKISKSLGNIIDPFELISEFGVDPVRYFFIREITVGKDGNFSKVNLKERINSELADNIGNLLHRTLTL--------TAKLLGPKVSEIYESENELLEFAYSLATEYKNDIELLDLNSSLDRIIQLSNKANEYISMEEPWKLKEKPETAGR--ILHSVLEALRIIAIGLQP 454
>gi|78777263|ref|YP_393578.1| methionyl-tRNA synthetase [Sulfurimonas denitrificans DSM 1251] >gi|78497803|gb|ABB44343.1| methionyl-tRNA synthetase [Sulfurimonas denitrificans DSM 1251] (644 aa)
Score = 779, Expect = 2.6e-80, Identities = 177/467 (37%), Positives = 266/467 (56%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIK---ENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEI---TTIIEKLNI-------QKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           YITTPIYY +G  HIGHA+TT IAD L RY+K  G +T+F+TG DEHGQKIEE A++ +   QE  D+ +  F NLW    I Y  FIRTT   HK  VQ  F  +  K  IY   ++G YCVSCE  +T+   V  E      C +   +++  EESYF ++ +++   +  + ++P+ + P +R NE+ N         DLS++R++F+WG+ +    ++ KHV+YVWLDAL+NY++ LGY   +++   ++W +     VQ + K+I RFH IYWP  L  + L  P    +HGW   +  KMSKS GNV+ P    + YG +  RY++L+E+   +D  FS++  I+  N +L+N++GNL NR IGM  KY D            F IE    LK    EI     +++ L+I        + L  +  L +  N  IE+  PW   K+  + +    ++L+ N + +    L PV+
  S:     4 YITTPIYYVNGEAHIGHAYTTFIADTLARYEKLKGEDTYFLTGTDEHGQKIEESAQKNSKPTQEFADEISASFKNLWDEFDISYDKFIRTTDAEHKKGVQRAFEVMYAKGDIYKDFYEGHYCVSCETFFTETQLVDGEFCPD--CGRSTNIVK--EESYFFRLSKYENALLKHYEENPDFILPRSRANEVIN--FVKGGLRDLSVTRTSFTWGVGMPNSIKDDKHVMYVWLDALMNYITALGYGTTEEN--MRYWPAS----VQFVGKDILRFHAIYWPAFLMSIDLPLPQHIGAHGWWTRDGEKMSKSKGNVISPKQVADVYGVENLRYFMLREVPFGQDGDFSQRAFIDRINSELSNDLGNLLNRIIGMSGKYSD------------FEIESVNVLKYHKKEIDAMNVVLDSLDIFMKNFQTHRYLEELWKLFSIGNKAIEEHAPWVKMKDGKKDEALSTVALVANILAKASIMLHPVM 460
>gi|85715531|ref|ZP_01046512.1| methionine--tRNA ligase [Nitrobacter sp. Nb-311A] >gi|85697726|gb|EAQ35602.1| methionine--tRNA ligase [Nitrobacter sp. Nb-311A] (695 aa)
Score = 779, Expect = 2.8e-80, Identities = 166/485 (34%), Positives = 269/485 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           FYITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHGQK+ + A+  N+   EL  + A++   L + L I +  FIRT+   H   VQE +  + +   IYL  + G Y V  E  Y ++  +  E D+     Q  P+   EE+SYF K+  ++ + ++ +  +P+ + P +R NE+  SF+      DLSISR+NF WGI++ ++P+HV+YVW+DAL NY++G+G+  +D+SN+ +FW +     V ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP      YG D  RY+ L+E+    D  ++ + ++   N DLAN+ GNL  RS+ MI K   G++P+       F+   +  L Q D  I    E +  Q+I   L+ +  ++ E N +     PW L K +  +     L +    V+++    +P + +   + L    I + +
  S:   186 FYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQRENISALELATRNAELLRKLDETLHISFDRFIRTSESAHHRSVQEIWKRMAENGDIYLSNYSGWYSVRDEAYYAEDETIVGE-DNVRRGPQGTPVEWVEEKSYFFKLASYQDRLLALYESEPDFIGPDSRRNEVV-SFVKG-GLKDLSISRTNFDWGIKVPDDPEHVMYVWVDALTNYITGVGFPNEDESNW-RFWPAG----VHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMSKSVGNVVDPFSLAAQYGVDQMRYFFLREVPFGHDGSYNHEAIVARINADLANDFGNLAQRSLSMIAKQHGGVLPEPG----DFSDSDKAILAQADGMIAVAREAMKTQQIHQALNAIWAVVAEANRYFAGEAPWVLAKTDPARQ-RTVLYVTAEVVRQIAILAQPAMPEACAKMLDILGIPTDE 661
>gi|110633935|ref|YP_674143.1| methionyl-tRNA synthetase [Mesorhizobium sp. BNC1] >gi|110284919|gb|ABG62978.1| methionyl-tRNA synthetase [Mesorhizobium sp. BNC1] (517 aa)
Score = 777, Expect = 3.8e-80, Identities = 174/517 (33%), Positives = 281/517 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR-IESE 1085
           + FYITT I YP+G PHIGHA+  +  D L R+++  G +  F+TG DEHG K+ + A++  +   EL D+ A  F  + KLL      FIRTT E H+   Q  +  +  +  IYLG + G Y V  E  Y ++   R   D   Y  Q  P+   EEESYF ++  ++ + +  + ++P+ + P  R NE+  SF+ +    DLSISR+ F WG+ +  + KHV+YVW+DAL NY++ LGY  +D   + ++W +     V ++ K+I RFH IYWP  L   G+  P +   HG++     KMSKS+GNV+DP   I  YG D  RY+ L+E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  DG +P  ++ +LS        L Q +  + T    +  Q I   L+ + D++ E N +    +PW L+K +  + ++  L      ++R+    +P +   +++ L   ++   +     V + + L     +  P+P++ R +E E
  S:     4 ETFYITTAISYPNGRPHIGHAYELIATDALARFQRCDGKDVMFLTGTDEHGIKMLQTARKEGITAGELADRNAPEFQRMAKLLNASNDDFIRTTEERHRTASQAIWKAMADRGDIYLGGYSGWYSVRDEAYYGED-ETRVGEDGVRYGPQGTPVEWVEEESYFFRLSAYQERLLKLYEENPDFIGPAERRNEIV-SFVRSG-LRDLSISRTTFDWGVPVPGDEKHVMYVWVDALTNYITALGYPDQDAERW-RYWPAD----VHIIGKDIIRFHAIYWPAFLMSAGIALPKRVFGHGFLFNRGEKMSKSVGNVIDPFTMIEHYGLDQVRYFFLREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCDGKVP--ARGELS--AADRAILDQAEAALATARGAMGRQAIHAALAAIFDVVAEANRYFAAQEPWALRKTDPAR-METVLYTTAETLRRIAILCQPFIPSSAEKLLDLLSVPQDRRGFADVGETAMLAPGTPLPAPQPVFPRYVEQE 513
>gi|189183674|ref|YP_001937459.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda] >gi|189180445|dbj|BAG40225.1| methionyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda] (511 aa)
Score = 777, Expect = 4.1e-80, Identities = 178/514 (34%), Positives = 286/514 (55%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQ---FDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQK-INTPEPIYLRIE 1083
           K+YITTPIYY +  PHIGHA+T+++ADV  R+ + LG E  F+TG DEHGQK+E+ A    + P+E VDK A  F  L   L +    FIRTT   H   VQ+ +  L ++  IYLG + G Y +  E  Y+++       D K         +  EE SYF  + ++ +K +  +  + +++ P    NE+ N F+ N    DLSISR+ F WGI +  +  HV+YVWLDAL+NY+S LGY   + +    FW +     + ++ K+I RFH +YWP  L   GL  P   + HGW   E  K+SKS+GNV++P+   + +G D  RY+LL+E+++  D  F++   IN  N +L N +GNL +R++  I KY    IP+     ++   + E  L +     D +  II+  N+  IL+R+++++N+ N + +Q  PW  K  N++K +   L  ++  ++ +   L+P + + +   L    ID ++     +    ++   K I  P+PI+++IE
  S:     4 KYYITTPIYYVNDIPHIGHAYTSILADVYARFMRLLGKEVIFLTGTDEHGQKVEKAASNAGVSPKEFVDKIASSFVKLSVDLNLSNDDFIRTTDTKHIKAVQKLWKVLEQQGDIYLGKYCGWYAIKDEAFYSES---ELTTDGKAPTGAEVEWV--EESSYFFALSKWQQKLLDWYENNHDIIKPAFFRNEVIN-FIKN-GLIDLSISRTTFKWGIAVPNDSSHVIYVWLDALVNYISALGYASDNGTLMTNFWPAD----LHIVGKDILRFHAVYWPAFLMSAGLPLPKAILVHGWWTNEGQKISKSVGNVINPVELTSKFGIDQVRYFLLREITIGNDGNFNKISFINRINSELCNKLGNLVHRTLSFIYKYNKAKIPQLDGITITNLYKSESLLLKIVMLSDNLANIIDNENVTVILNRIMEIVNQANIYFDQQAPWKFKDSNSQK-IATILYTLIETIRCIAILLQPFIPESANTILDLIAIDKTERMFSCINRSHAIKPGKTILEPKPIFVKIE 510
>gi|90424203|ref|YP_532573.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB18] >gi|90106217|gb|ABD88254.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisB18] (522 aa)
Score = 777, Expect = 4.6e-80, Identities = 167/511 (32%), Positives = 277/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT---TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLR 1081
           ++++TPI+YP+G PHIGHA+T +++D + R+++  GY+  F+TG DEHG K+++ A    L P +L D+ +  F ++   L I Y  +IRTT   H+   Q  ++ +     IYL  + G Y V  E  + +  A     +D +    L  P+   EEE+YF ++  ++ K +  + K P+ V P  R+NE+  SF+      DLSISR+ F WGI++   P+HV+YVW+DAL NY++G GY   D  +F+++W +     + ++ K+I RFH +YWP  L   G+  P +  SHG+++    KMSKS+GNV+DP      YG D  RY+ ++E+S  +D  ++ + ++N  N DLAN++GNL  RS+ MI K   G++P+       F+   +  L Q D  I    T +    I  +L+ V  ++ E N +     PW L K +  +     L +    +++V    +PV+   + + L    I   + D   +     +     +  P PI+ R
  S:    12 YFLSTPIFYPNGVPHIGHAYTAMVSDAIARFQRLDGYDVRFLTGTDEHGLKMQQTAIAEGLTPLQLADRNSARFRDMMAALNISYDDYIRTTEPRHERSCQALWTAIENNGDIYLDKYAGWYSVRQEAYFDE--AETTVGEDGVRREPLGSPVEWTEEETYFFRLSAYQDKLLELYAKVPDFVLPRERLNEV-ASFVKGG-LQDLSISRTTFDWGIKVPGAPRHVMYVWIDALTNYITGAGYPDVDSDSFKRYWPAS----LHVIGKDIVRFHAVYWPAFLMSAGVAVPQRVFSHGFLLNRGEKMSKSVGNVVDPFEMAKQYGVDQMRYFFMREVSFGQDGSYNHEAIVNRTNADLANDLGNLAQRSLTMIGKQLGGVLPEPG----DFSDNDKAILAQADAMIELARTAMATQQIHHMLNAVWAVVAEANRYFAGEAPWALAKTDPARQ-KTVLYVTAEVLRQVAILAQPVMPASAAKLLDSLGIAEEERDFTHLGGHERIRPGTPLPAPAPIFPR 515
>gi|162147584|ref|YP_001602045.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5] >gi|187595983|ref|ZP_02982246.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5] >gi|161786161|emb|CAP55743.1| Methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5] >gi|187491817|gb|EDU29755.1| methionyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5] (512 aa)
Score = 775, Expect = 6.4e-80, Identities = 171/519 (32%), Positives = 282/519 (54%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-----DNQKINTPEPIYLR-IESE 1085
           + +++Y+TTPIYY +G PHIGHA+T++ AD++ R+K+  G++ FF+TG DEHGQK+E+ A+   L P    D+ +  F  ++ ++ + Y  FIRTT   H       +  +     IYLG ++G Y +  E  Y ++  V + +  ++      P+    E SYF ++  F  + +  +   P  V P +R NE+  SF+      DLSISR++F WGI +  +  HV+YVW+DAL NYLS +G+    +     FW +     + L+ K+I RFH IYWP +L   GL  P    SHGW   E  KMSKSLGNV+DP   +  +G D  R++L++E+    DS  S K +IN  N +LAN++GNL  R++  + +   G++P+    +   +I    Q       +   I++  +   L  V  +I  CN +I++  PW LKK + ++ +   L ++++A++ +   L+P +       L Q  +   +       DF+SL       + +  P+ I+ R +E+E
  S:     1 MTRRYYVTTPIYYVNGAPHIGHAYTSVAADIVARFKRLAGFDVFFLTGTDEHGQKVEQAAQAAGLAPIAFADRVSADFRAMYDVMNVSYDDFIRTTEPRHIAGATALWERIAANGHIYLGAYEGWYALRDESFYNEDELVTQPDGTRV-APTGAPVEWVREPSYFFRLSAFADRLLDLYETRPGFVEPASRRNEV-ASFVRQ-GLRDLSISRTSFRWGIPVPGDADHVMYVWVDALANYLSAIGFPDARNPR-AGFWPAN----LHLVGKDIVRFHAIYWPALLMAAGLDLPDCVFSHGWWTIEGEKMSKSLGNVVDPRDLVAEFGLDPVRFFLMREMPFGGDSDLSRKAIINRMNVELANDLGNLAQRTLSQVARNCGGLLPEQGT-RTDDDIALLAQADLLPTLMHEQIDRRALTDALEEVWRVIRACNAYIDRQAPWALKKTDPDR-MAVVLRVLVDALRGIGTMLQPYMPGSMDALLTQLGVAEDE------RDFASLATPLPGGRALPPPQGIFPRYVEAE 510
>gi|55981267|ref|YP_144564.1| methionyl-tRNA synthetase [Thermus thermophilus HB8] >gi|62296622|sp|P23395|SYM_THET8 Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|55772680|dbj|BAD71121.1| methionyl-tRNA synthetase [Thermus thermophilus HB8] (618 aa)
Score = 775, Expect = 8.1e-80, Identities = 168/476 (35%), Positives = 266/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV YVW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+       +L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|68543|pir||SYTWMT methionine-tRNA ligase (EC 6.1.1.10) - Thermus aquaticus >gi|155136|gb|AAA27510.1| transfer RNA-Met synthetase (616 aa)
Score = 775, Expect = 8.1e-80, Identities = 168/476 (35%), Positives = 266/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV YVW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+       +L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|157829738|pdb|1A8H|A Chain A, Methionyl-Trna Synthetase From Thermus Thermophilus (500 aa)
Score = 775, Expect = 8.1e-80, Identities = 168/476 (35%), Positives = 266/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV YVW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+       +L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|15806450|ref|NP_295156.1| methionyl-tRNA synthetase [Deinococcus radiodurans R1] >gi|25009407|sp|Q9RUF3|SYM_DEIRA Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|6459194|gb|AAF11005.1|AE001988_1 methionyl-tRNA synthetase [Deinococcus radiodurans R1] (681 aa)
Score = 774, Expect = 9.9e-80, Identities = 166/491 (33%), Positives = 264/491 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYA-KVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYI-SSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK 1059
           ++F+IT  I Y +G PHIGH +  ++AD + RY++  G +  F+ G DEHG+KI + A +  + PQELVD  + + F  LWK LGI Y  FIRTT+  HK  VQ+    +     IY   ++GLY V  E   T+   V   +  + +     P   + E +YF  +++++ ++  +  ++P+L+ P    NE+       +D   LSISR  +   WGI++  +  HV YVW DALL+YL+ L  + +D S   K W+        ++ K+I + H ++WP ML   GL    + + H  I+ E G KM KSLGN +DP   +  +  DA RY LL+E SL  DS F E +L++  N DLAN++GNL +R++ MI KYR G+IP  ++P      E E   +   DE+  ++++L I   +   +  + + N +I +  PW L K    +  LD  L      ++     LE V+   +KE  +Q  +    + ++
  S:    18 REFFITAAIDYANGTPHIGHVYEKILADAIARYQRLAGRDVTFVMGTDEHGEKISKAAAKGGVTPQELVDDLSERAFQGLWKKLGISYDFFIRTTSAKHKKYVQDVLQRVYDAGDIYFAEYEGLYSVGAERYVTEKELVEGPDGVRRFPGDKDPPELRREANYFFNMQKYQPWLLETLQQNPDLIQPAGYRNEVLEML--KEDIGPLSISRPKARVPWGIELPWDTDHVTYVWFDALLSYLTPLVSQGQDASMSGKAWH--------VIGKDILKPHAVFWPTMLRAAGLPLYRRLVVHSHILAEDGRKMGKSLGNAIDPEELVAAWPVDAIRYALLREASLGADSPFGEGVLVSRLNSDLANDLGNLLSRTVSMIQKYRGGVIPAATEPT-DREREIEAAARALPDEVLRLVDELKINMAIDAAMSFVRDLNRYIAESTPWTLAKSPETQGRLDTVLYTAAEGLRVASVALEAVIPTKAKELREQLGLGRQGYPLQ 503
>gi|195952737|ref|YP_002121027.1| methionyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] >gi|195932349|gb|ACG57049.1| methionyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] (493 aa)
Score = 774, Expect = 1.1e-79, Identities = 187/514 (36%), Positives = 288/514 (56%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHP----LIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           KFY+TTPIYY +  PHIGHA+TT+ AD + RYK++ G++ FF+TG DEHG K+++ A+E  + P+EL DK  + F NLW  L I Y H IRTT +YHK  VQE  +++ ++  IY G ++G YCV CEE          E  D  Y   +H     LI+  EE+YF K+ +++  +   L + + + P  R  E+  +F+      DLSI+R     SWGI++  +  HV+YVW DAL NY+S L ++ K      +FW +       ++ K+I RFH +YWP  L  L +  P    +HGW   E  KMSKSLGNV++P   +N YG D  RY+LL+E++  +D  FS++ +    N +LAN +GNL +R+  M  KY  GII    K  +  + +++K   +  +     + +L   K L  V+ L++  N ++++  PW L K N+    D  L+LI + +    + L P + +  KE      +    +DI     + S+D + I T   ++ +IE
  S:     2 KFYVTTPIYYVNDVPHIGHAYTTIAADTIARYKRQKGFDVFFLTGTDEHGLKLQKAAEEKGMTPKELCDKNFENFKNLWDFLKISYDHIIRTTDDYHKAYVQEVITKVYERGDIYKGYYEGYYCVGCEE-----FKPESEIKDFDYSCPIHKKKCELIK--EETYFFKLSKYQDKLLE-LYETDFIKPDYRKEEVI-AFVRQ-GLKDLSITRPKERVSWGIELPFDKNHVIYVWFDALFNYISALKFKNK-----LEFWPAD----FHIVGKDILRFHAVYWPAFLMSLDMELPKHVYAHGWWTVEGQKMSKSLGNVINPYDVVNEYGLDETRYFLLREVAFGQDGDFSKEAVKRRINGELANGIGNLISRTFAMCIKY--GII---KKDDIKEDEDYKKIAIEVLEAFDKYMNELQFHKALEEVMKLVDYLNKYVDEKAPWTLAKNNDPSLKDVLLTLI-DGILLSCWMLNPFMPNKMKEVFDALGV--KIYDITSPKPY-SIDFEAIKTKINLFPKIE 493
>gi|124025722|ref|YP_001014838.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A] >gi|123960790|gb|ABM75573.1| Methionyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A] (516 aa)
Score = 773, Expect = 1.3e-79, Identities = 179/514 (34%), Positives = 277/514 (53%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHP--LIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF-LSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIE 1083
           K+ ITTP+YY +  PH+G ++TT+  D + R+++  G    F+TG+DEHGQKIE  A+  NL+PQ   D+  + +  LW  L I Y  F+RTT+  H ++V + +S++LK D +Y+G   G YCV CEE   K++    E+ DK     +H   L  ++EE+ F K+ +++  I   +     + P +R NE+ N    +    D SISR N  WGI++  N  H  YVW DALL Y+SG    Q      +K   +  A    ++ K+I RFH +YWP ML   G++ P     HG++  E  KM KSLGNVLDPI  +   G DA R+YLL+++   ED  F  +  ++  N DL N +GNL NR+I M  K+    IP  +       ++ + + K    E     +  N +   + +IDL N  N ++    PW L K+ + K++    +  +L + + +   L P++ + S   LKQ NID+S  + K    +  LD N ++  P P+  +IE
  S:     4 KYTITTPLYYVNDKPHLGSSYTTIACDAIARFERLNGNTVLFLTGVDEHGQKIERTAESKNLEPQLHCDEITEKYKYLWDKLNISYDRFVRTTSIEHTSLVHQFYSKVLKSDDVYMGRQSGWYCVGCEE--YKDV----EDKDKSPICSIHKKELEWRDEENLFFKLSKYQDQIEKLINVDGFISPKSRKNEIIN--FVSKGLRDFSISRVNLKWGIKVPGNKDHTFYVWFDALLGYVSGSLNDQCSPELTEKSLCNWPAN-RHVIGKDILRFHAVYWPAMLLSAGMKTPRSVFGHGFLTREGQKMGKSLGNVLDPIELLEYGGIDAMRWYLLRDIEFGEDGDFQMRRFVDIVNSDLCNTIGNLLNRTITMSKKWFKENIPIDNTASSDSTLKVQSETKII--EYMESFKDSNFKSSANAIIDLANSANLYLNDRAPWKLIKDISNKNVVALDIYSVLESCRIIGILLNPIVPNLSTRILKQLNIDTSNINFKDSLQWGLLDPNNRLQDPTPVMDKIE 510
>gi|72382182|ref|YP_291537.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A] >gi|72002032|gb|AAZ57834.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A] (516 aa)
Score = 772, Expect = 1.5e-79, Identities = 180/514 (35%), Positives = 277/514 (53%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHP--LIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF-LSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIE 1083
