>gi|26553547|ref|NP_757481.1| S-adenosylmethionine synthetase [Mycoplasma penetrans HF-2] >gi|26453553|dbj|BAC43885.1| S-adenosylmethionine synthetase [Mycoplasma penetrans HF-2] (378 aa)
Score = 1963, Expect = 0.0e+00, Identities = 378/378 (100%), Positives = 378/378 (100%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKYN 378
           MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKYN
  S:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKYN 378
>gi|188569179|ref|ZP_02829616.2| S-adenosylmethionine synthetase [Ureaplasma urealyticum serovar 2] (376 aa)
Score = 1110, Expect = 3.0e-119, Identities = 223/375 (59%), Positives = 294/375 (78%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGYDE+DFTIISNVN QS +I  +V+K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   + +   I+ DMKSQV+IDY++S  P I+ +++S+QH ++   E      +AI++ + KKYNLN++FK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKNIVAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   + +I+E I  +F+F IK+FI   N+ +  Y P +TYGHFGR +L+  WE+L+KVE++++ +K
  S:     1 MQYKKIITSESVGAGHPDKICDQISDAILDECLSQDQNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYDENDFTIISNVNKQSVDIAQSVDKTNKDLIGAGDQGIVFGYACDETPQYMPLTSVLAHELLKEIERQRRSKEFIKIQADMKSQVSIDYSNS-TPLIETMLVSIQHDEDYDVEYFNKKVSAIMEQIAKKYNLNTNFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGVGHHGGGAFSGKDPTKVDRSASYFARWIAKNIVAAKLAKQCEIQLAFAIGQPQPVAMYVNTFNTNLIDETKIFEAIKKSFNFDIKTFINDLNLWTTKYLPVATYGHFGRDDLDLSWEKLNKVEDLIKNSK 376
>gi|188524385|ref|ZP_02558133.2| methionine adenosyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660171|gb|EDX53551.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (376 aa)
Score = 1109, Expect = 4.0e-119, Identities = 222/375 (59%), Positives = 294/375 (78%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGYDE+DFTIISNVN QS +I  +V+K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   + +   I+ DMKSQV+IDY++S  P I+ +++S+QH ++   E      +AI++ + KKYNLN++FK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   + +I+E I  +F+F IK+FI   N+ +  Y P +TYGHFGR +L+  WE+L+KVE++++ +K
  S:     1 MQYKKIITSESVGAGHPDKICDQISDAILDECLSQDQNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYDENDFTIISNVNKQSVDIAQSVDKTNKNLIGAGDQGIVFGYACDETPQYMPLTSVLAHELLKEIERQRRSKEFIKIQADMKSQVSIDYSNS-TPLIETMLVSIQHDEDYDVEYFNKKVSAIMEQIAKKYNLNTNFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGVGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGQPQPVAMYVNTFNTNLIYETKIFEAIKKSFNFDIKTFINDLNLWTTKYLPVATYGHFGRDDLDLSWEKLNKVEDLIKNSK 376