           K+ ITTP+YY +  PH+G ++TT+  D + R+++  G    F+TG+DEHGQKIE  A+  NL+PQ   D+  + +  LW  L I Y  F+RTT+  H ++V + +S++LK D +Y+G   G YCV CEE   K++    E+ DK     +H   L  ++EE+ F K+ +++  I   +     + P +R NE+ N    +    D SISR N  WGI +  N  H  YVW DALL Y+SG    Q      +K  ++  A I  ++ K+I RFH +YWP ML   G++ P     HG++  E  KM KSLGNVLDPI  +   G DA R+YLL+++   ED  F  +  ++  N DL N +GNL NR+I M  K+    IP  +       ++ + + K    E     +  N +   + +IDL N  N ++    PW L K+ + K++    +  +L + + +   L P++ + S   LKQ NID+S  + K    +  LD N  +  P P+  +IE
  S:     4 KYTITTPLYYVNDKPHLGSSYTTIACDAIARFERLNGNTVLFLTGVDEHGQKIERTAESKNLEPQLHCDEITEKYKYLWDKLNISYDRFVRTTSIEHTSLVHQFYSKVLKSDDVYMGRQSGWYCVGCEE--YKDV----EDKDKSPICSIHKKELEWRDEENLFFKLSKYQDQIEKLIHVDGFISPKSRKNEIIN--FVSKGLRDFSISRVNLKWGINVPGNKDHTFYVWFDALLGYVSGSLNDQCSPELTEKSLSNWPANI-HVIGKDILRFHAVYWPAMLLSAGMKTPRSVFGHGFLTREGQKMGKSLGNVLDPIELLEYGGIDAMRWYLLRDIEFGEDGDFQMRRFVDIVNSDLCNTIGNLLNRTITMSKKWFKENIPIDNTLSSDSTLKVKSETKII--EYMESFKDSNFKSSANAIIDLANSANLYLNDRAPWKLIKDISNKNIVALDIYSVLESCRIIGILLNPIVPNLSNRILKQLNIDTSNINFKDSLQWGLLDPNNGLQDPTPVMDKIE 510
>gi|162139845|ref|YP_318075.2| methionyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255] (544 aa)
Score = 772, Expect = 1.7e-79, Identities = 168/511 (32%), Positives = 276/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSSLDNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHGQK+ + A+  N+   EL  + A++   L + L I +  FIRT+   H   VQ+ +  +     IYL  + G Y V  E  Y ++  V  E D+     Q  P+   EE+SYF K+  ++ + ++ +  +P+ + P +R NE+  SF+      DLSISR+ F WG+++  +P+HV+YVW+DAL NY++G+G+  +D+SN+ +FW +     + ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP      YG D  RY+ L+E+   +D  ++ + ++   N DLAN+ GNL  RS+ MI K   G++P+       F+   +  L Q D  I    E +N Q+I   L+ +  ++ E N +     PW L K +  +     L +    V+++    +P +     + L    I + + +   +  D        +  P P++ R
  S:    35 FYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQRENISALELATRNAELLRKLDEALDISFDRFIRTSESAHHRSVQDIWKRMAGNGDIYLSNYSGWYSVRDEAYYAEDETVVGE-DNVRRGPQGTPVEWVEEKSYFFKLSAYEDRLLALYESEPDFIGPDSRRNEVV-SFVKGG-LKDLSISRTTFDWGVKVPGDPEHVMYVWVDALTNYITGVGFPDEDESNW-RFWPAD----IHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMSKSVGNVVDPFSLAAQYGVDQMRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQRSLSMIAKQHGGVLPEPG----DFSDADKAILAQADGMIAIAREAMNTQQIHQALNAIWSVVAEANRYFAGEAPWALAKTDPARQ-KTVLYVTAEVVRQIAILAQPAMPAACAKLLDILGIPADERNFAMLGGDIRIRPGSALPAPVPVFPR 537
>gi|74420524|gb|ABA04723.1| methionyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255] (692 aa)
Score = 772, Expect = 1.7e-79, Identities = 168/511 (32%), Positives = 276/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSSLDNQKINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHGQK+ + A+  N+   EL  + A++   L + L I +  FIRT+   H   VQ+ +  +     IYL  + G Y V  E  Y ++  V  E D+     Q  P+   EE+SYF K+  ++ + ++ +  +P+ + P +R NE+  SF+      DLSISR+ F WG+++  +P+HV+YVW+DAL NY++G+G+  +D+SN+ +FW +     + ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP      YG D  RY+ L+E+   +D  ++ + ++   N DLAN+ GNL  RS+ MI K   G++P+       F+   +  L Q D  I    E +N Q+I   L+ +  ++ E N +     PW L K +  +     L +    V+++    +P +     + L    I + + +   +  D        +  P P++ R
  S:   183 FYITTAIVYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQRENISALELATRNAELLRKLDEALDISFDRFIRTSESAHHRSVQDIWKRMAGNGDIYLSNYSGWYSVRDEAYYAEDETVVGE-DNVRRGPQGTPVEWVEEKSYFFKLSAYEDRLLALYESEPDFIGPDSRRNEVV-SFVKGG-LKDLSISRTTFDWGVKVPGDPEHVMYVWVDALTNYITGVGFPDEDESNW-RFWPAD----IHIIGKDIIRFHAVYWPAFLMSAGIALPKRVYAHGFLFNRGEKMSKSVGNVVDPFSLAAQYGVDQMRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQRSLSMIAKQHGGVLPEPG----DFSDADKAILAQADGMIAIAREAMNTQQIHQALNAIWSVVAEANRYFAGEAPWALAKTDPARQ-KTVLYVTAEVVRQIAILAQPAMPAACAKLLDILGIPADERNFAMLGGDIRIRPGSALPAPVPVFPR 685
>gi|108563402|ref|YP_627718.1| methionyl-tRNA synthetase [Helicobacter pylori HPAG1] >gi|107837175|gb|ABF85044.1| methionyl-tRNA synthetase [Helicobacter pylori HPAG1] (643 aa)
Score = 772, Expect = 1.8e-79, Identities = 199/520 (38%), Positives = 285/520 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQ-LHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESEDK 1087
           M+K  ITTPIYY +  PHIGHA+TTLIAD L +Y    G E FF+TG DEHGQKIE+ A+  N  P+   D  + +F + W    ++Y  FIRTT   H+  VQ  F  + +K  IY G + G YCVSCE      I+     +DK+ C   L      EEESYF K+  ++K +  F  K+P  + PI R NE+  SF+      DLSI+R++F WGI + +   +PKHVVYVWLDALLNY S LGY    D+    F  ++      ++ K+I RFH IYWP  L  L L    +   HGW   E  KMSKSLGNVLD       YG +  RY+LL+E+   +D  FS+K LI   N +L N++GNL NR +GM  KY +  + K +K    ++ E EK   Q  D   + + K+ + K L  + ++ +  N  I + +PW L K N  + L+  LSLI N + +  + L   +   + +    F ++ +  + +       L +  +   EP++ ++E  +K
  S:     1 MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAYADSISAIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGTYSGYYCVSCESYCA--ISKTDNTNDKVLCPDCLRETTLLEEESYFFKLSTYEKPLLDFYAKNPEAILPIYRKNEV-TSFIEQ-GLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYASMLGYLNGLDNKMAHFECAR-----HIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGVKMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNLLNRLLGMAKKYFNYSL-KSAKITAYYSKELEKA-HQILDNANSFVPKMQLHKALEELFNVYDFLNKLIAKEEPWVLHKNNESEKLEALLSLIANVLLQSSFLLYAFMPKSATKLASAFRVEITPNNYERFFKAKKLQDMILQDTEPLFSKMEKVEK 514
>gi|78100832|pdb|1WOY|A Chain A, Crystal Structure Of Methionyl Trna Synthetase Y225f Mutant From Thermus Thermophilus >gi|119389107|pdb|2D5B|A Chain A, Crystal Structure Of Thermus Thermophilus Methionyl Trna Synthetase Y225f Mutant Obtained In The Presence Of Peg6000 (500 aa)
Score = 771, Expect = 2.3e-79, Identities = 167/476 (35%), Positives = 266/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV +VW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+       +L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTFVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|144899823|emb|CAM76687.1| Methionyl-tRNA synthetase [Magnetospirillum gryphiswaldense MSR-1] (518 aa)
Score = 770, Expect = 3.0e-79, Identities = 173/510 (33%), Positives = 276/510 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLN-------IQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPI 1078
           K FY+TTPIYY +  PHIGHA+TTL  DVL R+K+  GY+  F+TG DEHGQK+E+ A+   + PQ L D  +  F  L   L      FIRTT   H   VQ  +++L++   IYLG ++G Y V  E  Y ++  V   N  KL      P+   +E SYF ++  ++  +  + +D P+ V P +R NE+  SF+      DLS+SR++F WGI +  +  HV+YVWLDAL NY++ +GY ++ D ++ ++W +     + ++ K+I RFH +YWP  L   G++  T+  +HGW   E  K+SKS+GNV+DP+  I  YG D  RY+LL+E+    D  +S + ++   N +LAN+ GNL  R + M+ K     +P +         +F    ++  D    ++ KL          + L  +  +I   N ++++  PW LKK +  + +   L ++   ++ +    +  + D S + L Q  I +   D + +    S    K  TP P+
  S:     6 KTFYVTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGYDVKFLTGTDEHGQKVEKSAETAGISPQALADMNSANFRELAARLNCSNDDFIRTTEPRHVASVQALWNKLVQSGDIYLGHYEGWYSVRDEAFYGEDELVAGPNGGKL-APTGAPVEWVKEPSYFFRLSAWQDKLLQWYEDNPDCVAPQSRRNEVM-SFVKG-GLQDLSVSRTSFKWGIPVPGDADHVMYVWLDALTNYITAVGYPEQ-DGDYARYWPAD----LHMVGKDIVRFHAVYWPAFLMAAGIKPATRVFAHGWWTNEGQKISKSVGNVIDPLGLIEKYGLDQVRYFLLREVPFGNDGDYSHRAMVMRMNSELANDYGNLAQRVLSMVGKNCGNAVPVHG--------DFNDDDREMLDAAHGLLHKLRDAMDRQLFHEGLEALWVVIRAANGYVDRQAPWALKKTDPAR-MGTVLWVLAETIRNLALLTQAFMPDSSAKLLDQLAIAA---DQRGLAQCGSHHALKPGTPLPV 503
>gi|109947187|ref|YP_664415.1| methionyl-tRNA synthetase [Helicobacter acinonychis str. Sheeba] >gi|109714408|emb|CAJ99416.1| metS [Helicobacter acinonychis str. Sheeba] (643 aa)
Score = 770, Expect = 3.1e-79, Identities = 199/516 (38%), Positives = 285/516 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQ-LHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           M+K  ITTPIYY +  PHIGHA+TTLIAD L +Y    G E FF+TG DEHGQKIE+ AK  N  P+   D  + +F N W    ++Y  FIRTT   H+  VQ  F  + +K  IY G + G YCVSCE      I+     ++K+ C   L      EEESYF ++  ++K +  F  K+P ++ PI R NE+  SF+      DLSI+R++F WGI + +   +PKHVVYVWLDALLNY S LGY    ++    F  ++      ++ K+I RFH IYWP  L  LGL    +   HGW   E  KMSKSLGNVLD       YG +  RY+LL+E+   +D  FS+K L+   N +L N++GNL NR +GM  KY +  + K  K    +  E EK + Q  D   + + K+ + K L  +  + +  N  I + +PW L K N  + L+  LSLI NA+ +  + L   +   + +    FN+  +  + +      +L +  +   EP++ ++E
  S:     1 MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAKLRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDNEHQKCVQNAFEIMFEKGDIYKGTYSGYYCVSCESYCA--ISKADNINNKVLCPDCLRETTLLEEESYFFRLSAYEKPLLEFYAKNPEVILPIYRKNEV-TSFIEQ-GLLDLSITRTSFEWGILLPKKMNDPKHVVYVWLDALLNYASALGYLNGLENKMVHFECAR-----HIVGKDILRFHAIYWPAFLMSLGLPLFKQLCVHGWWTIEGVKMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNLLNRLLGMAKKYFNYSL-KSEKITTYYPKELEK-VHQILDNANSFVPKMQLHKALEELFGVYDFLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAMKLASAFNVKITPTNYERFFKSKNLQDIILQDTEPLFSKME 510
>gi|148259982|ref|YP_001234109.1| methionyl-tRNA synthetase [Acidiphilium cryptum JF-5] >gi|146401663|gb|ABQ30190.1| methionyl-tRNA synthetase [Acidiphilium cryptum JF-5] (511 aa)
Score = 770, Expect = 3.1e-79, Identities = 172/489 (35%), Positives = 264/489 (53%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL--YCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           + +KFYITTPIYY +G PHIGHA+T++ ADVL R+K+  G++  F+TG DEHGQK+E  A+  N+ PQE  D+ A  F  + + + I    FIRTT   H    Q  +  + +   I LG ++G Y V  E  Y ++  V   +  K   + A   P+    E SYF K+  F+  +    +D P  + P +  NE+  SF+ +    D+SISR++F WGI +   P HV+YVW+DAL NYL+  GY    D+   K+W +     + L+ KEITRFH +YWP ML   GL  P +  ++GW   E  KMSKSL N L     I  +G D  R+ LL+E+    D  FS + +I   N +LAN++GNL  R++  I K   G++P+ + P    +           D +   +++L  Q+ +  V  L+   N +I+   PW L+K + ++ L   L  +  A++ V   L+P + +   + L Q  + + +
  S:     1 MTRKFYITTPIYYVNGAPHIGHAYTSVAADVLARFKRLDGFDVHFLTGTDEHGQKVEATARANNIAPQEFTDRIAGEFRAMAQAMNISNDDFIRTTEPRHIRSCQAIWQAIERAGAIELGHYEGWYAVRDEAFYDESELVTGADGIKRSPFGA---PVEWVREPSYFFKLSMFQDRLLKLYEDNPEFIQPASSRNEVL-SFVRS-GLRDISISRTSFKWGIPVPGAPDHVMYVWIDALTNYLTACGYPDM-DAPLMKYWPAD----LHLVGKEITRFHAVYWPAMLMAAGLPVPRRIFANGWWTIEGEKMSKSLNNALAVEPLIAEFGLDQLRFCLLREMPFGNDGNFSRRSVITRINVELANDLGNLAQRTLSFIAKNAGGVVPE-AGPAAEADHALRAIADGLPDRMRDAMDRLAYQEAIEEVWKLVRAANAYIDHQAPWALRKTDPQRML-TVLRTLCEALRVVGILLQPFMPEAMAKLLDQLALPADR 480
>gi|85708668|ref|ZP_01039734.1| methionine--tRNA ligase [Erythrobacter sp. NAP1] >gi|85690202|gb|EAQ30205.1| methionine--tRNA ligase [Erythrobacter sp. NAP1] (525 aa)
Score = 769, Expect = 3.4e-79, Identities = 165/513 (32%), Positives = 276/513 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-----NQKINTPEPIYLRIE 1083
           +YITT I YP+G PHIGHA+  + ADV+ R+++  G E  F TG DEHG K+  KA+E    P++L D+ +  F  + + L I++  FIRT    H    Q  +  +     +YL  ++G Y V  E  Y ++  V  E + KL   Q  P+    EES+F ++ +++K +   LK P  + P +R NE+  +F+      DLS+SR++F WG+++  +  HV+YVW+DAL NYL+GLG+   +    +KFW +     + L+ K+I RFH IYWP  L    L  P K   HG+++    K SKSLGNV DP+     +G D  RY+L++E++  +D  +S + ++   N +LAN+ GNL  R++ MI K  DG++  +   ++   +           ++    E+L     +   I  +  CN ++++  PW LKK + E+ +   L  +  A++ +   ++P++ + +   L Q  +  ++   + + D S  D        +  P PI+ R+E
  S:     9 YYITTAINYPNGRPHIGHAYEGIAADVIARFQRLKGREVRFQTGTDEHGLKMARKAEEQGRTPRDLADEMSGYFREMDEALNIDFDRFIRTVEPEHHRASQAIWERMEAAGDLYLDRYEGWYSVRDEAYYDESELVEGEGEQKL-SPQGTPVEWTVEESWFFRLSKYEKPLLDLLKTPGFLEPASRRNEMI-AFVEQ-GLRDLSVSRTSFDWGVKVPGSDNHVMYVWVDALTNYLTGLGF-PDETPEMEKFWPAS----LHLIGKDIVRFHTIYWPAFLMSANLPVPKKVFGHGFLLNRGQKESKSLGNVTDPLELAEQFGVDNLRYFLMREVAFGQDGSYSSEAIVTRTNAELANSFGNLAQRTLSMIAKNMDGVLEPFELAEVDTAL-LAAVKNACATDLPREFEQLAFSVGIEVWIKAVYACNQYVDEQAPWTLKKTDPER-MKAVLQTLFCAIRDLAIAIQPIVPEKASAVLDQLGVPENERQFEQLHDRSWFDRLAKSGHVVGKPTPIFPRLE 516
>gi|114704621|ref|ZP_01437529.1| methionyl-tRNA synthetase [Fulvimarina pelagi HTCC2506] >gi|114539406|gb|EAU42526.1| methionyl-tRNA synthetase [Fulvimarina pelagi HTCC2506] (518 aa)
Score = 768, Expect = 4.3e-79, Identities = 169/518 (32%), Positives = 280/518 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDD---EITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESED 1086
           +++Y+TT I YP+G PHIGHA+  +  D L R+K+  GY+ FF+TG DEHG K+ + A+   L P+EL D  +  F  +   LG     FIRT+   HK   Q  +  + +   IY   + G Y V  E  Y ++     E+  ++   Q  P+   EEESYF ++  F+   +  + ++P+ + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NYL+  GY +  +    +FW +     + ++ K+ITRFH +YWP  L   GL    +  +HG++     KMSKS+GNV+DP   ++TYG D  RY+LL+E+   +D  +S   ++N  N +LAN++GNL  RS+ M+ K+ +G +P       +F    E  LK   D   +    +EK  + ++L+ +I ++++ N +    +PW L+K + ++ +   L +    ++ V   L+P   + + + L    +         +T  + L     +  P+PI+ R   E+
  S:     3 ERYYLTTAISYPNGKPHIGHAYELIATDALARFKRLDGYDVFFLTGTDEHGIKMLQNARAQGLTPRELADANSAEFQRMSAALGGSNDDFIRTSEARHKIACQAIWKRMEEAGDIYKDAYSGWYSVRDEAYYGEDETHISEDGTRI-GPQGTPVDWIEEESYFFRLSNFQDPLLKLYAENPDFIGPNERRNEVI-SFVKSG-LRDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYLTATGYPEDGNGGRTEFWPAD----LHVIGKDITRFHTVYWPAFLMSAGLPLCKRVYAHGFLFNRGEKMSKSVGNVIDPFALVDTYGLDRLRYFLLREVPFGQDGNYSHDGIVNRTNSELANDLGNLAQRSLSMVAKHCEGRVPDPG----AFTEADELILKAAGDLLAQCREAVEKQQLHQVLAAIIGVVSQANRYFAGEEPWALRKTDFDR-MQTVLYVTAEVLRTVAILLQPFTPESAGKLLDILGVQEDDRGFDELTKGTRLAPGASLPAPKPIFPRFVEEE 513
>gi|58617532|ref|YP_196731.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel] >gi|58417144|emb|CAI28257.1| Methionyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel] (506 aa)
Score = 768, Expect = 4.3e-79, Identities = 179/515 (34%), Positives = 281/515 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKI-NTPEPIYLRI 1082
           M+  Y+TTPIYY +  PHIGH +TTLI+D++ R+K+  GY   FITG DEHGQKIE+ A + N    E  D  + +F +L  ++   +  FIRTT   HK  V E +  L     IYLG + G Y V  E  Y +   +    D K         +  EE SYF ++  F++ +  F  K PN + P  R NE+  SF+ +    D+SISR N SWGI + E+  H++YVW+DAL NYL+ LG+ + + S ++ +W  +++ +V ++ K+I RFH +YWP +L    L  P + ++HGW   E  K+SKSLGNV++P   I  +G D  RY+L+KE+ +  D  +    +I+  N DLANN+GNL  R++ +++K   G IP  +   L  + +     ++  + +   I + N+  ++  V +L +  N +I    PW L K  +   +   L  +L  ++ V   L+P++   S + L Q  +  S++   F      +D   I   PEPI+ +I
  S:     1 MRNIYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKANKSLVEFTDHASAIFQHLTGVMNFSHDDFIRTTEIRHKKAVTELWRRLYHYGKIYLGNYSGWYAVRDETFYQEKELI----DGKAPTGAEVEWV--EEPSYFFRLSHFQERLLDFYDKHPNFIIPRHRYNEVI-SFVKSG-LKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFPEINSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQKISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRNSIISCINCDLANNIGNLVQRTVSLLHKECHGTIPNVAS-SLFQDEDALPNYQEILENVRICINQYNLNGVIHIVEELSSMANEYIAFRAPWKLSK-TDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIAL--SEYKRSFNNFAVPIDTGIILPKPEPIFTKI 505
>gi|15612032|ref|NP_223684.1| methionyl-tRNA synthetase [Helicobacter pylori J99] >gi|7388283|sp|Q9ZKG9|SYM_HELPJ Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|4155547|gb|AAD06543.1| METHIONYL-TRNA SYNTHETASE [Helicobacter pylori J99] (656 aa)
Score = 768, Expect = 4.4e-79, Identities = 196/512 (38%), Positives = 278/512 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQ-LHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIY 1079
           M+K  ITTPIYY +  PHIGHA+TTLIAD L +Y    G E FF+TG DEHGQKIE+ A+  N  P+   D  + +F N W    ++Y  FIRTT   H+  VQ  F  + +K  IY G + G YCVSCE      ++     D K+ C   L      EEESYF K+  ++K +  F  K+P  + PI R NE+  SF+      DLSI+R++F WGI + +   +PKHVVYVWLDALLNY S LGY    D+    F  ++      ++ K+I RFH IYWP  L  L L    +   HGW   E  KMSKSLGNVLD       YG +  RY+LL+E+   +D  FS+K L+   N +L N++GNL NR +GM  KY +  + K +K    +  E EK   Q  D   + + K+ + K L  + ++ +  N  I + +PW L K N  + L+  LSLI N + +  + L   +   + +    F ++ +  + +       L +  +   EP++
  S:     1 MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGTYSGYYCVSCESYCA--VSKVDNTDSKVLCPDCLRETTLLEEESYFFKLSAYEKPLLEFYAKNPEAILPIYRKNEV-TSFIEQ-GLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYASALGYLNGLDNKMAHFERAR-----HIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGVKMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNLLNRLLGMAKKYFNYSL-KSTKITAYYPKELEKA-HQILDNANSFVPKMQLHKALEELFNIYDFLNKLIAKEEPWVLHKNNESEKLEALLSLIANTLLQSSFLLYAFMPKSAMKLASAFRVEITPNNYERFFKAKKLQDMVLQDTEPLF 506
>gi|57167838|ref|ZP_00366978.1| methionyl-tRNA synthetase [Campylobacter coli RM2228] >gi|57020960|gb|EAL57624.1| methionyl-tRNA synthetase [Campylobacter coli RM2228] (628 aa)
Score = 768, Expect = 5.2e-79, Identities = 184/512 (35%), Positives = 277/512 (54%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKE---NPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           Y+TTPIYY +  PH+GHA+TT+IAD L R+ +  G+ET  +TG DEHGQKIE+ AK  N  P+E  DK +  F  LW    I Y  + RTT   H   V+  F ++ +K  IY   ++G YC+SCE  + K+  + +       C +   L++  EESYF K+ +++  I  +    + + P  + NEL N         DLSI+R++F WGI+I E   + KH++YVWLDAL  Y+S L Y+ + ++   KFW +     + L+ K+I RFH IYWP  L  + L  P    +HGW   E  KMSKS GNV+ P   ++ YG +AFRY+LL+E+    D  FSE +LIN  N +L N  GNL NR IGM  KY  G I +    +   N E +   +  ++ I   +E L   + L  +   ++  N  I + +PW+L K N  K+ +  + L  N + +    L P L    ++     N + S  + + +   + L + K +  E ++ +IE
  S:     3 YLTTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRLLTGTDEHGQKIEQAAKIRNSTPKEYADKISSEFKKLWDEFEITYDIYARTTDTRHVEFVKAMFLKMWQKGDIYKDEYEGHYCISCESFFAKSQLINECGCPD--CGKDTSLLK--EESYFFKLSKYQDKILQWYDKEDPILPKNKKNELIN--FVQSGLKDLSITRTSFDWGIEIPEEIKDDKHIIYVWLDALFIYISSLDYQSQGEN--AKFWPAH----IHLVGKDILRFHAIYWPAFLMSVDLPLPKFIGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGLEAFRYFLLREVPFGNDGDFSESVLINRINTELGNEFGNLLNRIIGMSIKYNQGNISQEGVLEFYKN-ELDTAKEHLNNAI-NFLENLQCNRYLEELFKALSVANLAISKYEPWNLIKANKIKEANALIGLCANILAKTSLLLSPTLPKSCQKVGLALNFEISPTNYQKLILQNELLDFKASACEALFPKIE 503
>gi|124023178|ref|YP_001017485.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9303] >gi|123963464|gb|ABM78220.1| Methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9303] (515 aa)
Score = 767, Expect = 5.7e-79, Identities = 168/516 (32%), Positives = 268/516 (51%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH--PLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGL---GYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWD-LKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP-EPIYLRIE 1083
           M  + ITTP+YY +  PH+G  +TT+ +D L R+++  G +  F+TG+DEHGQKI+  A+  N+ PQ+  D+  + + NLW    I    FIRTT+  H+ +V+  F  +     +YLG  +G YCV CEE   +    +  +        +H  PL  ++EE+ F ++ +F+  I   +  P+ ++P++R NE+ N         D SISR +  WG+ +   PKH  YVW DAL+ YLS L   G + + +   +  W +     V L+ K+I RFH +YWP ML   GL  P +   HG++  E  KM KSLGNVLDP   I   G DA R+YLL+++    D  F +K  ++  N DLAN +GNL NR+  M  K+ +G +P +        I++   L    +   TI+ +    +        ++ L    N ++ +  PW  +K   NE ++   L  +L A + V   + P++   S+  L Q  +     D      +  L +  +  P +P+  R+E
  S:     1 MMTYTITTPLYYVNDKPHLGSLYTTMASDALARFQRLEGKQVMFVTGVDEHGQKIQRTAEVNNISPQQHCDQITRSYQNLWSRWDISNDRFIRTTSHRHQLLVEAFFQRVETSGDVYLGRQQGWYCVDCEEYKDEPPQAQSPS------CPIHQKPLEWRDEENLFFRLSRFQSQIEDLISQPDFIWPVSRRNEIQNFVAQG--LRDFSISRIDVDWGLPVPGYPKHTFYVWFDALVGYLSALLDDGGQVRIERLVECGWPAS----VHLIGKDILRFHAVYWPAMLSSAGLPLPKQVFGHGFLTREGQKMGKSLGNVLDPEKLIEVCGEDAVRWYLLRDIQFGHDGDFQQKRFMDLVNNDLANTIGNLLNRTSTMARKWFEGSVPSHRN-----EIDYAHPLVTTAETTITIVRQSMPSMAFHDAAEAILKLAIAANVYLNETAPWSRMKTPGNEAEVADDLYSVLEACRLVGLLINPLVPSLSERLLNQLGLSIDSNDWSNSLAWGQLQSGALLPPSQPVMQRLE 510
>gi|121601643|ref|YP_989109.1| methionyl-tRNA synthetase [Bartonella bacilliformis KC583] >gi|120613820|gb|ABM44421.1| methionyl-tRNA synthetase [Bartonella bacilliformis KC583] (519 aa)
Score = 766, Expect = 9.0e-79, Identities = 171/511 (33%), Positives = 275/511 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQK--FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQK---ILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR 1081
           +YITTPI+YP+G PHIGHA+  + +D L R+++      FF++G DEHG K+++ A+ LN+ PQ+L D+ + +F  +   L      FIRTT E H    Q  + ++     IYL  + G Y V  E  Y +     +EN  +       P+   EEESYF ++ ++    +  + K P+ + P  R NE+  SF+ +    D+SISR NF+WG+ +  NP+HV+YVW+DAL NYL+ +G+    D+  QK  +W +     V ++ K+I RFH IYWP  L   G+  P +  +HG++     KMSKS+GNV+DP   I+ YG D  RY+ L+E+   +D  +S   L+N  N DLAN++GNL  RS+ M+ K  D  +P       +F  + ++ L+Q    +    + ++ Q     LS +  +I   N +    +PW L+K NN K     L + + +++R+   L P +   + + L    I      +  ++     +   +  PE I+ R
  S:     5 YYITTPIFYPNGAPHIGHAYNAIASDALARFQRLDRKNVFFLSGTDEHGLKMQKTAEALNITPQQLADRNSALFQKMLTALNCSNDDFIRTTEERHHQTCQVMWKKMEANGDIYLDRYAGWYSVRQESYYEQKDTEIRENGIRCEKELGSPVEWNEEESYFFRLSRYGDALLEHYEKYPDFIGPNERRNEII-SFVKSG-LKDISISRINFNWGVSVPNNPEHVMYVWVDALTNYLTAIGFF---DNTAQKRDYWPAN----VHVVGKDIIRFHAIYWPAFLLSAGIELPKRIFAHGFLFNRGEKMSKSIGNVVDPFKMIDHYGVDQVRYFFLREVPFGQDGSYSHDSLVNRVNADLANDLGNLAQRSLSMLQKNCDAKVPVPD----TFLTQDQQLLEQSLQALEVARQTMSCQAPHLALSAIFSVIANANRYFASEEPWSLRK-NNPKRFCTVLYVTVESLRRIGIMLLPFIPQSAAKLLDSLAIPEDNRLLHHISSLRIEEGTDLPPPEAIFPR 507
>gi|122919781|pdb|2D54|A Chain A, Crystal Structure Of Methionyl Trna Synthetase Y225a Mutant From Thermus Thermophilus (502 aa)
Score = 766, Expect = 9.2e-79, Identities = 167/476 (35%), Positives = 265/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKE 1044
           K FY+TTPIYY +  PH+GHA+TT++AD L R+ +  GY TFF+TG DEHG+ +   A+     P+  VD+ +  F   W LLGI Y  FIRTT E HK VVQ    ++ +   IY G ++GLYCVSCE  YT+     KE  + L      P+ +++E +YF ++++++ ++  ++++ P+L+ P    NE+       +   DLSISR  S   WGI +  +  HV  VW DALLNY+S L Y + +   ++ FW         L+ K+I + H ++WP ML+  G+         G+++   G KMSK+LGNV+DP   +  YGRDA RYYLL+E+   +D+  SE+ L   +  DLA+++GNL  R+  M+ ++ +G IP+  +  +L+       +L+        ++ +L     L   +  +   N +I + KPW+L K+  E +    L  ++  ++     L P + D   E
  S:     3 KVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----KELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLA--EPIGDLSISRPKSRVPWGIPLPWDENHVTAVWFDALLNYVSALDYPEGE--AYRTFW----PHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLR-------PLVRELKFHVALEEAMAYVKALNRYINEKKPWELFKKEPE-EARAVLYRVVEGLRIASILLTPAMPDKMAE 462
>gi|182678510|ref|YP_001832656.1| methionyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634393|gb|ACB95167.1| methionyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039] (530 aa)
Score = 765, Expect = 9.4e-79, Identities = 175/518 (33%), Positives = 274/518 (52%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK-------LNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSL-DNQKINTPEPIYLRIESEDK 1087
           +FY+TT I Y +G PHIGHA+  L  D +TR+K+  GY+  F+TGMDEHGQK+++ A   ++ PQEL D+ A  F  +   L       +RTT   H    QE ++ +     IYL  + G Y V  E  + +       N  KL      P+   EEESY+ K+  ++ + ++ +   P+ + P    NE+  SF+      DLSISRS F WGI +  + KHV+YVW+DAL NY++  G+   +      FW + DA ++    K+ITRFH IYWP  L   G+  P + + HG++     KMSKS+GNV+DP+  I TYG D FRY+ L+E+   +D  +S + ++N  N DLAN++GNL  RS+ M+ K   G +P+           F +  K   D    ++EK        ++  IL  +  ++ E N +    +PW +K++ +   ++  L +    ++RV    +P +   + + L    + +       V +   L     + TP PI+ RIE+E K
  S:    20 RFYLTTAIPYANGAPHIGHAYERLACDAITRFKRLDGYDVLFVTGMDEHGQKMQQTAARDHITPQELADRTAAQFAAMGLALDAPTDDVVRTTEPRHHVAAQEIWNRMAANGDIYLSKYPGWYSVRDEAFFDEGELTEGPNGTKL-APTGAPVEWVEEESYYFKLSAYQERLLAHYQAHPDFITPEKYRNEIV-SFVERG-LTDLSISRSTFDWGIPVPGDAKHVMYVWVDALTNYITATGFPDAEAPR-AVFWPA-DAHVI---GKDITRFHAIYWPAFLMSAGIALPKQIVVHGFLFNRGEKMSKSVGNVIDPLTLIETYGLDPFRYFFLREVPFGQDGNYSHEAIVNRTNADLANDLGNLAQRSLSMLAKNCGGKVPQPGA--------FSEADKAILDLSRALVEKSRDLMQDFSLHLILGEIWRVVGEANRYFAGEEPW-IKRKTDPARMETILYVTAEVLRRVAILTQPFIPQSASKLLDSLGVAAEARLFIHVEEGPDLPPGTVLPTPVPIFPRIETEAK 529
>gi|170789434|gb|EDT30478.1| methionyl-tRNA synthetase [Oligotropha carboxidovorans OM5] (523 aa)
Score = 765, Expect = 1.1e-78, Identities = 162/469 (34%), Positives = 264/469 (56%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           ++YITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHG K+ + A++  + P EL  + A  F ++ + L I +  FIRT+   H +  QE +  +     IYL  + G Y V  E  Y ++  V    DDK+    Q  P+   EE+SYF K+  ++ K ++ + + P  + P  R NE+  SF+      DLSISR+ F WG+++ ++P+HV+YVW+DAL NY++G+ +  + D+N+ K+W +     V ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP    N YG D  RY+LL+E+   +D  ++ + ++   N DLAN++GNL  RS+ MI K   GI+P+      +F+   +  L Q D  +    E +  Q+I   L+ +  ++ E N +     PW L K +  +     L +    V+++    +P +
  S:    11 RYYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGMDVFFLTGTDEHGLKMIQTAQKEGMTPAELATRNAARFKDMDRRLNISFDRFIRTSEVAHHDSTQEIWRRMAANGDIYLSSYAGWYSVRDEAYYAEDETV--VGDDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLALYEQHPEFIGPDVRRNEVV-SFVKGG-LKDLSISRTTFDWGVKVPDDPEHVMYVWVDALTNYITGINFPDEADANW-KYWPAD----VHVIGKDIIRFHAVYWPAFLMSAGIAVPKRVYAHGFLFNRGEKMSKSVGNVVDPFELANQYGVDQLRYFLLREVPFGQDGNYNHEAIVARTNADLANDLGNLAQRSLSMIGKQHGGIVPEPG----AFSDADKAILAQADAMLAQTREAMATQQIHVALNEIWTVVAEANRYFAGEAPWSLAKTDPARQ-KTVLYVTAEVVRQIAILAQPAM 470
>gi|118465949|ref|YP_880395.1| methionyl-tRNA synthetase [Mycobacterium avium 104] >gi|118167236|gb|ABK68133.1| methionyl-tRNA synthetase [Mycobacterium avium 104] (519 aa)
Score = 765, Expect = 1.1e-78, Identities = 155/479 (32%), Positives = 266/479 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF---LSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           M+ FY+TT I YP+G+PH+GHA+  +  D + R+K+  G++  F+TG DEHG K+ E A    +   EL  + + VF  L + L I +  FIRTT   H    +  +  +     IYL  + G Y V  E  + ++     ++  ++      PL   EE++YF ++  +  K ++ +  +P+ + P  R NE+  SF++     DLSISR++F WG+++ ++P HV+YVW+DAL NYL+G+GY   +   F+++W +     + ++ K+I RFH +YWP  L   G+  P +  +HG+++    KMSKS+GN++DPI  ++T+G D  RY+LL+E+   +D  +++  +I   N DLAN +GNL  RS+ MI K    ++P+       F  +  + L+  D  +  +    + Q +   L  +  ++ E N +    +PW L+K  +E D   F   L +    V+     ++PV+ D + + L
  S:     1 MRPFYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEGIGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDSYSGWYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPDFIAPEVRRNEVV-SFVSGG-LRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYPDTESEMFRRYWPAD----LHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSKSVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTKDAIITRINTDLANELGNLAQRSLSMIAKNLHSVVPEPG----DFTGDDRELLQTADGLLPRVRASFDSQAMHLGLEAIWLMLGEANKYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPDSAGKLL 476
>gi|41407070|ref|NP_959906.1| methionyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395421|gb|AAS03289.1| MetS [Mycobacterium avium subsp. paratuberculosis K-10] (519 aa)
Score = 765, Expect = 1.2e-78, Identities = 155/479 (32%), Positives = 266/479 (55%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF---LSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           M+ FY+TT I YP+G+PH+GHA+  +  D + R+K+  G++  F+TG DEHG K+ E A    +   EL  + + VF  L + L I +  FIRTT   H    +  +  +     IYL  + G Y V  E  + ++     ++  ++      PL   EE++YF ++  +  K ++ +  +P+ + P  R NE+  SF++     DLSISR++F WG+++ ++P HV+YVW+DAL NYL+G+GY   +   F+++W +     + ++ K+I RFH +YWP  L   G+  P +  +HG+++    KMSKS+GN++DPI  ++T+G D  RY+LL+E+   +D  ++E  +I   N DLAN +GNL  RS+ MI K    ++P+       F  +  + L+  D  +  +    + Q +   L  +  ++ E N +    +PW L+K  +E D   F   L +    V+     ++PV+ + + + L
  S:     1 MRPFYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAAAEGIGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHHEASKAIWRRMQAAGDIYLDSYSGWYSVRDERFFVESETKVLDDGTRVAAETGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPDFIAPEVRRNEVV-SFVSGG-LRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYPDTESEMFRRYWPAD----LHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEKMSKSVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTEDAIITRINTDLANELGNLAQRSLSMIAKNLHSVVPEPG----DFTGDDRELLQTADGLLPRVRASFDSQAMHLGLEAIWLMLGEANKYFSAQQPWVLRKSESEADQTRFRTVLYVTCEVVRIAALLVQPVMPESAGKLL 476
>gi|108801230|ref|YP_641427.1| methionyl-tRNA synthetase [Mycobacterium sp. MCS] >gi|119870381|ref|YP_940333.1| methionyl-tRNA synthetase [Mycobacterium sp. KMS] >gi|126437210|ref|YP_001072901.1| methionyl-tRNA synthetase [Mycobacterium sp. JLS] >gi|108771649|gb|ABG10371.1| methionyl-tRNA synthetase [Mycobacterium sp. MCS] >gi|119696470|gb|ABL93543.1| methionyl-tRNA synthetase [Mycobacterium sp. KMS] >gi|126237010|gb|ABO00411.1| methionyl-tRNA synthetase [Mycobacterium sp. JLS] (515 aa)
Score = 764, Expect = 1.3e-78, Identities = 159/478 (33%), Positives = 257/478 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLI---LNAVKRVIYYLEPVLIDGSKEAL 1046
           + FYITT I YP+G+PH+GHA+  +  D + R+K+  GY+  ++TG D HGQK+ E A  L +   +L  + + VF  L + L I +  FIRT+   H    ++ +  +     IYL  + G Y V  E  +T+     +E+  ++      PL   EE++YF K+  +  + ++ +   P  + P  R NE+  SF++     DLSISR+ F WG+ + ++P HV+YVW+DAL NYL+G+GY       FQ++W +     + ++ K+I RFH +YWP  L   GL  P K  +HGW++    KMSKS+GNV+DP+  ++T+G D  RY+ L+E+   +D  +SE  +I   N DLAN +GNL  RS+ M+ K     +P+  +    F  E    L   D  +  +    + Q +   L  +  ++   N +    +PW L+K     D   F +++   L  V+      +PV+ D +   L
  S:     3 QPFYITTAIAYPNGDPHVGHAYEYIATDAIARFKRLDGYDVRYLTGTDVHGQKMAETATALGVPVADLARRNSDVFQRLQEKLNISFDRFIRTSDTDHYRASEDIWQRMNAAGDIYLDAYSGWYSVRDERFFTEGETTLREDGVRIATETGAPLTWTEEQTYFFKLSAYTDRLLAHYEAHPEFIQPDARRNEIV-SFVSGG-LRDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVGYPDTSSEEFQRYWPAD----LHMIGKDIIRFHTVYWPAFLMSAGLELPRKVFAHGWLLNRGEKMSKSIGNVVDPVNLVDTFGLDQVRYFFLREVPFGQDGSYSEDAIIGRINADLANELGNLAQRSLSMVAKNLGSAVPEPGE----FTAEDLALLDAADALMDRVRRHFDEQAMHLALEAIWSVLGAANRYFSAQEPWVLRKSEAVHDQVRFRTVLYTTLETVRIAALLSQPVMPDSTATLL 477
>gi|92117538|ref|YP_577267.1| methionyl-tRNA synthetase [Nitrobacter hamburgensis X14] >gi|91800432|gb|ABE62807.1| methionyl-tRNA synthetase [Nitrobacter hamburgensis X14] (659 aa)
Score = 764, Expect = 1.4e-78, Identities = 165/485 (34%), Positives = 269/485 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSK 1055
           FYITT I YP+G PHIGHA+  +  DVL R+++  G + FF+TG DEHGQK+ + A++ N+   EL  + A++   L + L I ++ FIRT+   H + VQE +  +     IYL  + G Y V  E  Y ++  V  E D+     Q  P+   EE+SYF K+  ++ + ++ +   P+ + P +R NE+  SF+      DLSISR+ F WG+++ ++P+HV+YVW+DAL NY++G+G+  ++D ++ ++W +     + ++ K+I RFH +YWP  L   G+    +  +HG++     KMSKS+GNV+DP      YG D  RY+ L+E+   +D  ++ + ++   N DLAN+ GNL  RS+ MI K  DG +P+       F+   +  L Q D  I    E +N Q+I   L+ V  ++ E N +     PW L K +  +     L +    V+++    +P +       L    I +S+
  S:   150 FYITTAIVYPNGAPHIGHAYEAIATDVLARFQRLDGKDVFFLTGTDEHGQKMVQTAQKENISALELATRNAELLRKLDETLNISFNRFIRTSEPAHHHSVQEIWKRMAANGDIYLSSYAGWYSVRDEAYYAEDETVVGE-DNVRRGPQGTPVEWVEEKSYFFKLSAYQDRLLALYESQPDFIGPDSRRNEVI-SFVKG-GLKDLSISRTTFDWGVKVPDDPEHVMYVWVDALTNYITGVGFPDENDKDW-RYWPAD----LHIIGKDIIRFHAVYWPAFLMSAGIPLQKRVYAHGFLFNRGEKMSKSVGNVVDPFNLAAQYGVDQVRYFFLREVPFGQDGSYNHEAIVARINADLANDFGNLAQRSLSMIAKQHDGALPEPG----DFSDNDKAILAQADGMIAVAREAMNTQQIHQALNAVWAVVAEANRYFAGEAPWVLAKTDPARQ-KTVLYVAAEVVRQIAILAQPAMPASCATMLDLLGIPASE 625
>gi|13470650|ref|NP_102219.1| methionyl-tRNA synthetase [Mesorhizobium loti MAFF303099] >gi|25009388|sp|Q98MV8|SYM_RHILO Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|14021392|dbj|BAB48005.1| methionyl-tRNA synthetase [Mesorhizobium loti MAFF303099] (516 aa)
Score = 764, Expect = 1.4e-78, Identities = 169/513 (32%), Positives = 275/513 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQL-HPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSSLDNQKINTPEPIYLR 1081
           +K+Y+TTPI+YP+G PHIGHA+T +  D L R+++  G + FF+TG DEHG K+++ A++  + PQ L D+ + +F ++ + +G     +IRTT   H    Q  +  +     IYL  + G Y V  E  + ++     E  D +    L  P+   EEESYF ++  ++ K ++ +   P+ V P  R NE+  SF+ +    DLSISR+ F WG+ +  + KHV+YVW+DAL NY++  GY       + ++W +       ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP   I  YG D  RY+ L+E+   +D  +S   ++N  N DLAN +GNL  RS+ MI K   G++PK  +            L Q    +TT  + +  Q I   L+ + D++ E + +     PW LKK + E+ ++  L      V+RV    +P +   + + L    + + K D   V  D++ +    +  PE ++ R
  S:     4 EKYYLTTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVFFLTGTDEHGLKMQQTAEKEGITPQALADRNSAIFRSMTEAVGGSNDEYIRTTEPRHYASCQAIWKAMAANGDIYLDRYSGWYSVRQEAYFDESETTLGE--DGVRREPLGSPVEWNEEESYFFRLSAYQDKLLALYESQPDFVGPAERRNEVM-SFVKSG-LKDLSISRTTFKWGVPVPGDDKHVMYVWVDALTNYITAAGYPDTKSDQW-RYWPA-----THIIGKDIVRFHAVYWPAFLMSAGIELPKRVFAHGFLFNRGEKMSKSVGNVVDPFALIEHYGLDQVRYFFLREVPFGQDGSYSHDAIVNRTNADLANGLGNLAQRSLSMIAKNCGGVVPKRGE----MTDADSAILDQAVAALTTARKAMAGQGIHLALAAIFDVVAEADRYFAGQAPWALKKTDPER-METVLWTTAELVRRVAVLCQPFIPGSAAKLLDLLAVPADKRDFVHVHADYALVPGTALPAPEGVFPR 507
>gi|163722951|ref|ZP_02130488.1| methionyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] >gi|161403949|gb|EDQ28180.1| methionyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] (643 aa)
Score = 764, Expect = 1.5e-78, Identities = 170/486 (34%), Positives = 275/486 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKY-ISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD--DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKEN-NEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF 1056
           FYITTPIYY +  PH+GHA+TT++AD   RY +  G + +F+TG DEHG K+ E A++ N + ++ VD  + +F NLW  L I    FIRTT   H  VVQE   ++     IY   ++GLYC  CE  Y +    R+  D K    ++ P  + +E +YF ++ +++ + I    K+P  + P    NE+  SFL  +  +DL ISR  +  +WGI +  +  +V YVW DALLNY S LGY + +   FQK+W      +  +++K+I + H IYWP M++  G+        HG+      KMSKSLGNV++P+     YG + FRY+L++E++   DS FSE+ L+   N DLAN++GNLF+R I M +K+  G +P+ + P L+F+ +++      +  +     +++    K L+ V + I+  N +++   PW L K+      L+  +  +L  ++ V   + PVL + +++ +    +D   F
  S:     5 FYITTPIYYVNARPHLGHAYTTIVADTAKRYHQLRGQDAYFLTGTDEHGDKVVEAAEKENKEVRDYVDMISGLFRNLWPELLISNDQFIRTTDADHIKVVQEVLQKIYDNGDIYFSEYEGLYCFGCERFYLE----RELVDGKCPDHEVEPK-KIKESNYFFRMSKYQDWLIDHIKKNPGFIRPQRYANEVL-SFL-KEPLEDLCISRPKTRLTWGIDLPFDENYVTYVWFDALLNYASALGYPEGE--KFQKYWPG----VQHVVAKDILKPHGIYWPTMMKAAGIPVYNHLNVHGYWNVADSKMSKSLGNVVEPLELSKKYGIEQFRYFLMREMTFGLDSSFSEEALVGRINSDLANDLGNLFSRVISMAHKFCKGTVPE-NHPDLAFDSDWKLSDAAMEAVEAYDLAMDEFQFHKGLAAVWEFISRMNKYVDFTSPWVLAKDKAAAAQLEAVMYNLLEGLRLVAGMVWPVLPNAAEKMVGHLGLDKDAF 482
>gi|58579479|ref|YP_197691.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden] >gi|58418105|emb|CAI27309.1| Methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden] (506 aa)
Score = 764, Expect = 1.5e-78, Identities = 179/515 (34%), Positives = 280/515 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKI-NTPEPIYLRI 1082
           M+  Y+TTPIYY +  PHIGH +TTLI+D++ R+K+  GY   FITG DEHGQKIE+ A + N    E  D  + +F +L  ++   +  FIRTT   HK  V   +  L     IYLG + G Y V  E  Y +   +    D K         +  EE SYF ++  F++ +  F  K PN + P  R NE+  SF+ +    D+SISR N SWGI + E+  H++YVW+DAL NYL+ LG+ + + S ++ +W  +++ +V ++ K+I RFH +YWP +L    L  P + ++HGW   E  K+SKSLGNV++P   I  +G D  RY+L+KE+ +  D  +    +IN  N DLANN+GNL  R++ +++K   G IP  +   L  + +     ++  + +   I + N+  ++  V +L +  N +I    PW L K  +   +   L  +L  ++ V   L+P++   S + L Q  +  S++   F      +D   I   PEPI+ +I
  S:     1 MRNIYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKANKSLVEFTDHASAIFQHLTGVMNFSHDDFIRTTEIRHKKAVTGLWRRLYNYGKIYLGNYAGWYAVRDETFYQEKELI----DGKAPTGAEVEWV--EEPSYFFRLSHFQERLLDFYDKHPNFIIPKHRYNEVI-SFVKSG-LKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFPEINSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQKISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRSSIINCINCDLANNIGNLVQRTVSLLHKECRGTIPNVAS-SLFQDEDALPNYQEILENVRICINQYNLNGMIHIVEELSSIANEYIAFRAPWKLSK-TDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIAL--SEYKRSFNNFAVPIDTGIILPKPEPIFTKI 505
>gi|118469128|ref|YP_889680.1| methionyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155] >gi|118170415|gb|ABK71311.1| methionyl-tRNA synthetase [Mycobacterium smegmatis str. MC2 155] (515 aa)
Score = 763, Expect = 1.6e-78, Identities = 162/515 (31%), Positives = 280/515 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLI---LNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----KINTPEPIYLRIESE 1085
           FYITT I YP+G PHIGHA+  +  D + R+K+  GY+  ++TG D HGQK+ E A +  +   EL  + + VF  L + L I +  FIRT+   H    +  +  +     IYL  +KG Y +  E  +T+N    + +  ++      P+   EE++YF ++  +  + ++ + + P  + P  R NE+  SF++     DLSISR+ F WG+ + ++P HV+YVW+DAL NYL+G+G+   +  +F+++W +     + ++ K+I RFH +YWP  L   GL  P +  +HGW++    KMSKS+GNV+DP+  ++T+G D  RY+LL+E+   +D  ++E  +I   N DLAN +GNL  RS+ M+ K     +P   +    F  E    L   D  +  + E  ++  +   L  +  ++   N +    +PW L+K +  +D   F +++   L  V+     L+PV+ + + + L      + +       DFS++ N+      +  P  I+ R +++
  S:     5 FYITTAIAYPNGVPHIGHAYEYIATDAIARFKRLDGYDVRYLTGTDVHGQKMAETAAKEGIPAAELARRNSDVFQRLQEKLNISFDRFIRTSDADHYEASKAIWKRMADAGDIYLDAYKGWYSIRDERFFTENETTEQPDGTRIATETGAPVTWTEEQTYFFRLSAYTDRLLALYEEHPEFIGPDARRNEIV-SFVSGG-LKDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVGFPDTESESFRRYWPAD----LHMIGKDIIRFHTVYWPAFLMSAGLPLPKRIFAHGWLLNRGEKMSKSIGNVVDPVNLVDTFGLDQVRYFLLREVPFGQDGSYNEDAIIGRVNADLANELGNLAQRSLSMVAKNLGAAVPDPGE----FTDEDTALLAAADALLERVREHFDVPAMHLALEAIWSVLGAANRYFSAQEPWVLRKSDAAEDQQRFRTVLYTTLEVVRIASLLLQPVMPESTAKLLDLLGQPTDE------RDFSAIANRIKPGTSLPAPSGIFPRYQND 515
>gi|57239498|ref|YP_180634.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden] >gi|57161577|emb|CAH58505.1| methionyl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden] (506 aa)
Score = 763, Expect = 1.6e-78, Identities = 179/515 (34%), Positives = 280/515 (54%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKI-NTPEPIYLRI 1082
           M+  Y+TTPIYY +  PHIGH +TTLI+D++ R+K+  GY   FITG DEHGQKIE+ A + N    E  D  + +F +L  ++   +  FIRTT   HK  V   +  L     IYLG + G Y V  E  Y +   +    D K         +  EE SYF ++  F++ +  F  K PN + P  R NE+  SF+ +    D+SISR N SWGI + E+  H++YVW+DAL NYL+ LG+ + + S ++ +W  +++ +V ++ K+I RFH +YWP +L    L  P + ++HGW   E  K+SKSLGNV++P   I  +G D  RY+L+KE+ +  D  +    +IN  N DLANN+GNL  R++ +++K   G IP  +   L  + +     ++  + +   I + N+  ++  V +L +  N +I    PW L K  +   +   L  +L  ++ V   L+P++   S + L Q  +  S++   F      +D   I   PEPI+ +I
  S:     1 MRNIYVTTPIYYVNDVPHIGHVYTTLISDIIARFKRLDGYNVKFITGTDEHGQKIEKAAAKANKSLVEFTDHASAIFQHLAGVMNFSHDDFIRTTEIRHKKAVTGLWRRLYNYGKIYLGNYAGWYAVRDETFYQEKELI----DGKAPTGAEVEWV--EEPSYFFRLSHFQERLLDFYDKHPNFIIPKHRYNEVI-SFVKSG-LKDISISRQNISWGISVPEDDNHIIYVWIDALTNYLTTLGFPEINSSEYKNYWVDENSTVVHVVGKDILRFHAVYWPAILMAAELPLPKQILAHGWWTNEGQKISKSLGNVINPFELIEEFGVDQVRYFLIKEMPVGNDGDYKRSSIINCINCDLANNIGNLVQRTVSLLHKECRGTIPNVAS-SLFQDEDALPNYQEILENVRICINQYNLNGMIHIVEELSSIANEYIAFRAPWKLSK-TDPIVMQAVLYKLLEYIRCVGLLLQPIMPYLSSKILDQIAL--SEYKRSFNNFAVPIDTGIILPKPEPIFTKI 505
>gi|83593036|ref|YP_426788.1| methionyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170] >gi|83575950|gb|ABC22501.1| methionyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170] (519 aa)
Score = 763, Expect = 1.7e-78, Identities = 160/479 (33%), Positives = 262/479 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQF 1049
           FY+TTPIYY +  PHIGHA+TTL  DVL R+K+  G++  F+TG DEHGQK+++ A    + PQ   D+ +  F +L   +      FIRTT   HK   +  ++ L+++  IYL  ++G Y V  E  Y ++      +  +L      P+   EE SYF ++ ++++  +  +   P+ + P +R NE+  SF+      DLSISR+ FSWG+ +  +  HV+YVWLDAL NY++ +G+  +   ++ ++W +     + ++ K+I RFH +YWP  L   GL  P +  +HGW   E  K+SKS+GNV+DP   I TYG D  RY+LL+E+    D  FS + +IN  N +LAN++GNL  R + MI K   G +P+   P    +           D++   +++    + L  +  +I   N ++++  PW L+K N+   +   L ++   ++RV   ++P +   +   L Q 
  S:     8 FYLTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVQKSATAAGIDPQTFTDRVSANFRDLAAAMNFSNDAFIRTTEPRHKEACKALWTLLVERGEIYLDAYRGWYAVRDEAFYGEDELTTAADGSRL-APTGAPVEWVEEPSYFFRLSKWQQPLLDLYAARPDFIAPDSRRNEVI-SFVKG-GLTDLSISRTTFSWGVPVPGDEDHVMYVWLDALTNYITAVGFPDQ-TGDYARYWPAN----LHMVGKDILRFHTVYWPAFLMAAGLEVPGRVFAHGWWTNEGQKISKSVGNVIDPRALIETYGLDPVRYFLLREVPFGNDGDFSHRAMINRMNGELANDLGNLAQRVLSMIAKNCAGAVPE-PGPFSEDDDALLAAAVALLDKVRQAMDRQAFHEALEAIWVVIRAANGYVDRQAPWALRK-NDPPRMATVLYVLAEVIRRVALLMQPFVPASAARMLDQL 477
>gi|33863015|ref|NP_894575.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9313] >gi|33634932|emb|CAE20918.1| putative methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9313] (515 aa)
Score = 762, Expect = 2.3e-78, Identities = 169/516 (32%), Positives = 267/516 (51%)
  Q:   568 MKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH--PLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGL---GYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEK----LNIQKILSRVIDLINECNFFIEQVKPWD-LKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTP-EPIYLRIE 1083
           M  + ITTP+YY +  PH+G  +TT+ +D L R+++  G +  F+TG+DEHGQKI+  A+  N+ P+   D+  + + NLW   GI    FIRTT+  H+ +V+  F  +     +YLG  +G YCV CEE   +    +        C  +H  PL  ++EE+ F K+ +F+  I   +  P+ ++P+ R NE+ N         D SISR +  WG+ +   PKH  YVW DAL+ YLS L   G + + +   +  W +     V L+ K+I RFH +YWP ML   GL  P +   HG++  E  KM KSLGNVLDP   +   G DA R+YLL+++    D  F +K  ++  N DLAN +GNL NR+  M  K+ +G +P +        I++   L    +   TI+ +    +        ++ L    N ++ +  PW  +K   NE ++   L  +L A + V   + P++   S+  L Q  +     D      +  L +  +  P +P+  R+E
  S:     1 MMTYTITTPLYYVNDKPHLGSLYTTMASDALARFQRLEGKQVMFVTGVDEHGQKIQRTAEGNNISPKHHCDQITRSYQNLWSRWGISNDRFIRTTSHRHQLLVEAFFHRVETSGDVYLGRQQGWYCVGCEEYKDEPPQAQSP------CCPIHQKPLEWRDEENLFFKLSRFQSKIEDLISQPDFIWPVMRRNEIQNFVAQG--LRDFSISRVDVDWGLPVPGYPKHTFYVWFDALVGYLSALLDDGGQVRIERLEECGWPAS----VHLIGKDILRFHAVYWPAMLISAGLPLPKQVFGHGFLTREGQKMGKSLGNVLDPEKLLEICGADAVRWYLLRDIQFGHDGDFQQKRFMDLVNNDLANTIGNLLNRTSTMARKWFEGSVPTHRD-----EIDYAHPLVTTAETTITIVRQSMPSMAFHDAAEAILKLAIAANVYLNETAPWSRMKTPGNEAEVADDLYSVLEACRLVGLLINPLVPSLSERLLNQLGLSIDGNDWSKGLAWGQLQSGALLPPSQPVMQRLE 510
>gi|39935844|ref|NP_948120.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris CGA009] >gi|39649698|emb|CAE28219.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris CGA009] (514 aa)
Score = 762, Expect = 2.3e-78, Identities = 171/511 (33%), Positives = 278/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT---TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----KINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHG K+ + A++  L P  L  + A  F  +   LG+ Y  FIRT+ E H   VQE +  +  K  IYL  + G Y V  E  Y ++  V    DDK+    Q  P+   EE+SYF K+  ++  +    +D P+ + P +R NE+  SF+ +    DLS+SR+ F WG+++  +P+HV+YVW+DAL NY+SG+G+  ++D N+  +W +     V ++ K+I RFH +YWP  L   G+    +  +HG++  +  KMSKS+GN++DP    + YG D  RY+ L+E+    D  ++ + ++N  N DLAN++GNL  RS+ M+ K  +G +P++     +F+      L   D  IT   T +    I + L+ V  ++ E N +     PW L K +  +     L +    ++++    +P +   + + L    I   +       DF++L  +      +  P PI+ R
  S:     7 FYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQTAQKEGLTPHALATRNAGRFREMDDRLGVSYDRFIRTSEEQHHRSVQEVWKRMQDKGDIYLDSYSGWYSVRDEAYYAEDETV--VGDDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLYEDQPDFIGPDSRRNEVI-SFVKS-GLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYISGVGFPDENDKNWH-YWPAD----VHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKGEKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGNLAQRSLTMVAKQCEGKVPEHG----AFSETDSAILAMADAMITQARTAMATQQIHQALNAVWAVVAEANRYFAGEAPWALAKTDPARQ-KTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIAEGQ------RDFAALATRIVPGTPLPAPAPIFPR 507
>gi|85374072|ref|YP_458134.1| methionyl-tRNA synthetase [Erythrobacter litoralis HTCC2594] >gi|84787155|gb|ABC63337.1| methionyl-tRNA synthetase [Erythrobacter litoralis HTCC2594] (519 aa)
Score = 762, Expect = 2.6e-78, Identities = 170/516 (32%), Positives = 280/516 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTD---FSSLDNQKINTPEPI--YLRI---ESED 1086
           FYITT I YP+G PHIGHA+  + ADV+ R++++ G +  F TG DEHG K+  KA+E    P++L D+ +  F  +   L +    FIRT  + H    Q  +  +     +YL  ++G Y V  E  Y ++  V  E D+KL   Q  P+    EES+F ++ +++  +   L+ P  + P +R NE+  +F+      DLS+SR++F WG+++  +  HV+YVW+DAL NY++GLGY   DD+   + W       + L+ K+I RFH IYWP  L   GL  P +   HG+++ +  K SKSLGNV DP    + YG DA RY+L++E+S   D  +S + ++   N +LAN+ GNL  R++ MI+K  DG + K+ + +       +  L    + +    EKL     +   I  +  CN ++++  PW L+K + E+ +   L  +L A+  +   ++PV+ + +   L    + + +     ++    F+ L  +    P+P   + R+   ESED
  S:     5 FYITTAISYPNGRPHIGHAYEAIAADVIARFQRQRGLDVRFQTGTDEHGLKMARKAEEQGKSPRDLADEMSGYFKAMCDALNVSCDRFIRTVDDDHHRASQAIWRAMEAAGDLYLDRYEGWYSVRDEAYYDESELVDGEGDEKL-SPQGTPVEWTVEESWFFRLSKYEDKLLKLLESPGFLEPASRRNEMV-AFVKQG-LRDLSVSRTSFDWGVKVPGSEDHVMYVWVDALTNYITGLGY--PDDT---ELWRKHWPADLHLIGKDIVRFHTIYWPAFLMSAGLPVPKQVFGHGFVLKDGRKESKSLGNVTDPHDLADFYGVDALRYFLMREVSFGSDGNWSHEAIVTRVNAELANSFGNLAQRTLSMIHKNMDGSLEKF-EARGEDKALLQTVLTACRESLPREFEKLAFSVGIDEWIKAVYACNQYVDEQAPWALRKTDPER-MKAVLQTLLMAIHDLAIAIQPVIPEKAGALLDDLGVPTDRRTYDHISGEGWFNQLVAEGFTVPKPTPAFPRLEMPESED 518
>gi|32266841|ref|NP_860873.1| methionyl-tRNA synthetase [Helicobacter hepaticus ATCC 51449] >gi|32262893|gb|AAP77939.1| methionyl-tRNA synthetase [Helicobacter hepaticus ATCC 51449] (643 aa)
Score = 761, Expect = 2.7e-78, Identities = 187/516 (36%), Positives = 286/516 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENP------KHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIE--FEKQLKQFDDEITTIIEK-LNIQ--KILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALK--QFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIES 1084
           +K  IT+PIYY +  PHIGHA+TT++ D+L ++ +  G +  F+TG DEHGQKIE+ A++ +L PQ   DK +  F  LW    I+Y  F+RTT   H   VQ+ F  +  K  IY G ++G YC+SCE  +T+      EN+    C +   ++Q  EESYF  + +++ K +  +   P+ + P  R NE+      N+  +DLSI+R++F WG+ +  NP      KHV+YVWLDALL+YLS LGY    DS    +W +     +  + K+I RFH +YW   L  L L  P    +HGW   +  KMSKS+GNV++P    N YG ++ RY+LL+E+   +D  FS+K  I   N +L N+VGNL NR IGM  KY       ++    S  +E  F  +L +  + I    EK L++Q  + +  +       N  I + +PW+L K +        L LI N + +    L P++   + +      F+I++  ++ K +     L + K+N   P++ RIES
  S:     3 QKILITSPIYYVNDIPHIGHAYTTILCDMLKKFYQLQGNDVKFLTGTDEHGQKIEQSAQKHSLDPQSYADKISIRFKELWNEFNIDYDIFVRTTDNMHCLSVQKAFEIMYAKGDIYKGSYEGHYCISCETFFTQKQL--NENNACPDCGKPTQIVQ--EESYFFALSKYQNKLLDWYKSHPDFILPQFRQNEIIK--FVNEGLNDLSITRTSFEWGVPLPHNPVRKDDKKHVMYVWLDALLSYLSPLGYLS--DSAKMPYWENA----IHFVGKDILRFHAVYWLAFLMSLELPLPQHIYAHGWWTKDGTKMSKSIGNVINPKEVANAYGIESLRYFLLREMPFGQDGDFSQKAFIERINAELGNDVGNLLNRLIGMSEKY-------FALQVDSVQVEMFFAPELNELKNIIAQAQEKMLSMQPHRYVEELWKAFGLGNSVITKYEPWNLIKSHQTDKAMALLGLIANILAQSSLLLYPIMPQSACKIANTLNFDINAQNYE-KLIKQGQLLASFKLNKIPPLFPRIES 512
>gi|115524873|ref|YP_781784.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisA53] >gi|115518820|gb|ABJ06804.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris BisA53] (518 aa)
Score = 760, Expect = 4.3e-78, Identities = 169/511 (33%), Positives = 275/511 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT---TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----KINTPEPIYLR 1081