>gi|171920915|ref|ZP_02932066.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178889|ref|ZP_02555099.2| methionine adenosyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024116|ref|ZP_02569537.2| methionine adenosyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039561|ref|ZP_02528675.2| S-adenosylmethionine synthetase [Ureaplasma urealyticum serovar 8] >gi|188518255|ref|ZP_02555956.2| methionine adenosyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188530944|ref|ZP_02546830.2| S-adenosylmethionine synthetase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188592819|ref|ZP_02694953.2| S-adenosylmethionine synthetase [Ureaplasma urealyticum serovar 10] >gi|195867784|ref|ZP_03079784.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903137|gb|EDT49426.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209146|gb|EDU06189.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019173|gb|EDU57213.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998185|gb|EDU67282.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660481|gb|EDX53738.1| methionine adenosyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (376 aa)
Score = 1109, Expect = 4.0e-119, Identities = 222/375 (59%), Positives = 294/375 (78%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGYDE+DFTIISNVN QS +I  +V+K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   + +   I+ DMKSQV+IDY++S  P I+ +++S+QH ++   E      +AI++ + KKYNLN++FK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   + +I+E I  +F+F IK+FI   N+ +  Y P +TYGHFGR +L+  WE+L+KVE++++ +K
  S:     1 MQYKKIITSESVGAGHPDKICDQISDAILDECLSQDQNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYDENDFTIISNVNKQSVDIAQSVDKTNKNLIGAGDQGIVFGYACDETPQYMPLTSVLAHELLKEIERQRRSKEFIKIQADMKSQVSIDYSNS-TPLIETMLVSIQHDEDYDVEYFNKKVSAIMEQIAKKYNLNTNFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGVGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGQPQPVAMYVNTFNTNLIDETKIFEAIKKSFNFDIKTFINDLNLWTTKYLPVATYGHFGRDDLDLSWEKLNKVEDLIKNSK 376
>gi|15829173|ref|NP_326533.1| S-adenosylmethionine synthetase [Mycoplasma pulmonis UAB CTIP] >gi|22095900|sp|Q98PM0|METK_MYCPU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|14090117|emb|CAC13875.1| S-ADENOSYLMETHIONINE SYNTHETASE (METHIONINE ADENOSYLTRANSFERASE) (ADOMET SYNTHETASE) [Mycoplasma pulmonis] (376 aa)
Score = 1106, Expect = 7.4e-119, Identities = 228/372 (61%), Positives = 293/372 (78%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           + + TSESVG+GHPDKICDQISD++LD  LK DPNS+ A EV A+NRLI+IGGEITT GYVD+V  +W +LI LGY E+DFTIISNVN QS EI N V++ D+ IGAGDQG+++G+A+DE ++FMPL I+IAHDLVK AE++    KI+ +K DMKSQVTIDY+D +NPKID I+MS+QH ++   ++  +     II+ VV  YNLNS++K  IN +G F+IGGPIGDTGLTGRK++VDTYG  A HGGGAFSGKD TKVDRS AY ARYIAKN+VAAK+AKK E+QLS+ IG  +PI+  V++FGTSK+SD +I + I N F  S KS IEK N+++  Y P S +GHFGR +L+  WE+LD+V++I +F K