           +Y+TT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHGQK+ + A++  L P +L  + A  F  +   L + Y  FIRTT E H    QE +  +LK   IYL  + G Y V  E  Y ++     E D      Q  P+   EE+SYF K+  ++ K +  +   P+ + P +R NE+  SF+      DLS+SR+ F WGI++ +   HV+YVW+DAL NY++G+G+  + D N+ ++W +     + ++ K+I RFH +YWP  L   G+    +  +HG++     KMSKS+GNV+DP      YG D  RY+LL+E+   +D  ++ + ++N  N DLAN++GNL  RS+ MI K    I+P+      +F+   +  L Q D  +    T +    I + L+ V  ++ E N +     PW L K +  +     L +    +++V    +P +   + + L    I + +       DF++L N+     ++  P P++ R
  S:    11 YYLTTAIAYPNGVPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGQKMVQTAQKEGLTPHDLATRNAGRFREMDDKLNVSYDRFIRTTEEQHHRSSQEIWRRMLKNGDIYLDSYAGWYSVRDEAYYAEDETTVGE-DKVRRGPQGSPVEWVEEKSYFFKLSAYQDKLLKLYADQPDFIGPDSRKNEVV-SFVKG-GLKDLSVSRTTFDWGIKVPDEEGHVMYVWVDALTNYITGVGFPDETDPNW-RYWPAD----LHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVFAHGFLFNRGEKMSKSVGNVVDPFNLAEQYGVDQLRYFLLREVQFGQDGSYNHEAIVNRINADLANDLGNLAQRSLSMIAKQYASIVPEPG----AFSDNDKAMLAQADGMLELARTAMATQQIHQALNAVWAVVGEANRYFAGEAPWALAKTDPPRQ-KTVLYVTAEVIRQVAILAQPAIPASAAKLLDILAIPADQ------RDFAALPNRITPGTQMPAPAPVFPR 511
>gi|167365206|ref|ZP_02299350.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1] >gi|192291492|ref|YP_001992097.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1] >gi|192285241|gb|ACF01622.1| methionyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1] (514 aa)
Score = 759, Expect = 5.4e-78, Identities = 169/511 (33%), Positives = 276/511 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEIT---TIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----KINTPEPIYLR 1081
           FYITT I YP+G PHIGHA+  +  D L R+++  G + FF+TG DEHG K+ + A++  L P  L  + A  F  +   LG+ Y  FIRT+ E H   VQE +  +  K  IYL  + G Y V  E  Y ++  V  E D      Q  P+   EE+SYF K+  ++  +    +D P+ + P +R NE+  SF+ +    DLS+SR+ F WG+++  +P+HV+YVW+DAL NY+SG+G+  ++D+N+  +W +     V ++ K+I RFH +YWP  L   G+    +  +HG++  +  KMSKS+GN++DP    + YG D  RY+ L+E+    D  ++ + ++N  N DLAN++GNL  RS+ M+ K  +G +P++     +F+      L   D  I    T +    I + L+ V  ++ E N +     PW L K +  +     L +    ++++    +P +   + + L    I   +       DF++L  +      +  P PI+ R
  S:     7 FYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQTAQKEGLTPHALATRNAGRFREMDDRLGVSYDRFIRTSEEQHHRSVQEVWKRMQDKGDIYLDSYSGWYSVRDEAYYAEDETVVGE-DKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLYEDQPDFIGPDSRRNEVI-SFVKS-GLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYISGVGFPDENDANWH-YWPAD----VHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKGEKMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGNLAQRSLTMVAKQCEGKVPEHG----AFSENDSAILAMADGMIAQARTAMATQQIHQALNAVWAVVAEANRYFAGEAPWALAKTDPARQ-KTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIAEGQ------RDFAALATRIVPGTPLPAPAPIFPR 507
>gi|146340771|ref|YP_001205819.1| methionyl-tRNA synthetase [Bradyrhizobium sp. ORS278] >gi|146193577|emb|CAL77594.1| Methionyl-tRNA synthetase (EC 6.1.1.10) [Bradyrhizobium sp. ORS278] (705 aa)
Score = 758, Expect = 6.2e-78, Identities = 163/491 (33%), Positives = 268/491 (54%)
  Q:   561 ITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           + +  E    FY+TT I YP+G+PHIGHA+  +  D + R+ +  G + FF+TG DEHG K+ + A+   L P EL  + A  F  + + L + +  FIRTT   H   VQ  ++ +L+   IY   + G Y V  E  Y +   V  E D+     Q  P+   EE+SYF ++  ++ K ++ +   P+ + P  R NE+  SF+      DLSISR+ F WG+++  + +HV+YVW+DAL NY++G+G+  ++D+N+ KFW +     V ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP    + YG D  RY+ L+E+   +D  ++ + ++   N DLAN++GNL  RS+ MI K   G++P+  +    F+   +  L + D  I    + +  Q+I   L+ V  ++ E N +     PW L K + ++     L +    +++V    +PV+   S + L    I
  S:   186 VAAATENANTFYVTTAIAYPNGSPHIGHAYEAIATDAIARFARLDGKDVFFLTGTDEHGLKMVQTAQNEGLTPSELAARNAGRFREMDERLNVSFDRFIRTTEPAHHKSVQAIWTRMLENGDIYADTYSGWYSVRDEAYYAEEETVVGE-DNVRRGPQGTPVEWVEEKSYFFRLSAYQDKLLALYENQPDFIGPDARRNEI-TSFVRGG-LKDLSISRTTFDWGVRVPHDDEHVMYVWVDALTNYITGVGFPDENDANW-KFWPAD----VHVIGKDIIRFHAVYWPAFLMSAGVPVPKRVYAHGFLFNRGEKMSKSVGNVVDPFNLADQYGVDQLRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSLSMITKQFGGVLPEPGE----FSANDQAILAEADAMIGAARKAMATQQIHQWLNAVWSVVAEANRYFAGEAPWALAKTDPKRQ-HTVLYVTAEVIRQVAILTQPVMPAASAKLLDSLGI 667
>gi|163843264|ref|YP_001627668.1| methionyl-tRNA synthetase [Brucella suis ATCC 23445] >gi|163673987|gb|ABY38098.1| methionyl-tRNA synthetase [Brucella suis ATCC 23445] (515 aa)
Score = 758, Expect = 7.5e-78, Identities = 164/519 (31%), Positives = 279/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+ S    +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    + + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPS----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|154248247|ref|YP_001419205.1| methionyl-tRNA synthetase [Xanthobacter autotrophicus Py2] >gi|154162332|gb|ABS69548.1| methionyl-tRNA synthetase [Xanthobacter autotrophicus Py2] (550 aa)
Score = 758, Expect = 7.8e-78, Identities = 162/476 (34%), Positives = 262/476 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           FYITT I YP+G PH+GHA+  +  D + R+K+  GY+  F+TG DEHG K+ + A++  + P+EL+ +    F+ + +   +    FIRTT E H    Q  ++++     IY   + G Y V  E  Y ++     E   +L   Q  P+   EEESYF ++  ++ + ++ + ++P  + P  R NE+  SF++     DLSISR+ F WGI +  + KH++YVW+DAL NY++ LGY   +   F++FW +     + ++ K+I RFH +YWP  L   GL  P +   HG++     KMSKS+GNV+DP     TYG DA RY+ L+E+S  +D  +S + ++   N DLAN++GNL  RS+ MI K  DG++P+        + E E  L   D  +    E +  Q I   L+ V +++ E N +     PW L+K +  + +   L +    ++ V   ++PV+ + +   L
  S:    39 FYITTAIAYPNGVPHMGHAYEAIATDCIARFKRLDGYDVRFLTGTDEHGIKMLQTAQKAGVTPRELLARNVPRFEAMVEAFNLSIDDFIRTTQERHHASSQAIWAKMAANGDIYKSTYAGWYSVRDEAYYAEDETQLNEQGIRL-GPQGTPVEWVEEESYFFRLSAYQDRLLAYYAENPGFIMPEARRNEVV-SFVSGG-LTDLSISRTTFDWGIPVPGDDKHIMYVWVDALTNYITALGYPDTEAELFKRFWPAN----LHVIGKDIIRFHAVYWPAFLWSAGLEAPKRVFGHGFLFNRGEKMSKSVGNVIDPFDLAATYGVDAIRYFFLREVSFGQDGSYSHEAIVARMNADLANDLGNLAQRSLSMIAKNLDGVVPQPG----PLSPEDEAILALADGMLEKSREAMEGQAIHHYLAAVWNVVAEANRYFAAQAPWALRKTDPAR-MATVLWVTAELIREVGILVQPVMPESAARLL 506
>gi|99034647|ref|ZP_01314595.1| hypothetical protein Wendoof_01000592 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (471 aa)
Score = 756, Expect = 1.1e-77, Identities = 173/448 (38%), Positives = 262/448 (58%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEI------------------------------VQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNE 1013
           E  + FYITTP+YY +  PHIGHA+T+L+ DV+ R+ K  G    F TG DEHGQKIE+ AK   ++P+E  D+ +  F  L K +  EY  FIRTT E HK  V   ++ L ++  IYL  + G Y V  E  Y ++  +    D K         I+  EESYF ++  +++ +    K+ P+ ++P +R NE+  SF+ +    DLSISR++F+WGI++  N KHV+YVW+DAL NYL+ +G+   +   +++FW   + +I                              V ++ K+I RFH +YWP +L    L  P +   HGW + E  K+SKSLGNV+DPI     +G D  RY+LL+E S  +D  FS+K +I+  N +LANN+GNL  R+I  ++K   GI+P   +  L    E     K   D++   + K     I+  +I++ +E N +I++  PW L K + E
  S:     2 EQFENFYITTPVYYVNDKPHIGHAYTSLLCDVVARFMKLAGKNVKFTTGTDEHGQKIEKAAKAKEMQPKEFTDEVSVSFKELAKFMNFEYDDFIRTTEERHKKAVIALWNRLEERGQIYLDSYSGWYSVRDEAFYQESELI----DGKAPTGAEVQWIK--EESYFFRLSNWQEKLLELYKNQPSFIFPESRRNEVI-SFVRS-GLIDLSISRTSFNWGIKVPGNDKHVIYVWIDALTNYLTSIGFPSTEGEEYKRFWAEPETQIPVSSTGMTPNQGKTQIPVSSAANLADNSFNVHVIGKDILRFHAVYWPAILLAADLPLPKQIAVHGWWLNEGEKISKSLGNVIDPIGLAQEFGVDQLRYFLLREASFGQDGNFSKKNMISRINSELANNIGNLVQRTISFLHKQCSGIVPTIDQSLLKGE-ESLPGCKAILDQVMNHLSKYEFNHIILLIINISSEANAYIDKSAPWTLSKTDRE 471
>gi|169628221|ref|YP_001701870.1| methionyl-tRNA synthetase [Mycobacterium abscessus] >gi|169240188|emb|CAM61216.1| Methionyl-tRNA synthetase (MetG) [Mycobacterium abscessus] (523 aa)
Score = 756, Expect = 1.2e-77, Identities = 163/481 (33%), Positives = 260/481 (54%)
  Q:   566 EVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD---DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-------NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           E +  FYITT I YP+G PHIGHA+  +  D + R+K+  G++  ++TG DEHG K+ + A    +   +L    + VF+ L + L I +  FIRTT   H    +  + ++     IYL  + G Y V  E  YT        +  +   A   P+   EE SYF ++  ++ K ++ +   P  + P  R NE+  SF++     DLSISR+ F WG+ + +NP+HV+YVW+DAL NYL+G+GY   D   F ++W +     + ++ K+I RFH +YWP  L   G+  P +  +HG++  +  KMSKS+GNV+DPI  +NT+G D  RY+LL+E+   +D  ++E+ LI   N DLAN +GNL  RS+ M+ K   GI+P+  +    F  E  + L   D   ++  T  E   +   L  +  ++   N +    +PW L K         +++     L   L  V+ V   ++PV+ + + + L
  S:     3 ESLDPFYITTAIAYPNGEPHIGHAYEYVATDAVARFKRLDGFDVRYLTGTDEHGLKVAQTAAAAGIPTAQLARHNSDVFEALQRTLNISFDRFIRTTDPDHYEASKAIWRKMADNGDIYLDTYSGWYSVRDEAYYTDAETTVAPDGTRTATATGTPVDWTEEHSYFFRLSAYQDKLLAHYEAHPEFIGPDVRRNEVV-SFVSGG-LRDLSISRTTFDWGVPVPDNPEHVMYVWVDALTNYLTGVGYPDTDSELFGRYWPAN----IHMIGKDIIRFHTVYWPAFLMSAGIALPQRVFAHGFLTNKGEKMSKSIGNVVDPINLVNTFGLDQVRYFLLREVPFGQDGSYTEEGLIGRINADLANELGNLAQRSLSMVAKNLGGIVPEPGE----FAPEDTELLAAADTLLEQARTHFEVPAMHLALEAIWQVLGASNRYFSAQEPWVLAKSFQTDGSAADQERFGTVLYTTLEVVRIVALLVQPVMPESAAKLL 484
>gi|170782642|ref|YP_001710976.1| putative methionyl tRNA synthetase [Clavibacter michiganensis subsp. sepedonicus] >gi|169157212|emb|CAQ02395.1| putative methionyl tRNA synthetase [Clavibacter michiganensis subsp. sepedonicus] (528 aa)
Score = 755, Expect = 1.6e-77, Identities = 173/476 (36%), Positives = 264/476 (55%)
  Q:   563 SKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKY-AKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEN--DDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           S+GE    FYITTPI+Y +  PHIGHA+T + ADVL R+ ++ G +T+F+TG DEHGQKI   A   +  P+   D+   + +  L + + I    FIRTT   H+  V+     L    FIY G +KG YCV CEE    +  +      + +L CA    P+   EE++YF ++  F + + +F ++ P+ + P +  NE+  SF+     +DLSISRS+F WGI I  +  HVVYVW +AL+NY++ +GY   DD+ F + W +       L+ K+I RFH + WP ML  LG   P +   HGW++    KMSKS    + P    +T+G DAFRYY ++  +  +D  FS + L   +  +LAN  GNL +R I M+ +Y DG IP+ ++   + ++  +   +         IE+L I + L+ V  L++E N +I   +PW L KK+ +   L+  L   +  +  +   L PVL
  S:     5 SRGE---PFYITTPIFYVNDVPHIGHAYTEVAADVLARWHRQRGDDTWFLTGTDEHGQKILRTATANDTTPKAWADRLVTESWQPLLEAVDISNDDFIRTTDARHEESVKVFLQRLHDAGFIYTGEYKGYYCVGCEEYKQPSDLLEGTGPFEGQLVCAIHSKPVELLEEKNYFFRMSDFGERLLAFYEERPDFIQPESARNEIL-SFVRRG-LEDLSISRSSFDWGIPIPWDESHVVYVWFEALMNYVTAIGYGVDDDA-FHRRWPA-----THLVGKDILRFHAVIWPAMLMALGEEPPRRVFGHGWLLVGGEKMSKSKLTGIVPQTITDTFGIDAFRYYFMRAFAFGQDGSFSWEDLSARYQAELANGFGNLSSRVIAMVGRYFDGRIPEANELTEA-DLRVQSVARAAASTADDAIERLAIHESLAAVWTLVDELNGYITSQEPWALAKKDEDRARLETVLHTAVRGLGTLAVLLAPVL 474
>gi|168023212|ref|XP_001764132.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162684572|gb|EDQ70973.1| predicted protein [Physcomitrella patens subsp. patens] (640 aa)
Score = 755, Expect = 1.6e-77, Identities = 177/515 (34%), Positives = 275/515 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKL--YCAQLH--PLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD---DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIE----KLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCF--LSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFV-TDFSSLDN-QKINTPEPIYLRIE 1083
           ++F +TTP+YY +  PH+G A+ T+ AD L R+++  G +  FITG DEHG+KI   A      P+E  D  A  +  LWK LGI Y  FIRTT  +H+ +V E +  +  K  IY   ++GLYCV+CEE         K+ D+ +   C  +H  P   + E++YF  + ++++ +   L  +PN V P  R+NE+       +   D SISR+   WGI +  NPK  +YVW DALL Y+S L    K+    +  ++ W +     V ++ K+I RFH +YWP ML    L  P     HG++  +  KM KSLGN ++P   ++ +G D+ RYY LKE+   +D  FSEK  I   N +LAN +GNL NR++G++ K  D +IP  S      +I  E  ++    E  +  +    +L+       ++ +    N ++ +  PW L KE      D    L++IL AV+ +   L PV+ +       Q     + F  I +  T +  L + Q +   +PI+ R+E
  S:    86 ERFTVTTPLYYVNAAPHMGSAYPTIAADALARFQRLQGRDVNFITGTDEHGEKIALAAAAKGRAPKEHCDAVAAEYQLLWKELGIAYDKFIRTTDSHHETLVDEFYKRVEAKGDIYQAKYEGLYCVNCEE--------YKDEDELIEDLCCPIHRKPCEARNEDNYFFALSKYQQPLEELLSSNPNFVRPSFRMNEVQGWV--KEGLRDFSISRAAVEWGIPVPTNPKQTIYVWFDALLGYISALLPEGKEPILTNATERGWPAS----VHIIGKDILRFHAVYWPAMLMSADLPLPEAVFGHGFLTKDGLKMGKSLGNTIEPRELVSKFGPDSVRYYFLKEIEFGKDGDFSEKRFIEIVNANLANTIGNLLNRTLGLLKKNCDAVIPVDSS-----SISEENPIRILAAESVSKAKLHYSELDYSSACDIILGIATAGNLYMSEKAPWSLFKEGGSAAEDAAQELTVILEAVRIIAVALSPVVPELCNRIYLQLGFTEADFKSISWNDTQWGGLKSGQVMADAQPIFQRLE 598
>gi|94984831|ref|YP_604195.1| methionyl-tRNA synthetase [Deinococcus geothermalis DSM 11300] >gi|94555112|gb|ABF45026.1| methionyl-tRNA synthetase [Deinococcus geothermalis DSM 11300] (670 aa)
Score = 754, Expect = 1.8e-77, Identities = 164/490 (33%), Positives = 256/490 (52%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYA-KVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIK 1059
           +F+ITT I Y +G PHIGH +  ++AD L RY +  GY+  F+TG DEHG+KI + A +    PQ  VD  + + F  LW  L I Y  FIRTT   HK  V E    +     IY   ++GLY V  E   T+   V   +  + Y     P   + E +YF ++++++ ++ + + ++P+ + P    NE+       +   DLSISR  S   WGI++  +P HV YVW DALLNY+S    R   +    K W+        ++ K+I + H ++WP ML   GL    K + H  I+ E G KM KSLGN +DP   +  Y  DA RY LL+E +L  DS + E +L++  N DLAN++GNL +R++ MI KYR G++P+  +          K L     E+ T++  L +   +   ++ + + N +I + +PW+L K E   + LD  L      ++     LE V+   ++E   Q  +    + ++
  S:    11 EFFITTAIDYANGAPHIGHVYEKILADALARYHRLAGYDVTFVTGTDEHGEKIAKAAAKAGQTPQTFVDDLSLRAFKGLWDRLEISYDDFIRTTEGRHKRFVAEILQRVYDAGDIYFAEYEGLYSVGAERYVTEKELVEGPDGVRRYPGDKDPPELRREANYFFRMEKYQDWLRAHIEQNPDFIQPAGYRNEVLEML--REPIGDLSISRPKSRVPWGIELPWDPDHVTYVWFDALLNYVSAPVSRGLGEETIGKAWH--------VIGKDILKPHAVFWPTMLRAAGLPIYRKLVVHSHILAEDGRKMGKSLGNAIDPEQLVREYPVDAIRYTLLREATLSADSPYGEGILVSRLNSDLANDLGNLLSRTVSMIQKYRGGVLPQALEVGEREREVEAKALA-LPSEVMTLVRDLKVNMAIETAMNFVRDLNRYIAESQPWNLAKSEETARRLDTVLYTAAEGLRVASVALEAVIPGKARELRAQLGLGGQSYALR 495
>gi|22298292|ref|NP_681539.1| methionyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] >gi|25009348|sp|P59081|SYM_SYNEL Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|22294471|dbj|BAC08301.1| methionyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] (529 aa)
Score = 753, Expect = 2.3e-77, Identities = 179/512 (34%), Positives = 270/512 (52%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQ-KEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDD---SNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI----IEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSS---------LDNQKINTPEPIYLRI 1082
           F +TTP+YY +  PHIG A+TT+ ADVL R+ +  GY+  FITG DEHGQKIE  A++  L PQ   D+ A  F  LW+ L I Y  F RTT+  H  +V E F  +     IYLG  +G YCV CEE   +   +         C   ++  ++ ++E +YF ++ ++++  +  + + P+ V P +R NE+  SF+      D SISR N +WG  +  +P+  +YVW DALL Y++ L    +D+   +N  K W   +  I+    K+I RFH I WP ML   GL  P +   HG++  +  KM KSLGN LDP   +  YG DA RYY +KE+    D  FSE   +   N DLAN++GNL NR++ M  KY DG +P          I  E  L+Q  + ++        +L   ++  + + L    N F+++  PW   +      +   L  +L +V+ V Y L P++   S+    Q    S +F+     D              +Q +  PEPI+ ++
  S:     5 FSLTTPLYYVNALPHIGSAYTTIAADVLARFYRLQGYQVRFITGTDEHGQKIERTAQQRGLSPQAHCDEIAAGFQALWQQLNIHYDRFSRTTSPRHHAIVNEFFQRVWDNGDIYLGQQQGWYCVECEEFKEERELLEGRR-----CPIHVNRTVEWRDERNYFFRLSKYQQALLDHYAEHPDFVQPPSRRNEVL-SFIER-GLQDFSISRVNLAWGFPVPTDPEQTLYVWFDALLGYVTAL-LEPEDEPTLANALKTWWPINLHII---GKDILRFHGISWPAMLMSAGLPLPEQIFVHGFLTKDGQKMGKSLGNTLDPFALVAQYGADAVRYYFMKEVEFGRDGDFSETRFVTILNADLANDLGNLLNRTLKMAWKYTDGKVPNVQGAA----IPREHPLRQLAEHLSQTYGQGYRQLAFHEVCQQALTLARAGNKFLDEEAPWKRYRAGETAAVAEILYCVLESVRLVAYVLAPIIPQLSEAIYGQLGY-SIRFNGSIAPDLLGDRQAQWGVLPASQPLANPEPIFQKL 519
>gi|148553410|ref|YP_001260992.1| methionyl-tRNA synthetase [Sphingomonas wittichii RW1] >gi|148498600|gb|ABQ66854.1| methionyl-tRNA synthetase [Sphingomonas wittichii RW1] (523 aa)
Score = 753, Expect = 2.4e-77, Identities = 161/515 (31%), Positives = 280/515 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQ-----------KINTPEPIYLRIESE 1085