  S:     3 KNLFTSESVGRGHPDKICDQISDSILDAVLKIDPNSRCAIEVMASNRLIIIGGEITTQGYVDLVSKSWEILISLGYTENDFTIISNVNEQSKEIANQVDRQDDNIGAGDQGIMFGFASDETKSFMPLAISIAHDLVKRAEKLRVENKINGLKSDMKSQVTIDYSDQKNPKIDTILMSLQHDKDVLLDNFRNDVKKLIIEPVVNDYNLNSNYKCFINPNGSFSIGGPIGDTGLTGRKIIVDTYGGAAHHGGGAFSGKDYTKVDRSAAYMARYIAKNLVAAKVAKKLEIQLSYGIGMIEPISINVNSFGTSKFSDLEITDFIRNNFSLSPKSIIEKLNLKNTKYFPTSFFGHFGRDDLDLPWEKLDQVDKIKKFFK 376
>gi|47459144|ref|YP_016006.1| S-adenosylmethionine synthetase [Mycoplasma mobile 163K] >gi|47458473|gb|AAT27795.1| s-adenosylmethionine synthetase [Mycoplasma mobile 163K] (386 aa)
Score = 1100, Expect = 3.6e-118, Identities = 216/372 (58%), Positives = 282/372 (75%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFC-NAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           I TSESVGKGHPDKICDQISD +LD  LK+D N++VACEV A+N+LIVIGGEI T  Y+DVVK AWN+L+ LGYDE+DFTIISN+N QS++I   V+K N  I AGDQG+V+GYAT+E E F+PL   IAH+++K AE+   N      K DMKSQVT+DY+D +NPK+  II+++QH +N  K+  E F  + II  V  KY LN +F+ +IN +G FTIGGPIGDTGLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAYFAR++AKN+VAA++A K E+Q +FAIG   PIA  ++     KY  E I +++ N F+F++   IEK +++ PIY   +++GHFGR +L+  WE+LD V++I +F KKY
  S:     5 IFTSESVGKGHPDKICDQISDRILDSILKKDCNARVACEVMASNKLIVIGGEIKTNSYIDVVKEAWNILLKLGYDENDFTIISNINKQSSDISFGVDKSNGSIAAGDQGIVFGYATNETEQFLPLNFVIAHEILKIAEKKRLNKTFQNAKSDMKSQVTMDYSDPKNPKLVTIIVAIQHEKNIDKDEFEKFIKDEIIYVVTDKYKLNRNFEILINTAGDFTIGGPIGDTGLTGRKIIVDTYGGWARHGGGAFSGKDYTKVDRSGAYFARWVAKNLVAAEVADKVEIQFAFAIGKEMPIAININV-TNEKYKIELIEKVVKNLFNFNVGEIIEKLDLKKPIYEQVASFGHFGRNDLDLSWEKLDYVDKIKQFLKKY 377
>gi|171920296|ref|ZP_02931647.1| methionine adenosyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902709|gb|EDT48998.1| methionine adenosyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] (384 aa)
Score = 1097, Expect = 8.0e-118, Identities = 219/375 (58%), Positives = 290/375 (77%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGY+E+DFTIISNVN QS +I  +V K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   N +   I+ DMKSQV+IDY++   P I+ +++S+QH ++   E      + I+D +  KY LN+DFK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   +++I+E I  +F+F IK+FI    + +  Y P +TYGHFGR +LN  WE+L+KV+++++++K
  S:     9 MKYKKIITSESVGAGHPDKICDQISDAILDECLAQDKNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYNENDFTIISNVNKQSVDIAQSVNKANKDLIGAGDQGIVFGYACDETPQYMPLTTVLAHELLKEIEKQRRNKEFVKIQADMKSQVSIDYSNCM-PVIETMLVSIQHDEDYNIEYFNKKVSKIMDQIAIKYGLNTDFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGIGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGEPQPVAMFVNTFKTNLVDEKKIFEAINKSFNFDIKTFINDLELWTTKYLPVATYGHFGRDDLNLSWEKLNKVQDLIKYSK 384
>gi|170762349|ref|YP_001752496.1| methionine adenosyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|168827926|gb|ACA33188.1| methionine adenosyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] (384 aa)
Score = 1097, Expect = 1.0e-117, Identities = 219/375 (58%), Positives = 290/375 (77%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGY+E+DFTIISNVN QS +I  +V K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   N +   I+ DMKSQV+IDY++   P I+ +++S+QH ++   E      + I+D +  KY LN+DFK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   +++I+E I  +F+F IK+FI    + +  Y P +TYGHFGR +LN  WE+L+KV+++++++K
  S:     9 MKYKKIITSESVGAGHPDKICDQISDAILDECLAQDKNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYNENDFTIISNVNKQSVDIAQSVNKANKDLIGAGDQGIVFGYACDETPQYMPLTTVLAHELLKEIEKQRRNKEFVKIQADMKSQVSIDYSNC-TPVIETMLVSIQHDEDYNIEYFNKKVSTIMDQIAIKYGLNTDFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGIGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGEPQPVAMFVNTFKTNLVDEKKIFEAINKSFNFDIKTFINDLELWTTKYLPVATYGHFGRDDLNLSWEKLNKVQDLIKYSK 384
>gi|13357974|ref|NP_078248.1| S-adenosylmethionine synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|183508431|ref|ZP_02689233.2| methionine adenosyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11258510|pir||A82895 S-adenosylmethionine synthetase UU412 [imported] - Ureaplasma urealyticum >gi|6899400|gb|AAF30823.1|AE002138_10 S-adenosylmethionine synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|182675839|gb|EDT87744.1| methionine adenosyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] (376 aa)
Score = 1096, Expect = 1.0e-117, Identities = 219/375 (58%), Positives = 290/375 (77%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGY+E+DFTIISNVN QS +I  +V K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   N +   I+ DMKSQV+IDY++   P I+ +++S+QH ++   E      + I+D +  KY LN+DFK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   +++I+E I  +F+F IK+FI    + +  Y P +TYGHFGR +LN  WE+L+KV+++++++K
  S:     1 MKYKKIITSESVGAGHPDKICDQISDAILDECLAQDKNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYNENDFTIISNVNKQSVDIAQSVNKANKDLIGAGDQGIVFGYACDETPQYMPLTTVLAHELLKEIEKQRRNKEFVKIQADMKSQVSIDYSNC-TPVIETMLVSIQHDEDYNIEYFNKKVSTIMDQIAIKYGLNTDFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGIGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGEPQPVAMFVNTFKTNLVDEKKIFEAINKSFNFDIKTFINDLELWTTKYLPVATYGHFGRDDLNLSWEKLNKVQDLIKYSK 376
>gi|186701848|ref|ZP_02553877.2| methionine adenosyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701142|gb|EDU19424.1| methionine adenosyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] (376 aa)
Score = 1092, Expect = 3.4e-117, Identities = 218/375 (58%), Positives = 290/375 (77%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M+ +KI+TSESVG GHPDKICDQISDA+LDECL QD NS+VACEV A NRLIVI GEITT  YVDVVK AW ++ PLGY+E+DFTIISNVN QS +I  +V K N+  IGAGDQG+V+GYA DE   +MPL   +AH+L+K  E+   N +   I+ DMKSQV+IDY++   P I+ +++S+QH ++   +      + I+D +  KY LN+DFK+IIN+SG+F IGGPIGDTGLTGRK++VDTYG +  HGGGAFSGKD TKVDRS +YFAR+IAKN+VAAKLAK+CE+QL+FAIG  +P+A  V+TF T+   +++I+E I  +F+F IK+FI    + +  Y P +TYGHFGR +LN  WE+L+KV+++++++K