           +YITT I YP+G PHIGHA+  + AD + R+++ +G +  F TG DEHG K+ + A+  ++ P+ L D+ +  F  + + L I    FIRT+   H    Q  +  +     +YL  ++G Y V  E  Y +      E   KL   Q  P+   +EES+F ++ ++++ +    +D P+ + P TR NE+  SF++     DLS+SR++F WG+ +  +P HV+YVW+DAL NYL+G+GY  +D +   ++W +     + L+ K+I RFH +YWP  L    +  P +   HG+++ +  KMSKS+GNV+DP+     YG D  RY+LL+E+S  +D  +  + ++N  N +LAN+ GNL  R++ MI K  DG +P   + +    +          DE     E+L     +   +  +  CN +++   PW L+K + E+ +   L  +   ++ +   + P++ D + + L Q  + +         DF+++++Q           ++  P P++ R+E E
  S:     9 YYITTAISYPNGRPHIGHAYEAIAADAIARFQRSMGRDVRFQTGTDEHGLKMAQAARARDITPRALADEMSSYFKEMCETLNISCDRFIRTSDADHYAASQAIWQAMEANGDLYLDRYEGWYSVRDEAFYDEKELTDGEGGQKL-SPQGTPVEWTKEESWFFRLSRYQEPLLQLYRDQPDFIRPETRRNEIV-SFVSGG-LSDLSVSRTSFDWGVPVPGSPGHVMYVWVDALTNYLTGIGYPDRD-AALGRYWPAN----LHLIGKDIVRFHTVYWPAFLMSAKIPLPKQVFGHGFLLNKGEKMSKSVGNVVDPMTMAERYGVDQLRYFLLREVSFGQDGSYGHEAIVNRANAELANSFGNLAQRTLSMIFKNLDGELPALDRTEDDAAL-VRAVATACLDETPRAFEQLAFSIGIEAWMKAVFACNQYVDAQAPWTLRKTDPER-MKTVLGTLFAVIRDLAITILPIIPDSAGKLLDQMGVAAD------ARDFAAIESQAWYDELRASGYRVAQPVPLFPRLELE 519
>gi|115451471|ref|NP_001049336.1| Os03g0209600 [Oryza sativa (japonica cultivar-group)] >gi|108706784|gb|ABF94579.1| Methionyl-tRNA synthetase, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113547807|dbj|BAF11250.1| Os03g0209600 [Oryza sativa (japonica cultivar-group)] (602 aa)
Score = 753, Expect = 2.5e-77, Identities = 171/515 (33%), Positives = 274/515 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGL---GYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFN-------IEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNE------KDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFV-TDFSSLD-NQKINTPEPIYLRIESE 1085
           + +TTP+YY +  PH+G A+TT+ AD + R+++ L     FITG DEHG+KI   A+     P++  D  +  +  LW  L IEY  FIRTT   H+ VV + +S +L    IY   ++GLYCVSCEE   +    ++  ++K     L P + ++E++YF  + +++  +   L K+PN V P  R+NE+           D SISR++  WGI +  + K  +YVW DALL Y+S L   G +       ++ W +     + L+ K+I RFH +YWP ML   G+  P     HG++  +  KM KSLGN L+P   +N +G D+ RY+ L+E+    D  +SE+  IN  N  LAN +GNL NR++G++         K  K  L+F+       I  +  ++   D+     E L +      ++++ N  N +I++  PW   K+  E      KD    L +IL  ++ +   L P+    S     Q      +F  +++  T +  L   Q +  P+P++ RIE+E
  S:    63 YVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLDKRVVFITGTDEHGEKIATSAEACGRNPKDHCDTISNSYKMLWADLDIEYDKFIRTTDRKHEAVVNDFYSRVLDSGDIYRADYEGLYCVSCEEYKDE----KELGENKCCPVHLKPCVPRKEDNYFFALSKYQHQLEDLLTKNPNFVRPSHRLNEVQGWV--KSGLRDFSISRASVEWGIPVPNDTKQTIYVWFDALLGYISALLDDGEKASLQQAVERGWPAS----LHLIGKDILRFHAVYWPAMLMSAGISVPDAVFGHGFLTKDGMKMGKSLGNTLEPKDLVNRFGVDSVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLLNRTLGLLK--------KNCKSTLAFDSIAAADGISLKDNVENLVDKAKDQFENLLLSSACETLMEIGNLGNLYIDEQAPWSCFKQGGESAEKAAKD----LVIILETMRIIAIALSPITPSLSLRIYTQLGFTEDQFRTLRWEDTKWGGLKAGQVMMEPKPVFARIETE 575
>gi|148560370|ref|YP_001258936.1| methionyl-tRNA synthetase [Brucella ovis ATCC 25840] >gi|148371627|gb|ABQ61606.1| methionyl-tRNA synthetase [Brucella ovis ATCC 25840] (515 aa)
Score = 753, Expect = 2.5e-77, Identities = 163/519 (31%), Positives = 278/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    + + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYTGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|23501876|ref|NP_698003.1| methionyl-tRNA synthetase [Brucella suis 1330] >gi|25009345|sp|P59078|SYM_BRUSU Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|23347815|gb|AAN29918.1| methionyl-tRNA synthetase [Brucella suis 1330] (515 aa)
Score = 753, Expect = 2.6e-77, Identities = 163/519 (31%), Positives = 278/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    + + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|54020190|ref|YP_115920.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae 232] >gi|53987363|gb|AAV27564.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae 232] (520 aa)
Score = 753, Expect = 2.9e-77, Identities = 192/515 (37%), Positives = 299/515 (58%)
  Q:   561 ITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSF-LKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN-PKHVVYVWLDALLNYLSGLGYRQKDDSNFQK--FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS-------FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTP 1075
           +  + ++ KK YITTPIYY SG  HIGH +TT++A V+  +KK  G+E    TG DEHGQKI + A + NL+PQE VDK  + F  LW+   I+Y +F RTT   HKN +++ F ++ + + I+ G ++GLY +S EE  +++ AV  +N +  +      +    E+SYF  IK+F+K++  F L++P  ++     NEL  +FL     +DLS++R N  WGI + +      +YVWLDAL +YLS +   Q D  N +K  FW +  A+I+Q++ KEI RFHCIYWPI L+ L  R P+  ++HGW+IT +GKMSKS GNV++P+  +  +  +  ++Y + +++ K DSVF E LL N +N    N  GNL +R+I +I K       K+ +P L         +I F +++    DE     ++L I+K    VI+L    N F +  + W+ K   N K L   L L+LN +  +  +L   +   + E L+   I+   F  I  +  F  ++ +K+  P
  S:     2 LQERSKMTKKCYITTPIYYASGRLHIGHLYTTVLAWVIRNFKKMSGFEARLFTGSDEHGQKISQLAAKANLEPQEFVDKNVENFKFLWEKFEIDYDYFQRTTNLNHKNFIKKIFLKMYEDNHIFNGEYQGLYSISDEEFLSQSQAVY-QNRNYFHPVSGAKMELISEKSYFFPIKKFQKWLEDFLLENPKFIFDSKIANELRQNFLQK-GLEDLSVTRKNLKWGIFLDQKFENQTIYVWLDALFSYLS-VFKDQIDLENPKKSNFW-TDSAQIIQVVGKEIARFHCIYWPIFLKSLNFRLPSIILTHGWLITPEGKMSKSKGNVINPLDLLKKFDPEIIKFYFVSQINTKNDSVFDENLLENFYNSFFVNTFGNLISRTIALIVK-------KFDQPLLFEIADLDWTDISFYEKILLSLDEFCDNFDQLEIEKAFKTVIELTKNLNGFFDIKQLWNQK---NLKKLAQGLILVLNGIYAITVFLSIAMPKKTNEILEFLGINEKNFLLITKLDKFDKINFKKLEKP 514
>gi|177676442|ref|ZP_02946856.1| methionyl-tRNA synthetase [Methylocella silvestris BL2] >gi|172069009|gb|EDT55119.1| methionyl-tRNA synthetase [Methylocella silvestris BL2] (526 aa)
Score = 752, Expect = 3.7e-77, Identities = 164/468 (35%), Positives = 256/468 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIE-FEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           FYITT I Y +G PHIGHA+  +  D + R+K+  GYET F+TGMDEHGQK+++ A   NL P +L D+ A  F  + +LL       +RTT   H    QE +  +     IYL  + G Y V  E  +  +         KL      P+   EEESY+ ++  +++ + +  ++ P+ V P    NE+  +F+      DLSISRS F WG+ +  +PKHV+YVW+DAL NY++G G+     S   KFW + DA ++    K+ITRFH IYWP  L   GL  P + ++HG++     KMSKS+GNV+DP      YG D FRY+LL+E+   +D  +S + ++N  N DLAN++GNL  RS+ M+ K   G++P  S P L+   E    Q +    +    +    +  IL+ +  ++ E N +    +PW +K++ +   ++  L + +  ++ +    +P +
  S:     6 FYITTAIPYANGAPHIGHAYERIATDAIARFKRLDGYETLFVTGMDEHGQKMQQTAARENLSPLQLADRTAAQFYAMGELLNASADDIVRTTEARHHAASQEIWKRMQASGDIYLSKYPGWYSVRDEAFFDDSELTDGPGGSKL-APTGAPVEWVEEESYYFRLSAYQERLLALYRERPDFVTPEKYRNEIV-AFVERG-LTDLSISRSTFDWGVPVPGDPKHVMYVWVDALTNYITGTGFPDAA-SPRAKFWPA-DAHVI---GKDITRFHAIYWPAFLMSAGLLVPKQIVTHGFLFNRGEKMSKSIGNVIDPFALAKEYGVDPFRYFLLREVPFGQDGNYSHEAIVNRTNADLANDLGNLAQRSLSMLAKNCGGVLP--SSPALNETDEALLFQARALPQKARGHMRDYALHLILAEIWRVVGEANRYFATEEPW-VKRKTDPARMESVLYVTVEVLRIIAIMTQPFM 464
>gi|88607461|ref|YP_505630.1| methionyl-tRNA synthetase [Anaplasma phagocytophilum HZ] >gi|88598524|gb|ABD43994.1| methionyl-tRNA synthetase [Anaplasma phagocytophilum HZ] (513 aa)
Score = 751, Expect = 3.9e-77, Identities = 175/518 (33%), Positives = 280/518 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRS--NFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           K F +TTPIYY +  PHIGH +TTLI+DVL R+K+  G    F TG DEHGQKIEE A++      + VD+ ++ F  L    G     FIRTT   HK+ V   +  L  +  IY G + G Y V  E  Y +   +  +         L      EE  YF K+ ++++ +    +D P  V P  +++E+  SF+ +    DLS+SRS  + SWGI +  +P+H++YVW+DAL NYL+ +G+  +D  ++  FW  +++ +V ++ K+I +FH +YWP +L   GL  P + ++HGW + E  K+SKSLGNV+ P+  IN YG D  RY+LL E  +  D+ FS K L    N DLANN+GNL  R++ +++K+ +G +P     KL    E     +   ++    +E+    + L  +I + +  N +I    PW L KE+     +  L  +L  +K +   L+P L   S++ L+Q  +   K   + + +  +   + +    PI+ + + +D
  S:     4 KHFCVTTPIYYVNDVPHIGHFYTTLISDVLARFKRLDGDNVKFTTGTDEHGQKIEETARKRGTPVLQFVDEVSESFRELVHKSGFCADDFIRTTESRHKDAVVALWDRLYSRGQIYKGSYAGFYSVRDETFYQERDLIDGKAPTGAEVTWL------EEPGYFFKLSEWQEALLQLYQDNPRFVVPEGKLSEVI-SFVKSG-LRDLSVSRSKAHLSWGIGVPGDPEHLIYVWVDALSNYLALVGFPNEDAEDYNNFWCGENSHVVHVVGKDILKFHAVYWPALLMAAGLPLPKQVVAHGWWLNEGQKISKSLGNVICPLTIINEYGLDNVRYFLLSETPIGNDASFSAKRLKERVNCDLANNIGNLVQRTVTLVHKWCEGKVPSVDM-KLMCGDEALPDYQGILEQYRVYVEERRFFEALKFIIGVSSTANEYIAVKAPWKLFKEDTAL-AEAVLFKLLEYIKCIGLLLQPFLPVTSEKLLEQIAVPVEKRKFEHIAELCT--GRVLPKAVPIFSKFDMDD 512
>gi|117927385|ref|YP_871936.1| methionyl-tRNA synthetase [Acidothermus cellulolyticus 11B] >gi|117647848|gb|ABK51950.1| methionyl-tRNA synthetase [Acidothermus cellulolyticus 11B] (539 aa)
Score = 751, Expect = 4.0e-77, Identities = 160/446 (35%), Positives = 246/446 (55%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKY-AKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEND---DKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENN 1012
           + K FY+TTPIYY +  PHIGHA+TT+ ADVL R+ ++ G   +F+TG DEHGQK+   A+     PQE  D+  A+ +   W+ L I Y  FIRTT   H   VQ     L +K  IY GV++G YCV+CEE       V  E +    ++      P+ Q  E +YF ++ ++    +  +   P  V P +  NE+   F+      DLSISRS+F WG++I  + + VVYVW DALLNY++ +GY   D++   +F ++  A+ V L+ K+I RFH + WP ML   GL  P K  +HGW++    KMSK+    + P      +G DAFRYY L+     +D+ FS + +   +  +LAN +GNL +R   M  +Y DG++P   +   +        L     +    +++L+    L+R+ DL+   N ++ + +PW L K+++
  S:     1 MTKTFYVTTPIYYVNDAPHIGHAYTTVAADVLARWHRQRGEPVWFLTGTDEHGQKVLRSAQAGGASPQEWADRLVAEAWQPTWRELDISYDDFIRTTEPRHTGRVQAFLQRLYEKGEIYEGVYEGPYCVACEEFKLPGELVSGEGEYAGQQVCPVHRRPVDQLSETNYFFRLSKYADALLDHYAAHPEAVEPESARNEVMQ-FIRQG-LQDLSISRSSFDWGVKIPWDDRQVVYVWFDALLNYITAIGYDAPDETMRARFASTWPAD-VHLVGKDILRFHAVIWPAMLLAGGLPLPRKVFAHGWLLVSGEKMSKTRLTGIAPTQLTAHFGSDAFRYYFLRSFPFGQDASFSWEEMSARYTAELANGLGNLASRVTAMTGRYFDGVLPVPGEVTAA-EQRVADVLAAVVPDADAAMDRLDFFTALARIWDLVLVLNGYLTEQQPWQLAKQDD 447
>gi|62289919|ref|YP_221712.1| methionyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941] >gi|82699846|ref|YP_414420.1| methionyl-tRNA synthetase [Brucella melitensis biovar Abortus 2308] >gi|189024161|ref|YP_001934929.1| methionine--tRNA ligase [Brucella abortus S19] >gi|62196051|gb|AAX74351.1| MetG, methionyl-tRNA synthetase [Brucella abortus biovar 1 str. 9-941] >gi|82615947|emb|CAJ10970.1| Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia [Brucella melitensis biovar Abortus 2308] >gi|189019733|gb|ACD72455.1| methionine--tRNA ligase [Brucella abortus S19] (515 aa)
Score = 749, Expect = 6.8e-77, Identities = 162/519 (31%), Positives = 278/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P++L D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    + + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|33861424|ref|NP_892985.1| methionyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33634001|emb|CAE19326.1| Methionyl-tRNA synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (511 aa)
Score = 749, Expect = 7.3e-77, Identities = 168/458 (36%), Positives = 257/458 (56%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQ-KEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVK 1028
           F ITTP+YY +  PH+G  +TTLI D + RYK+  G +  FITG+DEHG KI+  AK   ++PQ   D+ + +F   WK   I ++ F+RT+++ H+ +V+E ++ + K D IY+GV KG YCV CEE +  N     +N     C      ++ K EE+ F K+ +++  I   +K+P  + P  R NE+ N    +    D SISR+N SWGI + +   H  YVW DALL Y+S +    K+ S  +   N   A+I  L+ K+I RFH +YWP ML   G++ P K   HG++  E  KM KSLGNVLDP   ++ YG++A R+YLLK+++L +D  F  K  ++  N DLAN +GNL NR+  M  K+ D  +P  S   LS +   E   K+  +          +    + ++ L    N ++ + +PW L K+  EK++    ++I N ++
  S:     3 FVITTPLYYVNDKPHLGSIYTTLICDSIARYKRLTGADVIFITGVDEHGLKIQRTAKNKGVEPQFHCDEISDIFKQNWKNWDITHNKFVRTSSQKHEYIVKEFYNRVKKSDDIYMGVQKGWYCVGCEE-FKDN----PDNSPTHKCPIHQKTLEWKNEENLFFKLSKYQSQIEELIKEPAFIQPKERRNEIIN--FVSKGLKDFSISRTNVSWGISVPDIDNHTFYVWFDALLGYVSAISLDMKEPSLDESIDNGWPADI-HLIGKDILRFHAVYWPAMLISAGMKVPKKVYGHGFLTREGQKMGKSLGNVLDPDILLSKYGKEAVRWYLLKDITLGQDGDFQNKRFVDIINNDLANTIGNLLNRTSSMSRKWFDNRVP--SNEMLSKDNSLELYAKKTVENYFRHFNSYELDLAANVILSLAINTNLYLNEKQPWTLIKD--EKNIPLVSNIIYNVLE 449
>gi|72080730|ref|YP_287788.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] >gi|71913854|gb|AAZ53765.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (513 aa)
Score = 749, Expect = 7.5e-77, Identities = 193/509 (37%), Positives = 296/509 (58%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSF-LKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN-PKHVVYVWLDALLNYLSGLGYRQKDDSNFQK--FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS-------FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTP 1075
           + KK YITTPIYY SG  HIGH +TT++A V+  +KK  G+E    TG DEHGQKI + A + NL+PQE VDK  + F  LW+   I+Y +F RTT   HKN +++ F ++ + + I+ G ++GLY +S EE  +++ AV +        +  HP+   +     E+SYF  IK+F+K++  F L++P  ++     NEL  +FL     +DLS++R N  WGI + +      +YVWLDAL +YLS +   Q D  N +K  FW +  A+I+Q++ KEI RFHCIYWPI L+ L  R P+  ++HGW+IT +GKMSKS GNV++P+  +  +  +  ++Y + +++ K DSVF E LL N +N    N  GNL +R+I +I K       K+ +P L         +I F +++    DE     ++L I+K    VI+L    N F +  + W+ K   N K L   L L+LN +  +  +L   +   + E L+   I    F  I  +  F  ++ +K+  P
  S:     1 MTKKCYITTPIYYASGRLHIGHLYTTVLAWVIRNFKKMSGFEARLFTGSDEHGQKISQLAAKANLEPQEFVDKNVENFKFLWEKFEIDYDYFQRTTNLNHKNFIKKIFLKMYEDNHIFNGEYQGLYSISDEEFLSQSQAVYQNG------SYFHPVSGAKMELISEKSYFFPIKKFQKWLEDFLLENPKFIFDSKIANELRQNFLQR-GLEDLSVTRKNLKWGIFLDQKFENQTIYVWLDALFSYLS-VFKDQIDLENPKKSNFW-TDSAQIIQVVGKEIARFHCIYWPIFLKSLNFRLPSIILTHGWLITPEGKMSKSKGNVINPLDLLKKFDPEIIKFYFVSQINTKNDSVFDENLLENFYNSFFVNTFGNLISRTIALIVK-------KFDQPLLFEIADLDWTDISFYEKILLSLDEFCDNFDQLEIEKAFKTVIELTKNLNGFFDIKQLWNQK---NLKKLAQGLILVLNGIYAITVFLSIAMPKKTNEILEFLGIRQKNFLLITKLDKFDKINFKKLEKP 507
>gi|148255487|ref|YP_001240072.1| methionyl-tRNA synthetase [Bradyrhizobium sp. BTAi1] >gi|146407660|gb|ABQ36166.1| methionyl-tRNA synthetase [Bradyrhizobium sp. BTAi1] (722 aa)
Score = 749, Expect = 7.5e-77, Identities = 161/481 (33%), Positives = 265/481 (55%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI 1051
           FY+TT I YP+GNPHIGHA+  +  D + R+ +  G + FF+TG DEHG K+ + A+   L P EL  + A  F ++ + L + +  FIRTT   H   VQ  ++ +L+   IY   + G Y V  E  Y ++  V  E D+     Q  P+   EE+SYF ++  ++ + ++ +   P+ + P  R NE+  SF+      DLSISR+ F WG+++  + +HV+YVW+DAL NY++G+G+  ++D+N+ K+W +     V ++ K+I RFH +YWP  L   G+  P +  +HG++     KMSKS+GNV+DP    + YG D  RY+ L+E+   +D  ++ + ++   N DLAN++GNL  RS+ MI K   G +P+  +    F+      L + D  I    + +  Q+I   L+ V  ++ E N +     PW L K + ++     L +    +++V    +PV+   S + L    I
  S:   213 FYVTTAIAYPNGNPHIGHAYEAIATDAIARFARLDGKDVFFLTGTDEHGLKMVQTAQNEGLTPGELATRNAGRFRDMDERLNVSFDRFIRTTEPAHHKSVQAIWNRMLENGDIYADTYAGWYSVRDEAYYAEDETVVGE-DNVRRGPQGTPVEWVEEKSYFFRLSAYQDRLLALYESQPDFIGPDARRNEII-SFVKG-GLKDLSISRTTFDWGVRVPHDDEHVMYVWVDALTNYITGVGFPDENDANW-KYWPAD----VHVIGKDIIRFHAVYWPAFLMSAGVPVPKRVYAHGFLFNRGEKMSKSVGNVVDPFNLADQYGVDQLRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSLSMIAKQLGGQLPEPGE----FSANDRAILAEADAMIGAARKAMATQQIHQWLNAVWSVVAEANRYFAGEAPWALAKTDPKRQ-HTVLYVTAEVIRQVAILTQPVMPTASAKLLDSLGI 684
>gi|17987270|ref|NP_539904.1| methionyl-tRNA synthetase [Brucella melitensis 16M] >gi|17982947|gb|AAL52168.1| METHIONYL-TRNA SYNTHETASE [Brucella melitensis 16M] (544 aa)
Score = 749, Expect = 8.2e-77, Identities = 165/523 (31%), Positives = 280/523 (53%)
  Q:   565 GEVM--KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           G +M  +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L      + K     V          +  P+P++ R +E++++
  S:    27 GSIMSREKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAAPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 543