  S:     1 MKYKKIITSESVGAGHPDKICDQISDAILDECLAQDKNSRVACEVLACNRLIVIAGEITTHAYVDVVKTAWEIIKPLGYNENDFTIISNVNKQSVDIAQSVNKANKDLIGAGDQGIVFGYACDETPQYMPLTTVLAHELLKEIEKQRRNKEFVKIQADMKSQVSIDYSNC-TPVIETMLVSIQHDEDYNIKYFNKKVSTIMDQIAIKYGLNTDFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGIGHHGGGAFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGEPQPVAMFVNTFKTNLVDEKKIFEAINKSFNFDIKTFINDLELWTTKYLPVATYGHFGRDDLNLSWEKLNKVQDLIKYSK 376
>gi|54020517|ref|YP_115960.1| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 232] >gi|53987690|gb|AAV27891.1| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 232] (378 aa)
Score = 1084, Expect = 2.9e-116, Identities = 214/371 (57%), Positives = 272/371 (73%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           KI  +ESVGKGHPDKICDQISDA+LDE LKQD +++VA E  A+NRLI+IGGEI+T+GYVD+VK+AW +L  +GY+E+DFTIISNVN QS EI + V++ N  IGAGDQG+VYG+AT+EC NFMPL  N+A+ LVK AE++    +  F   DMKSQV I Y  +  PK+  ++MS+QH QN    + +E   N I+    KKYNLN DF++ +N SG FTIGGPIGDTGLTGRKL++DTYG  AKHGGGAFSGKD TKVDRSGAY AR+IAKN+VAA +A + E+Q ++AIG   P    V     +K    +I EII N F+  + S I + N+R PIY   + YGHFGR EL+  WE+LD VE+I ++ K
  S:     5 KISVAESVGKGHPDKICDQISDAILDEILKQDEHARVAVETMASNRLIIIGGEISTSGYVDLVKIAWEILFEIGYNENDFTIISNVNRQSGEIASLVDQKNGTIGAGDQGIVYGFATNECPNFMPLAQNLANFLVKKAEELRKMGEFQFACADMKSQVEIHYDQNSKPKVKSMLMSIQHQQNFNYHNFVEFVINKIMIPAAKKYNLNIDFEKKVNKSGDFTIGGPIGDTGLTGRKLIIDTYGDAAKHGGGAFSGKDYTKVDRSGAYIARWIAKNLVAAGVAAEIELQFAYAIGNEYPELINVTYLKNAKIPTVKIIEIIKNVFNLRLVSLISRLNLRKPIYRNLAVYGHFGRDELDLPWEKLDMVEKIKDYLK 377
>gi|144227639|gb|AAZ44534.2| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae J] (378 aa)
Score = 1082, Expect = 4.7e-116, Identities = 214/371 (57%), Positives = 272/371 (73%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           KI  +ESVGKGHPDKICDQISDA+LDE LKQD +++VA E  A+NRLI+IGGEI+T+GYVD+VK+AW +L  +GY+E+DFTIISNVN QS EI + V++ N  IGAGDQG+VYG+AT+EC NFMPL  N+A+ LVK AE++    +  F   DMKSQV I Y  +  PK+  ++MS+QH QN    + +E   N I+    KKYNLN DF++ +N SG FTIGGPIGDTGLTGRKL++DTYG  AKHGGGAFSGKD TKVDRSGAY AR+IAKN+VAA +A + E+Q ++AIG   P    V     +K    +I EII N F+  + S I + N+R PIY   + YGHFGR EL+  WE+LD VE+I ++ K
  S:     5 KISVAESVGKGHPDKICDQISDAILDEILKQDEHARVAVETMASNRLIIIGGEISTSGYVDLVKIAWEILFEIGYNENDFTIISNVNRQSGEIASLVDQKNGTIGAGDQGIVYGFATNECPNFMPLAQNLANFLVKKAEELRKIGEFQFACADMKSQVEIHYDQNSKPKVKSMLMSIQHQQNFNYHNFVEFVINKIMIPAAKKYNLNIDFEKKVNKSGDFTIGGPIGDTGLTGRKLIIDTYGDAAKHGGGAFSGKDYTKVDRSGAYIARWIAKNLVAAGVAAEIELQFAYAIGNEYPELINVTYLKNAKIPTVKIIEIIKNVFNLRLVSLISRLNLRKPIYRNLAVYGHFGRDELDLPWEKLDMVEKIKDYLK 377
>gi|71893799|ref|YP_279245.1| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae J] (377 aa)