>gi|187736581|ref|YP_001878693.1| methionyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835] >gi|187426633|gb|ACD05912.1| methionyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835] (550 aa)
Score = 748, Expect = 8.8e-77, Identities = 188/518 (36%), Positives = 283/518 (54%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEND-DKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFL-KDPNLVYPITRINELFNSFLNNDDFD-DLSISR--SNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS---NFQKFWNSQDAEIVQLMSKEI-TRFHCIYWPIMLEMLGL---RKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLIN----ECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI-DSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIES 1084
           V + +YITT I Y +G PHIGHA+  ++ADVL R+ +  G E +F+TG+D+HGQK+++ A++L + PQE V+     F  LW  LGI    +  TT   HK  VQ+  ++L  K  +Y   +KG Y V  E+  T      KE D +  +  +   +++ EEE+++ ++    +++  F+ K  + V P  R  E+ N+     DFD DL ISR  S  SWGI+   +P+ V YVW DAL+NY+S  GY  + DS    F K W + D E++    K+I    H +YWP ML  +G      PT  + HGW      KMSKS+GNV+DP      +G +  RYYL+++++  +D+ F    L+  +N +LAN++GNL NRSI M  +Y D +I        +++ E  K L+   D+  T+  K     + S  +  +N     CN +IEQ +PW L K E +   L C L  +L    +  Y +  VL D S   L Q N  D  +        +  L    +IN P P++ RI S
  S:    13 VPRMYYITTAIDYTNGPPHIGHAYEKVLADVLARWHRMKGEEVYFLTGVDQHGQKVQQTAEKLGITPQEHVNNITGQFLALWDRLGISNDGWASTTDPRHKACVQKILTDLKDKGQLYKKSYKGFYSVRQEQFLTD-----KERDAEGNFGPEWGEVVELEEENWYFRLTDHVEWMKQFVEKSSDFVLPSFRKAEVLNAI----DFDSDLCISRPKSRLSWGIEFPFDPEFVTYVWFDALINYISFAGYLAEPDSGLPEFSKLWPA-DCEVI---GKDILVPAHGVYWPAMLHAMGFSDEEMPTLLV-HGWWNINGEKMSKSIGNVVDPNLLAEQFGPEPVRYYLVRDITTGKDANFDADRLVMLYNTELANDLGNLCNRSINMTRRYCDSVISGAE----AYDDEASKALRSTMDQAVTLFSKYMDDNMASDALAALNAQVSACNAYIEQQQPWQLAKDEASAPRLRCVLRHLLECCAQTGYLIGCVLPDASARILGQLNAGDLFRGLTPAALKWGILPAGHRINDPAPVFPRILS 531
>gi|94496391|ref|ZP_01302968.1| methionyl-tRNA synthetase [Sphingomonas sp. SKA58] >gi|94424137|gb|EAT09161.1| methionyl-tRNA synthetase [Sphingomonas sp. SKA58] (520 aa)
Score = 748, Expect = 1.0e-76, Identities = 163/515 (31%), Positives = 277/515 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNI--EFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFV-TDFSS---LDNQKINTPEPIYLRIE 1083
           K F ITT I YP+G PHIGHA+  +  D + R+++ +G + FF TG DEHG K+ + A+   ++P+ L D+ A  F  + + L I +  FIRT+   H    Q  +  +     +YLG ++G Y V  E  Y +   +  E   KL   Q  P+    EES+F ++  ++ K ++ +   P+ + P +R NE+   F+      DLSISR++F WG+++ +   HV+YVW+DAL NYL+G GY   D     ++W ++  +I  ++ K+I RFH +YWP  L    L  P +   HG+++    KMSKSLGNV DP+   + +G D  RY+LL E++   D  +S + +I   N DLAN+ GNL  R++  I K  DG +P+ +  ++   +        + F + +  +   + I+  +  V      CN +I+   PW L+K +  + ++  L+ +  A+  +   ++PV+   +   L Q  ID+     + + +DF +        ++ P+P++ R+E
  S:     3 KPFTITTAISYPNGRPHIGHAYEVIATDAIARFQRMMGRDVFFQTGTDEHGLKMAQTARARGIEPRALADEMAGYFKVMNEALNISHDRFIRTSEPDHHRASQAIWRAMEANGDLYLGRYEGWYSVRDEAFYDEKELIEGEGGAKL-SPQNTPVEWTVEESWFFRLSAYQDKLLALYESQPDFIQPESRRNEIMR-FVEGG-LSDLSISRTSFDWGVRVPDADGHVMYVWVDALTNYLTGCGY-PDDAERMARYW-AEGGDITHVIGKDIVRFHAVYWPAFLMSAKLPLPKQIFGHGFLLNRGEKMSKSLGNVADPMELADRFGVDQLRYFLLSEVTFGNDGSYSAEAIIARSNSDLANSFGNLAQRTLSFIAKNLDGRLPEPAAMEVDSALLSGIADACRIFQNAMNDLAPSVAIEAWMRAVF----ACNAYIDAQAPWALRKTDPAR-MEAVLATLYEAIASLAVMIQPVIPASAAALLDQMGIDADARSYELIGSDFYAALRASGFALSPPKPLFPRLE 514
>gi|161618949|ref|YP_001592836.1| methionyl-tRNA synthetase [Brucella canis ATCC 23365] >gi|161335760|gb|ABX62065.1| methionyl-tRNA synthetase [Brucella canis ATCC 23365] (515 aa)
Score = 748, Expect = 1.0e-76, Identities = 163/519 (31%), Positives = 277/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+      DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L    + + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNNSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKLG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|87199956|ref|YP_497213.1| methionyl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444] >gi|87135637|gb|ABD26379.1| methionyl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444] (521 aa)
Score = 748, Expect = 1.1e-76, Identities = 165/513 (32%), Positives = 282/513 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKK-YISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQF----DDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNI--DSSKFDIKFVTDF---SSLDNQKINTPEPIYLRIE 1083
           FYITT I YP+G PHIGHA+  + ADV+ R+++ +G +  F TG DEHG K+ +KA+EL + P+EL D+ +  F  +   L + Y  FIRTT E H    QE +  +     +YL  ++G Y V  E  Y ++  V  E  +KL   Q  P+    EES+F ++ ++ +  +  + ++P  + P +R NE+   F+      DLS+SR++F WG+++     HV+YVW+DAL NY++GLG+   ++ +F K+W +     + L+ K+I RFH +YWP  L    +  P +   HG+++    K SKSLGNV DP+   + +G D  RY+L++E++  +D  +S + ++   N +LAN+ GNL  R++ MI K   G +  +       N+  ++ L        +E+      LN    +   +  +  CN ++++  PW L+K + E+     L+L + A++ +   + PV+   + + L Q  I  ++  FD     D+        +++  P P + R+E
  S:     5 FYITTAISYPNGKPHIGHAYEAIAADVIARFQRAMGRDVRFQTGTDEHGLKMAQKARELGITPRELSDEMSSYFIKMCDELNVSYDVFIRTTEERHHASTQELWRRMEANGDLYLDRYEGWYSVRDEAFYDESELVAGEGGEKL-SPQGTPVDWTVEESWFFRLSKYAEPLLKLYEENPGFIQPDSRRNEVMR-FVEG-GLRDLSVSRTSFDWGVKVPGCDGHVMYVWVDALTNYITGLGF-PDENGDFAKYWPAN----LHLIGKDIVRFHTVYWPAFLMSADIALPRQVFGHGFLLNRGQKESKSLGNVTDPLDLADRFGVDPLRYFLMREVAFGQDGSYSAEAIVTRCNAELANSYGNLVQRTLSMIFKNMGGNLETFHS-----NVGDDELLATVFNACREELPREFSALNFSAGIEAWMRAVFACNAYVDEQAPWALRKTDPERMKAVLLTLFI-AIRDLTVAISPVVPAAAAKVLDQLGIPREARGFDALTDADWYMARVATGERLAQPMPAFPRLE 513
>gi|25009373|sp|Q8YH17|SYM_BRUME Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) (515 aa)
Score = 747, Expect = 1.2e-76, Identities = 163/519 (31%), Positives = 277/519 (53%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKI---LSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLR-IESEDK 1087
           +K+YITT I YP+G PHIGHA+  +  D + R+++  G + +F+TG DEHG K+ + A++  + P+EL D+    F  + ++L      +IRT+ E H    Q  +  ++    IY G + G Y V  +E Y          D   Y  Q  P+   EEESYF ++  ++ K +  +  +P  + P  R NE+  SF+ +    DLSISR+ F WGI +  + KHV+YVW+DAL NY++ LGY    D  +  +W +       ++ K+I+RFH +YWP  L    L  P +  +HG++     KMSKS+GNV+DP   +  YG D  RY+L++E+   +D  +S + ++N  N DLAN++GNL  RS+ MI K  +G +P+      +F+   +  L Q D  + T  + ++ Q +   L  +  ++ E N +    +PW L+K +  + +   L +    ++RV   ++P +   +++ L      + K     V          +  P+P++ R +E++++
  S:     4 EKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRELADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQVIWQAMVANGDIYKGGYAGWYSVR-DEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYENNPGFIMPAERRNEIV-SFVKSG-LKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITALGYPDTTDERW-AYWPAN----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLAQRSLSMIAKNCEGKVPQPG----AFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVAEANRYFAGQEPWALRKTDPAR-MGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAAPADKRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQ 514
>gi|56551988|ref|YP_162827.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543562|gb|AAV89716.1| methionyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4] (521 aa)
Score = 747, Expect = 1.4e-76, Identities = 158/462 (34%), Positives = 250/462 (54%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFK-KYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRV 1030
           + FYITT I YP+G PHIGHA+  + +D L RY +  G + +F TG DEHG K+ + A+  +++P  L D+ +  F  +  +  I Y  FIRTT   H    Q  +  L     IYLG ++G Y +  E  Y +   V     +KL   Q  P+    EES+F ++  F+ K ++ +   P+ + P  R NE+  SF+ +    DLSISR++F WGI + ++P HV+YVW+DAL NYL+G GY   +   F ++W +     + ++ K+I RFH +YWP  L    +  P K   HG+++    KMSKS+GNV+DPI     YG D  RY+LL+E++  +D  +S + ++N  N DLAN+ GNL  RS+ +I K     +P     +       EK +     ++ T +  +   + L  +   + E N +I +  PW ++K +  +  D  L   + AV+++
  S:     3 QSFYITTAISYPNGKPHIGHAYEAIASDALARYHRLAGDDVYFQTGTDEHGLKMAQTARNRDIEPIALADEMSSHFKTMDDVYNISYDRFIRTTEAEHYKASQALWKTLADAGHIYLGRYEGWYSIRDEAFYKEEELVTDSKGEKL-SPQGTPVEWNVEESWFFRLSAFQDKLLAYYEAHPDFIQPEARRNEVI-SFVKS-GLADLSISRTSFDWGIPVPDSPGHVMYVWIDALTNYLTGAGY-PDNKERFDRYWPAD----IHVIGKDIIRFHAVYWPAFLMAADIALPKKVFGHGFLLNRGEKMSKSVGNVVDPIDMAKLYGVDQIRYFLLREVTFGQDGSYSHEAIVNRINADLANDFGNLAQRSLSIIAK-NGAKVPSPEDTRAEDQALMEK-IAGIPHQVATAMNNVAPNQALDAIWRGVGEANLYISEQAPWTVRKTDPVR-ADTILYWTIEAVRQL 454
>gi|145346067|ref|XP_001417517.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144577744|gb|ABO95810.1| predicted protein [Ostreococcus lucimarinus CCE9901] (573 aa)
Score = 746, Expect = 1.7e-76, Identities = 178/498 (35%), Positives = 265/498 (53%)
  Q:   539 AAHDIEDVTQLIEAI------KEYID------LKITSKGEVMK-----KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQG-KMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEP 1036
           AA+++ED    +EA+      KE  D        +   G  +K     +F +TT I Y +G PH+GHA+ ++  DVL RY +  G +  F TG DEHGQKI E A+E  + P   VD +   F NL K L +    + RTT+E HK    E F        IYL  ++G Y V  E   T++ A      D +    L  +   +EESYF K  ++ K+ I+    +P  + P +R NE+  + L NDD  DLS+SR+ F WGI + + PKHV+YVW DAL NYL+G G+ ++ ++  + FW +     V ++ K+I  FHC+ WP ML   GL  P     HG++  + G KMSKS+GNV+DP   +  +  D FRYYL++      D  FSE  +I   N DLA+ +GNL +R   +  K   GIIP  +   + F++   +   +        + + NIQ      I+ I   N ++    PW +K E  E+     +   L AV   +++L+P
  S:    27 AANEVEDARIALEAVDVRERAKEVDDDARAKERAVEDAGRGVKDPRGERFSVTTAINYANGAPHMGHAYESISTDVLARYHRAYGRQVLFQTGSDEHGQKIAEAAEEKGMAPLAFVDTHVAEFQNLNKRLDVSNDVYNRTTSEAHKKACAELFRRSRDNGDIYLDTYEGWYNVREETFVTESEAQASGYKDPVSGKDLKKM---KEESYFFKQSRYQKQLIAHIESNPEFIQPSSRRNEIL-ARLQNDDLRDLSVSRTTFDWGIPVPDAPKHVMYVWFDALTNYLTGTGWPEETEN--KDFWPAS----VHIIGKDIIWFHCVIWPCMLWSAGLPLPKTVFGHGFVTADDGQKMSKSIGNVVDPNDVLKRFSSDTFRYYLMRCGVYGADVPFSEPAMIAIHNADLADVIGNLVHRVTNLCKKNCGGIIPDCASENV-FSVGVLRAKSE------AAMSRFNIQGACELAIEAIKCTNKYLTDSAPWAVKGEGAEERKSVIIKSTLEAVYVAMHFLQP 526
>gi|88808698|ref|ZP_01124208.1| methionine--tRNA ligase [Synechococcus sp. WH 7805] >gi|88787686|gb|EAR18843.1| methionine--tRNA ligase [Synechococcus sp. WH 7805] (525 aa)
Score = 746, Expect = 1.7e-76, Identities = 172/526 (32%), Positives = 270/526 (51%)
  Q:   560 KITSKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS---NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           ++ +  E M  + +TTP+YY +  PH+G  +TT+  D L R+++  G E  FITG+DEHGQKI+  A+  ++ P +  D+ + ++ +LW    I    F+RTT+  H+ +VQ  F        I  G  +G YCV CEE +  ++A  K  D    CA    PL  ++EE+ F  + QF++ I S + DP  + P +R  E+ N         D SISR N SWG+ +  +  H  YVW DALL YL+ L     DD    +  +  +      V ++ K+I RFH +YWP ML   GL  P +   HG++  E  KM K+LGNVLDP   +   G DA R+YLL+++   ED  F ++  ++  N DLAN +GNL NR+  M  K+ D  +P  S    S +   +   ++  D +   I     +     V+ L  E N ++ +  PW L K+  +E+ +   L  +L   + +   L+P++   S   L Q +   S+        +  L+    ++ PEP+  R+E E
  S:     4 RLGANAEAMT-YSLTTPLYYVNAKPHLGSVYTTIACDALARFQRLEGEEVVFITGVDEHGQKIQRTAEAQSISPADHCDRISALYADLWARWDITNDRFVRTTSPRHRPLVQAFFQRCEAAGHIRTGHQEGWYCVDCEE-FKDDLADAKNPD----CAIHRKPLEWRDEENLFFCLSQFQERIESLIADPQFIAPSSRRREIENFVAGG--LRDFSISRVNVSWGLPVPGHQGHTFYVWFDALLGYLTAL----LDDGGPVDLDRLTDVGWPVDVHVIGKDILRFHAVYWPAMLMSAGLPVPKRVFGHGFLTREGQKMGKALGNVLDPETLLERCGTDAVRWYLLRDIQFGEDGDFQQQRFMDLVNNDLANTIGNLLNRTASMSRKWFDASLPPVSAAVRS-DHPLKDTTERTIDRVRQSIPAFAFKDAAEAVLQLAIEANGYLNEQAPWSLMKQPGHEQKVGDDLYAVLECCRVIGLLLQPLVPGLSSRILAQLDQSPSEKGWTHALSWGQLEPGASLSKPEPVMQRLELE 522
>gi|120405753|ref|YP_955582.1| methionyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1] >gi|119958571|gb|ABM15576.1| methionyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1] (511 aa)
Score = 745, Expect = 2.1e-76, Identities = 155/476 (32%), Positives = 252/476 (52%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFD---DEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEAL 1046
           +YITT I YP+G+PH+GHA+  +  D + R+K+  G++  F+TG D HG K+ E A +L +   EL    + VF  L + L I +  FIRT+   H    +  +  ++    +YLG + G Y V  E  +T+          ++      P+   EEE+YF ++  +   + +   D P  + P  R NE+  SF++     DLSISR+ F WG+ + ++P HV+YVW+DAL NYL+G+G+   D   F ++W +     + ++ K+I RFH +YWP  L   G+  P K   HG+++    KMSKS+GNV+DP+  ++T+G D  RY+ L+E+   +D  +SE  +I   N DLAN  GNL  RS+ M+ K  DG++P+      +F  E  + L   D   + +    E   +   L  +  ++   N +    +PW L+K +  +     L   L  V+      +PV+ D + + L
  S:     5 YYITTAIAYPNGDPHVGHAYEYIATDAVARFKRLDGFDVRFLTGTDVHGLKMAETAAKLGVPTAELARSNSDVFQRLQEKLHISFDRFIRTSDPDHYEASKAIWRRMVDAGDVYLGKYSGWYSVRDERFFTEAETSVDAAGVRIATETGTPVTWTEEETYFFRLSAYADRLLALYADHPEFIEPEVRRNEVV-SFVSGG-LRDLSISRTTFDWGVPVPDHPDHVMYVWVDALTNYLTGVGFPDTDSELFTRYWPAD----LHMVGKDIIRFHTVYWPAFLMSAGIELPKKVFVHGFLLNRGEKMSKSVGNVVDPVNLVDTFGLDQVRYFFLREVPFGQDGSYSEDAIIGRINADLANEFGNLAQRSLSMVAKNLDGVVPQPG----AFTAEDSEMLAAADALLERVRRHFEATAMHLALEAIWSVLGAANRYFSAQEPWVLRKTDPAR-FATVLYTTLEVVRIAALLSQPVMPDAAAKLL 473
>gi|50955324|ref|YP_062612.1| methionyl-tRNA synthetase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951806|gb|AAT89507.1| methionyl-tRNA synthetase [Leifsonia xyli subsp. xyli str. CTCB07] (529 aa)
Score = 745, Expect = 2.3e-76, Identities = 170/468 (36%), Positives = 267/468 (57%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLL---GIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAV--RKENDDKLYCA-QLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKD-LDCFLSLILNAVKRVIYYLEPVL 1038
           FYITTPI+Y +  PHIGHA+T + ADVL R++++ G +T+ +TG DEHGQKI   A      P+E  D+  +  D    LL    I    FIRTT E H+  VQ+   +L    FIY G ++ LYCV CEE   ++  V    E  D+  CA    PL   +E++YF ++  F +K ++ + + P+ V P +  NE+  SF+      DLSISRS+F WGI++  +  HVVYVW DALLNY++ +GY Q D+  F++ W +       L+ K+I RFH + WP ML   GL  P +   HGW++    KMSKS    + P    +T+G DAFRYY L+ ++  +D  FS + L   +  +LAN  GNL +R + M+ +Y  G +P   + + + ++E ++ + Q   +    + +L I   ++ V  ++++ N +I + +PW L K+  +++ L   L   +  ++ +   L PV+
  S:     7 FYITTPIFYVNDVPHIGHAYTEVAADVLARWRRQAGDDTWLLTGTDEHGQKILRTATANGTTPKEWADRLVR--DEWLPLLTTVDIANDDFIRTTDERHEKNVQKFLQKLYDDGFIYAGEYEALYCVGCEEFKPQSEIVDGTGEYADQKVCAIHSKPLELLQEKNYFFRMSDFAEKLLALYEERPDFVQPESARNEVV-SFVRQG-LSDLSISRSSFDWGIKVPWDESHVVYVWFDALLNYITAVGYGQ-DEEAFERRWPA-----THLVGKDILRFHAVIWPAMLLAAGLEVPHRVFGHGWLLVGGEKMSKSKLTGIAPTQITDTFGSDAFRYYFLRAINFGQDGSFSWEDLSARYQAELANGFGNLASRVVAMVMRYFGGEVPAAGEFREA-DLEVQRVVAQAAADADAAMARLAIHDGIAAVWTIVDQLNGYITEQEPWALAKDEAKRERLQTVLYTAVEGLRALAVLLSPVI 471
>gi|194476532|ref|YP_002048711.1| methionine--tRNA ligase [Paulinella chromatophora] >gi|171191539|gb|ACB42501.1| methionine--tRNA ligase [Paulinella chromatophora] (524 aa)
Score = 744, Expect = 2.7e-76, Identities = 177/514 (34%), Positives = 275/514 (53%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKD----DSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIP-------------KYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWD-LKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFN----IDSSKFDIKFVTDFSSL------DNQKINTPEPIYLRIES 1084
           + +TTP+YY +  PH+G A+TTL  D L RY++ +G    FITG DEHGQKI+  A+  +LKPQE  ++ ++ + +LW    I    FIRTT   H+ +V+E F  + K   I  G  +G YCV+CEE   K+  V  E D++    Q   L  ++E + F  + +++K I   ++ P  + P++R  E+ N  L      + SISR N  WGI +  +  H  YVW DAL+ YL+ L     D    D   ++ W +     V ++ K+I RFH +YWP ML   GL  P     HG++  E  KM KSLGN+LDP   +  YGRD+ R+YLL+++   ED  F +K  I+  N DL+N +GNL NR++ M  ++    +P             K S+  +  NI              T ++KL  ++     +DL  + N F+ +  PW  +K+E   + +   L  +L   + +   L P++ + S    KQ      +D +K   K +T  SSL      +   +  P P+  R+E+
  S:     3 YTVTTPLYYVNDRPHLGSAYTTLACDALARYQRLIGKSVVFITGCDEHGQKIQRTAEAASLKPQESCNQVSEEYHHLWSRWQISNDRFIRTTDLRHQAIVKEFFLRVEKAGDILEGQQQGWYCVACEE--FKDEPVDAEGDNQCAIHQ-RRLEWRDEPNLFFNLSRYQKQIEELIQKPGFILPVSRRREIEN--LVAQGLHNFSISRINLPWGIPVPGHTDHTFYVWFDALIGYLTAL-LEPSDPPELDIILRRGWPAN----VHVIGKDILRFHAVYWPAMLMSAGLEVPDMVFGHGFLTREGKKMGKSLGNILDPELLLEEYGRDSVRWYLLRDIPFGEDGDFQKKRFIDLINNDLSNTIGNLLNRTLSMARRWFANAVPDCREAVTDQHSLAKASQSAILINI--------------TALDKLEFRRAAEATLDLAAQANTFLSEQAPWSRIKQEGGREQVGADLYAVLETTRIISLLLIPLIPELSIRLQKQLGLKLVLDGAKVSPKGITWESSLSWGQLEEGSHLPEPIPVMARLEN 520
>gi|39938719|ref|NP_950485.1| methionyl-tRNA synthetase [Onion yellows phytoplasma OY-M] >gi|39721828|dbj|BAD04318.1| methionyl-tRNA synthetase [Onion yellows phytoplasma OY-M] (520 aa)
Score = 743, Expect = 3.4e-76, Identities = 175/517 (33%), Positives = 293/517 (56%)
  Q:   570 KFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLK-DPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYR-QKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPK-YSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIESED 1086
           KF+++T I Y SG PHIG+ + +++AD + R+K+  G++  F TG DEHGQKI  KA +    PQE VD+ +     ++ L+ + Y  F +TT  +HK  VQ  F +L ++  IYLG ++GLY V+ EE+Y   +A +   D K +  +   LI   EE+YF K+ +++  +  +L+ +P+L+ P  +  EL N  L  +   DLS+SR++F WGI +  +PKHV+YVW+DAL NYL+GL Y     +S F ++W       + ++ K+I RFH IYWPI+L  L +  P ++++H WI+ ++ KMSKS GNVL     +  +  D+ RY++L E+   +D   + +LL+   N DLAN +GNL +R  GM+  YR   + K      L    +  KQ       +   ++   +   L  +++L    N +I+ V+PW+L K    ++ LD  L  ++  ++ +   L+P L   + + L Q  + +S    + +  F  L +QK++    ++ R+E ++
  S:    10 KFFLSTAIAYASGIPHIGNVYESILADAIARFKRLEGFDVLFQTGTDEHGQKIAAKALQQGKNPQEYVDQISLEIKRIYDLMQVSYDKFAKTTNPHHKQTVQAIFYKLWQQGDIYLGKYQGLYSVA-EESY---VAAKDLIDGKTFNGETPILIS--EETYFFKLSKYQAQLLQYLENNPSLIKPDAQRKELLN--LLKEPLADLSVSRTSFKWGIPVPFDPKHVIYVWIDALSNYLTGLDYNPTSKNSQFNRYWPCD----MHVIGKDILRFHLIYWPILLMALEISLPKQFLTHPWILFDKNKMSKSKGNVLYVDDLLKYFPVDSIRYFVLSEIPYAQDGNITYELLVERHNSDLANVLGNLVHRVFGMVKSYRQNNLSKTLITTNLDPKFDLSKQALATLPLVRLKMQDCKVGDSLKEIMNLARFANKYIDLVEPWNLFKNPEKQQLLDHTLYSLVETLRFLGVLLQPFLPQTAHKILTQ--LKASDITFESLDTFGLLSSQKLDNYHILFNRLEIDE 516
>gi|50954430|ref|YP_061718.1| methionyl-tRNA synthetase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950912|gb|AAT88613.1| methionyl-tRNA synthetase [Leifsonia xyli subsp. xyli str. CTCB07] (589 aa)
Score = 743, Expect = 3.5e-76, Identities = 167/473 (35%), Positives = 256/473 (54%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDN---LWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKN--IAVRKENDDKLYC-AQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSK 1043
           FYITTPI+Y +  PHIGHA+T + ADVL R+ ++ G + + + G DEHGQKI   A    L P E  D+   V D+   L + L I    FIRTT + HK VV    + L +K  +Y G ++G YCV CEE   ++  IA       ++ C      +    E++YF K+  F+  +   L D   + P    NE+  +F+ +    D+SI+RS+F WG+++   P HVVYVW DALLNY+SG+G+   D   F + W       V ++ K+I R H + WP ML    L  P + ++HGW++    KMSKS    + P   +  +G DAFRYY ++ +   +D  FS   +   +N DLAN +GNL +R+I MI KYR GI+P+ + P  + + E    + Q     +  I++  + + L +V  ++   N +I +  PW L + E     LD  L+ +   ++ +   L P L D ++
  S:    12 FYITTPIFYVNDVPHIGHAYTEVAADVLVRWHRQAGEDVWLLAGTDEHGQKILRTAAAQRLSPAEWTDRL--VHDSWRPLLEALRISADDFIRTTEDRHKVVVIAFLTLLREKGLVYEGTYEGFYCVGCEEYKQESDIIAGTGAFAGQVLCPVHARSVDVVNEKNYFFKMSAFQDRLLEMLADEEFLRPAAVRNEIL-AFVGSG-LKDISITRSSFDWGVEVPWEPGHVVYVWFDALLNYISGIGW-GSDVEEFDRRWPD-----VHIIGKDIARLHAVLWPAMLMAADLPVPKRIVAHGWLLVNGEKMSKSNATGIGPEQIVKAFGIDAFRYYFVRSIVFGQDGSFSWDDIHRRYNADLANGLGNLVSRTIAMITKYRAGIVPEAAAPTAAED-EVRHTITQARANASAAIDRFALSEALGQVWTIVERLNSYITEQTPWSLARDEAQAHRLDTVLNTVAEGLRELAVLLRPFLPDTAQ 480
>gi|159903438|ref|YP_001550782.1| methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9211] >gi|159888614|gb|ABX08828.1| Methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9211] (509 aa)
Score = 743, Expect = 3.7e-76, Identities = 165/444 (37%), Positives = 238/444 (53%)
  Q:   573 ITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLH--PLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITT----IIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDL 1016
           ITTP+YY +  PH+G  +TT+  D  +R+++  G    F+TG+DEHGQKI+  A+   + PQ   DK +  +  LWK   I Y+ FIRTT+  H+ +V + F +++K   I LG  +G YCV CEE Y  +       D K  C  +H  PL  ++EE+ F  + +++  I S +  P+ + P++R NE+ N    +    D SISR N  WGI +     H  YVW DALL YLS L    ++  N     +      V ++ K+I RFH IYWP ML   GL  P K   HG++  E  KM KSLGN+LDP   +  YG+D  R+YLL ++   +D  F +K   +  N DLAN +GNL NR+  M  K+ D        P    N+E +  LK    E  T      E+ + + +   VI L  E N ++   +PW L KE + K+L
  S:     5 ITTPLYYVNDKPHLGSTYTTIACDAYSRFQRLQGNTVEFVTGVDEHGQKIQRTAQSHQITPQVHCDKISLNYKELWKKWDITYTSFIRTTSPSHQELVNQFFDKVVKSGDILLGNQQGWYCVGCEE-YKDD-----PPDSKSPCCPIHLKPLEWRDEENLFFALSKYQSKIESLVAQPSFIQPLSRRNEILN--FVSKGLRDFSISRKNVEWGIPVPGYKGHTFYVWFDALLGYLSSL-LPMQNKINLADLSHYGWPASVHVIGKDILRFHAIYWPAMLMSAGLELPKKVFGHGFLTREGQKMGKSLGNILDPELLLEQYGKDPIRWYLLSDIRFGQDGDFQQKRFQDLVNNDLANTIGNLLNRTSTMSRKWFDN-----GTPDFDINLE-DSNLKLLAQESITSSLLAYEEFDFKTVCETVIKLATESNVYLNNTQPWTLIKEPSNKEL 439
>gi|145346883|ref|XP_001417911.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578139|gb|ABO96204.1| predicted protein [Ostreococcus lucimarinus CCE9901] (591 aa)
Score = 743, Expect = 3.7e-76, Identities = 163/467 (34%), Positives = 275/467 (58%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS----NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPI---YFINTYGRDAFRYYLLKELSL-KEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGII--PKYSKPKLSF-NIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           ++TTPIYY +  PHIGH +T+ +AD   RY++  G + FF+TG DEHG K+E+ A++  ++PQ L D+ ++ F ++     I +  FIRTT +YH+  V+     L +KD +YLG ++G Y    EE YT++ A  KE D K   +    +++  EE+Y+ ++ +F+K + +   D P+ + P  R NE+      N+  +D+ ISR+NF WGI + ++ KHV+YVW+DAL+NY++ +G     DS    +  K+W +     + +M+KEI+ FH + WP +L  L L  P +  +H + I E  KMSKSLGN +D      F   YG DA RYYL  E  +  +D+ FS + +   ++ DL N +GN  +R+  MINKY DG +   + +  +++F N ++  +      +  T  +KL++ +  +   +++ + + FI + +P+ + K E+   +L   L   L A++     LEP++
  S:    67 FVTTPIYYVNDQPHIGHVYTSTVADAYARYRRARGEDVFFLTGTDEHGLKVEQSAEKRGIEPQALADENSQKFRDVMTAYDISFDEFIRTTDDYHERQVRALVKVLQEKDAVYLGRFEGWYDEGQEEYYTESKA--KELDYKSPISG-KDMVRSSEENYYFRLSKFQKELEALHADNPDFLTPSARRNEMIGRL--NEGLNDVPISRTNFKWGIPMPDDEKHVIYVWIDALMNYITAIGLGDGKDSIVYADRSKYWPAS----MHIMAKEISWFHSVIWPALLMALDLPLPQRVHAHAFWIREGRKMSKSLGNFVDLACMDRFKEHYGLDAMRYYLAVEGPIGAQDANFSAERVQEIYSSDLVNTMGNSVSRTTAMINKYFDGEVRSEEANGARVTFDNWDWPARTSAHVQDALTAYDKLDLPRAAAAAKNIVMDVDLFITETEPFRMAKDESKSAELAACLYQCLEALRIAAVLLEPLM 537
>gi|71893760|ref|YP_279206.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae J] >gi|71851887|gb|AAZ44495.1| methionyl-tRNA synthetase [Mycoplasma hyopneumoniae J] (513 aa)
Score = 742, Expect = 4.4e-76, Identities = 192/509 (37%), Positives = 296/509 (58%)
  Q:   567 VMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKE-----EESYFLKIKQFKKYISSF-LKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN-PKHVVYVWLDALLNYLSGLGYRQKDDSNFQK--FWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLS-------FNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKF-DIKFVTDFSSLDNQKINTP 1075
           + KK YITTPIYY SG  HIGH +TT++A V+  +KK  G+E    TG DEHGQKI + A + NL+PQE VDK  + F  LW+   I+Y +F RTT   HKN +++ F ++ + + I+ G ++GLY +S EE  +++ AV +        +  HP+   +     E+SYF  IK+F+K++  F L++P  ++     NEL  +FL     +DLS++R N  WGI + +      +YVWLDAL +YLS +   Q D  N +K  FW +  A+I+Q++ KEI RFHCIYWPI L+ L    P+  ++HGW+IT +GKMSKS GNV++P+  +  +  +  ++Y + +++ K DSVF E LL N +N    N  GNL +R+I +I K       K+ +P L         +I F +++    DE     ++L I+K    VI+L    N F +  + W+ K   N K L   L L+LN +  +  +L   +   + E L+   I+   F  I  +  F  ++ +K+  P
  S:     1 MTKKCYITTPIYYASGRLHIGHLYTTVLAWVIRNFKKMSGFEARLFTGSDEHGQKISQLAAKANLEPQEFVDKNVENFKFLWEKFEIDYDYFQRTTNLNHKNFIKKIFLKMYEDNHIFNGEYQGLYSISDEEFLSQSQAVYQNG------SYFHPVSGAKMELISEKSYFFPIKKFQKWLEDFLLENPKFIFDSKIANELRQNFLQK-GLEDLSVTRKNLKWGIFLDQKFENQTIYVWLDALFSYLS-VFKDQIDLENPKKSNFW-TDSAQIIQVVGKEIARFHCIYWPIFLKSLNFPLPSIILTHGWLITPEGKMSKSKGNVINPLDLLKKFDPEIIKFYFVSQINTKNDSVFDENLLENFYNSFFVNTFGNLISRTIALIVK-------KFDQPLLFEIADLDWTDISFYEKILLSLDEFCDNFDQLEIEKAFKTVIELTKNLNGFFDIKQLWNQK---NLKKLAQGLILVLNGIYAITVFLSIAMPKKTNEILEFLGINEKNFLLITKLDKFDKINFKKLEKP 507
>gi|148239464|ref|YP_001224851.1| methionyl-tRNA synthetase [Synechococcus sp. WH 7803] >gi|147848003|emb|CAK23554.1| Methionyl-tRNA synthetase [Synechococcus sp. WH 7803] (514 aa)
Score = 742, Expect = 5.2e-76, Identities = 170/515 (33%), Positives = 264/515 (51%)
  Q:   571 FYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDS---NFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLD-NQKINTPEPIYLRIESE 1085
           + +TTP+YY +  PH+G  +TTL  D L R+++  G +  FITG+DEHGQKI+  A+  N+ P +  D+ + ++ +LW    I    F+RTT+  H  +VQ  F        I  G  +G YCV CEE +  + A  K  D  ++     PL  ++EE+ F  + QF++ I + + DP  + P +R  E+ N         D SISR N SWG+ +  +P H  YVW DALL YL+ L     DD    +  +  +      V ++ K+I RFH +YWP ML   GL  P +   HG++  E  KM K+LGNVLDP   +   G DA R+YLL+++   ED  F ++  ++  N DLAN +GNL NR+  M  K+ +  +P  S P +      ++  +Q  + +   I  L  Q     V+ L  E N ++ +  PW L K+  +E+ +   L  +L   + +   L+P++   S   L Q +   S         +  L+    +  PEP+  R+E E
  S:     3 YSLTTPLYYVNAKPHLGSVYTTLACDALARFQRLEGQDVVFITGVDEHGQKIQRTAETQNISPIDHCDRISALYSDLWTRWHISNDRFVRTTSPRHLPLVQAFFQRCEAAGHIRTGHQEGWYCVDCEE-FKDDPADAKAPDCPIH---RKPLEWRDEENLFFCLSQFQERIETLIADPQFIAPASRRREIENFVAGG--LRDFSISRVNVSWGLPVPGHPGHTFYVWFDALLGYLTAL----LDDGGAVDLDRLADIGWPADVHVIGKDILRFHAVYWPAMLMSAGLPVPKRVFGHGFLTREGQKMGKALGNVLDPEILLERCGTDAVRWYLLRDIQFGEDGDFQQQRFMDLVNNDLANTIGNLLNRTASMSRKWFEASLPPVS-PDVRSEHPLKQPTEQTIERVRQSIPALAFQDAAEAVLQLAIEANGYLNEQAPWSLMKQPGHEEKVGDDLYAVLECCRVIGLLLQPLVPGLSSRILAQLDQRPSDDGWTQALRWGQLEPGVGLPKPEPVMQRLELE 511
>gi|57242363|ref|ZP_00370302.1| methionyl-tRNA synthetase [Campylobacter upsaliensis RM3195] >gi|57017043|gb|EAL53825.1| methionyl-tRNA synthetase [Campylobacter upsaliensis RM3195] (626 aa)
Score = 741, Expect = 5.7e-76, Identities = 189/512 (36%), Positives = 282/512 (55%)
  Q:   572 YITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKEN---PKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITT---IIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKENNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSSKFDIKFVTDFSSLDNQKINTPEPIYLRIE 1083
           YITTPIYY +  PH+GHA+TT+IAD L R+ +  G++T F+TG DEHGQKIE+ AK  N  P+E  DK +  F  LW    I Y  + RTT E H   V++ F ++ +K  IY G ++G YCVSCE  +T++  + +       C +   L++  EESYF ++ +++K I  + +   +V P  +  EL N F+ N    DLSI+R++F WGI+I  N    KHV+YVWLDAL  Y+S L   +K ++    F  +     V L+ K+I RFH IY+P  L    L  P    +HGW   +  KMSKS GN + P    + YG + FRY+LL+E+    D  FSE +LIN  N +L+N  GNL +R IGM  KY +G I       L+F   ++ +LK+ +  +      IE     + L  +   ++  N  I + +PW+L K N     +  +SL  N + +V   L P L   +++  K  + D +  + + +     L N K N  E ++ +IE
  S:     3 YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLSGHKTLFLTGTDEHGQKIEQAAKNKNYSPKEYADKISLEFKKLWDEFEISYDIYARTTDERHIKFVKQVFLKMWEKGDIYKGEYEGYYCVSCESFFTQSQLISQCGCPD--CGKETKLLK--EESYFFRLSKYEKNILKWYESEPIV-PKNKKAELVN-FIEN-GLKDLSITRTSFEWGIKIPSNLNDDKHVIYVWLDALFIYISSLELDEKSEN--LGFLPA----FVHLVGKDILRFHAIYFPAFLMSADLPLPKYIAAHGWWTRDGKKMSKSKGNAIHPKIIADAYGLEVFRYFLLREVPFGNDGDFSETMLINRINAELSNEFGNLLSRIIGMSLKYSNGEI--LQNEVLNF---YKAELKEANLHLQNALEFIENFQFNRYLEELFKALSVANLSISKYEPWNLIKANETSKANALVSLCANILAKVSLLLHPALPKSTQKVAKALSFDITLQNYQKLILNDELLNFKANACETLFPKIE 502
>gi|148273554|ref|YP_001223115.1| methionyl-tRNA synthetase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831484|emb|CAN02445.1| metS [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (525 aa)
Score = 741, Expect = 6.6e-76, Identities = 174/476 (36%), Positives = 263/476 (55%)
  Q:   563 SKGEVMKKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKY-AKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEN--DDKLYCA-QLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKHVVYVWLDALLNYLSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTI-----------IEKLNIQKILSRVIDLINECNFFIEQVKPWDL-KKENNEKDLDCFLSLILNAVKRVIYYLEPVL 1038
           S+GE    FYITTPI+Y +  PHIGHA+T + ADVL R+ ++ G +T+F+TG DEHGQKI   A   +  PQ   D+   + +  L + + I    FIRTT   H+  V+     L    FIY G +KG YCV CEE    +  +      + +L CA    P+   EE++YF ++  F + + +F ++ P+ + P +  NE+  SF+     +DLSISRS+F WGI I  +  HVVYVW +AL+NY++ +GY   DD  F++ W +       L+ K+I RFH + WP ML  LG   P +   HGW++    KMSKS    + P    +T+G DAFRY+ ++ ++  +D  FS + L   +  +LAN  GNL +R I M+ +Y DG IP                L + D+ +  +           I++L I + L+ V  L++E N +I   +PW L KK+ +   L+  L   +  +  +   L PVL
  S:     2 SRGE---PFYITTPIFYVNDVPHIGHAYTEVAADVLARWHRQRGDDTWFLTGTDEHGQKILRTATAHDTTPQAWADRLVTESWQPLLEAVDISNDDFIRTTDARHEESVKIFLQRLHDAGFIYTGEYKGYYCVGCEEYKQPSDLLEGTGPFEGQLVCAIHSKPVELLEEKNYFFRMSDFGERLLAFYEERPDFIQPESARNEIL-SFVRRG-LEDLSISRSSFDWGIPIPWDESHVVYVWFEALMNYVTAIGY-GVDDERFRRRWPA-----THLVGKDILRFHAVIWPAMLMALGEEPPRRVFGHGWLLVGGEKMSKSKLTGIVPQTITDTFGIDAFRYHFMRSIAFGQDGSFSWEDLSARYQAELANGFGNLSSRVIAMVGRYFDGRIPA------------ADGLTEADERVLAVARSAAATADQAIDRLAIHEALAAVWTLVDELNGYITSQEPWALAKKDEDRARLETVLHTAVRGLGTLAVLLAPVL 471
>gi|186454707|ref|ZP_02965022.1| methionyl-tRNA synthetase [bacterium Ellin514] >gi|184208266|gb|EDU05310.1| methionyl-tRNA synthetase [bacterium Ellin514] (517 aa)
Score = 740, Expect = 7.8e-76, Identities = 162/486 (33%), Positives = 271/486 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKYAKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKENDDKLYCAQLHPLIQKEEESYFLKIKQFKKYISSFLKD-PNLVYPITRINELFNSFLNNDDFDDLSISR--SNFSWGIQIKENPKHVVYVWLDALLNY------------LSGLGYRQKDDSNFQKFWNSQDAEIVQLMSKEITRFHCIYWPIMLEMLGLRKPTKYISHGWIITEQGKMSKSLGNVLDPIYFINTYGRDAFRYYLLKELSLKEDSVFSEKLLINTFNKDLANNVGNLFNRSIGMINKYRDGIIPKYSKPKLSFNIEFEKQLKQFDDEITTIIEKLNIQKILSRVIDLINECNFFIEQVKPWDLKKE-NNEKDLDCFLSLILNAVKRVIYYLEPVLIDGSKEALKQFNIDSS 1054
           K FYITT IYY +G  H+GHA+  +IADV+ R ++ LG E FF+TG+DEHGQK+++ A+   L PQ+  D+ + ++  + + L +    F+RTT   HK VVQ   S+L  +   Y   +KG Y    E   T+    +    D  + A    + + +EE+Y+ K+K  ++++  +++  P+ + P  R NE+   FL N+  +DL I+R  +  +WGI +  +   V YVW DAL+NY            LS LG   +        W +       ++ K+I +FH +YWPIML+ +GL  P + + HGW   +  K+SK+ GNV+DP+  +N +G DAFR+Y+++EL++  D  +++      +  +LAN +GNL NRS+ M+ +YR+GI+P+ S        E   +  +   E    +E+  +Q  L  + +L+N  N +++Q  P+ L K+    K LD  L  +  + + +   L P +   S+    Q  + S+
  S:     3 KCFYITTAIYYVNGEAHLGHAYEMVIADVIARSRRSLGTEVFFLTGLDEHGQKVQQAAQFKGLSPQQYCDELSLIWRTMAQKLELTIDDFVRTTEPRHKEVVQAILSKLNNEGHFYKAAYKGYYSTREETFLTE----KDRLPDGNFPASYGEVTELQEENYYFKLKDHQQWLIDYIESTPSFIQPEYRRNEVL-GFLKNNTLEDLCITRPINRLNWGIPVPFDTNFVTYVWFDALVNYISIPAAHGDPVVLSALGRTGQG----LPLWPAD----THVIGKDILKFHSVYWPIMLKAMGLPLPRQLLVHGWWQKDGQKLSKTTGNVVDPLAVVNEWGIDAFRFYVVRELAIGPDGNWTDGGFQARYQAELANGLGNLVNRSLSMLKRYRNGIVPERSD-------ELAPEAGKVIAETRAHLEQNGLQAALLSIWELVNRANQYVDQTAPFRLAKDPAQSKRLDEVLYNLAESCRILAILLAPFIPGTSERIYNQLGLSSA 484
>gi|21222203|ref|NP_627982.1| methionyl-tRNA synthetase [Streptomyces coelicolor A3(2)] >gi|25009395|sp|Q9F2I9|SYM_STRCO Methionyl-tRNA synthetase (Methionine--tRNA ligase) (MetRS) >gi|10432496|emb|CAC10330.1| putative methionyl tRNA synthetase [Streptomyces coelicolor A3(2)] (538 aa)
Score = 739, Expect = 1.2e-75, Identities = 168/476 (35%), Positives = 262/476 (55%)
  Q:   569 KKFYITTPIYYPSGNPHIGHAFTTLIADVLTRYKKKLGYETFFITGMDEHGQKIEEKAKELNLKPQELVDKY-AKVFDNLWKLLGIEYSHFIRTTAEYHKNVVQETFSELLKKDFIYLGVWKGLYCVSCEENYTKNIAVRKEND---DKLYCAQLHPLIQKEEESYFLKIKQF-KKYISSFLKDPNLVYPITRINELFNSFLNNDDFDDLSISRSNFSWGIQIKENPKH