Score = 1081, Expect = 6.9e-116, Identities = 214/371 (57%), Positives = 272/371 (73%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           KI  +ESVGKGHPDKICDQISDA+LDE LKQD +++VA E  A+NRLI+IGGEI+T+GYVD+VK+AW +L  +GY+E+DFTIISNVN QS EI + V++ N  IGAGDQG+VYG+AT+EC NFMPL  N+A+ LVK AE++    +  F   DMKSQV I Y  +  PK+  ++MS+QH QN    + +E   N I+    KKYNLN DF++ +N SG FTIGGPIGDTGLTGRKL++DTYG  AKHGGGAFSGKD TKVDRSGAY AR+IAKN+VAA +A + E+Q ++AIG   P    V     +K    +I EII N F+  + S I + N+R PIY   + YGHFGR EL+  WE+LD VE+I ++ K
  S:     4 KISVAESVGKGHPDKICDQISDAILDEILKQDEHARVAVETMASNRLIIIGGEISTSGYVDLVKIAWEILFEIGYNENDFTIISNVNRQSGEIASLVDQKNGTIGAGDQGIVYGFATNECPNFMPLAQNLANFLVKKAEELRKIGEFQFACADMKSQVEIHYDQNSKPKVKSMLMSIQHQQNFNYHNFVEFVINKIMIPAAKKYNLNIDFEKKVNKSGDFTIGGPIGDTGLTGRKLIIDTYGDAAKHGGGAFSGKDYTKVDRSGAYIARWIAKNLVAAGVAAEIELQFAYAIGNEYPELINVTYLKNAKIPTVKIIEIIKNVFNLRLVSLISRLNLRKPIYRNLAVYGHFGRDELDLPWEKLDMVEKIKDYLK 376
>gi|144575463|gb|AAZ53818.2| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 7448] (378 aa)
Score = 1078, Expect = 1.6e-115, Identities = 212/371 (57%), Positives = 271/371 (73%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVE-KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           KI  +ESVGKGHPDKICDQISDA+LDE LKQD +++VA E  A+NRLI+IGGEI+T+GYVD+VK+AW +L  +GY+E+DFTIISNVN QS EI + V+ K+  IGAGDQG+VYG+AT+EC NFMPL  N+A+ LVK AE++    +  F   DMKSQV I Y  +  PK+  ++MS+QH QN    + +E     I+    KKYNLN DF++ +N SG FTIGGPIGDTGLTGRKL++DTYG  AKHGGGAFSGKD TKVDRSGAY AR+IAKN+VAA +A + E+Q ++AIG   P    V     +K    +I EII N F+  + S I + N+R PIY   + YGHFGR EL+  WE+LD VE+I ++ +
  S:     5 KISVAESVGKGHPDKICDQISDAILDEILKQDEHARVAVETMASNRLIIIGGEISTSGYVDLVKIAWEILFEIGYNENDFTIISNVNRQSGEIASLVDHKNGTIGAGDQGIVYGFATNECPNFMPLAQNLANFLVKKAEELRKIGEFQFACADMKSQVEIHYDQNSKPKVKSMLMSIQHQQNFNYHNFVEFVITKIMIPAAKKYNLNIDFEKKVNKSGDFTIGGPIGDTGLTGRKLIIDTYGDAAKHGGGAFSGKDYTKVDRSGAYIARWIAKNLVAAGVAAEIELQFAYAIGNEYPELINVTYLKNAKIPTVKIIEIIKNVFNLRLVSLISRLNLRKPIYRNLAVYGHFGREELDLPWEKLDMVEKIKDYLR 377
>gi|72080783|ref|YP_287841.1| S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 7448] (377 aa)
Score = 1076, Expect = 2.6e-115, Identities = 212/371 (57%), Positives = 271/371 (73%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVE-KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           KI  +ESVGKGHPDKICDQISDA+LDE LKQD +++VA E  A+NRLI+IGGEI+T+GYVD+VK+AW +L  +GY+E+DFTIISNVN QS EI + V+ K+  IGAGDQG+VYG+AT+EC NFMPL  N+A+ LVK AE++    +  F   DMKSQV I Y  +  PK+  ++MS+QH QN    + +E     I+    KKYNLN DF++ +N SG FTIGGPIGDTGLTGRKL++DTYG  AKHGGGAFSGKD TKVDRSGAY AR+IAKN+VAA +A + E+Q ++AIG   P    V     +K    +I EII N F+  + S I + N+R PIY   + YGHFGR EL+  WE+LD VE+I ++ +
  S:     4 KISVAESVGKGHPDKICDQISDAILDEILKQDEHARVAVETMASNRLIIIGGEISTSGYVDLVKIAWEILFEIGYNENDFTIISNVNRQSGEIASLVDHKNGTIGAGDQGIVYGFATNECPNFMPLAQNLANFLVKKAEELRKIGEFQFACADMKSQVEIHYDQNSKPKVKSMLMSIQHQQNFNYHNFVEFVITKIMIPAAKKYNLNIDFEKKVNKSGDFTIGGPIGDTGLTGRKLIIDTYGDAAKHGGGAFSGKDYTKVDRSGAYIARWIAKNLVAAGVAAEIELQFAYAIGNEYPELINVTYLKNAKIPTVKIIEIIKNVFNLRLVSLISRLNLRKPIYRNLAVYGHFGREELDLPWEKLDMVEKIKDYLR 376
>gi|50365056|ref|YP_053481.1| S-adenosylmethionine synthetase [Mesoplasma florum L1] >gi|60389978|sp|Q6F1M6|METK_MESFL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|50363612|gb|AAT75597.1| S-adenosylmethionine synthetase [Mesoplasma florum L1] (377 aa)
Score = 998, Expect = 2.5e-106, Identities = 198/368 (53%), Positives = 265/368 (72%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDNQ-IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDA+LDE LKQDPN+KVACE FA    ++IGG+ITT   VD  K+A +VL  +GY+   + I ++       V  QS +I   ++ D + IGAGDQG+++GYAT+E + F+PL I I+H+LV  A ++    K  + + DMKSQVTIDY D  NPKID I+MS+QH     +E  + F  + I+D V K++ LN+DF  +IN +G+F IGGP GDTGLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY ARY AKN+VA+ LA K E+Q+S+AIG  +P++  ++TFGT K S E I + +   FDFS+   I+K ++R P +   +TYGHFG+ E    WEQLDKV+ I
  S:     1 MRKLFTSESVSEGHPDKICDQISDAILDEVLKQDPNAKVACETFATTNYLLIGGQITTTASVDYEKIARDVLRKIGYNNDAYGINADTCKIDIRVEQQSADIALGIDLDTEVIGAGDQGIMFGYATNESKTFLPLAITISHELVYLASKLRKEGKFKWARPDMKSQVTIDYTDESNPKIDTILMSIQHDDEMIEEEFKKFIKSEIMDVVAKEFELNTDFNVLINPTGRFVIGGPQGDTGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSAAYMARYAAKNLVASGLADKIEIQVSYAIGKPEPVSIFIETFGTEKVSKEVIAKALNENFDFSVNEIIKKLDLRKPTFLKTATYGHFGKDEFT--WEQLDKVKTI 375
>gi|169350335|ref|ZP_02867273.1| hypothetical protein CLOSPI_01096 [Clostridium spiroforme DSM 1552] >gi|169293118|gb|EDS75251.1| hypothetical protein CLOSPI_01096 [Clostridium spiroforme DSM 1552] (404 aa)
Score = 968, Expect = 9.0e-103, Identities = 196/377 (51%), Positives = 269/377 (71%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDNQIG-AGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           M+ + + TSESV KGHPDK+CDQISDA+LD CL +DPNS+VACEVFA   L+VIGGEITT   VD  ++A +VL  +GYD+++  I          ++ QS++I  A+  ++++G AGDQG+++G+A  E E +MPLPI+IAH LV+ A +   + +  + + DMK+QVTIDY +S+ P+ID I+MS+QH  +  +   + +    I+D VVKKYNLN+D+K +IN +G+F IGGP GDTGLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY  RYIAKNIVAA L  K E+Q+S+AIG  +P +  ++T+GT   S + I + I   FD +    I+   +R PIY   + YGHFGR ++N  WE+LDKV    E  KKY
  S:    25 MKEKILFTSESVSKGHPDKVCDQISDAILDACLSEDPNSRVACEVFATTNLVVIGGEITTNAKVDYEQVARDVLKDIGYDDNEKGIDYRTCKIQVVMDLQSSDI--ALGTNDEVGGAGDQGIMFGFACKETEGYMPLPISIAHHLVRVATEKKDSGEFKYARPDMKAQVTIDYTESE-PRIDTILMSIQHDPDFKEAEFKCYIKEEIMDAVVKKYNLNTDYKVLINPTGRFVIGGPHGDTGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSAAYMLRYIAKNIVAADLCDKIEIQISYAIGVKEPTSIFIETYGTEHVSHDVILKAIKENFDLTPGGIIDTLKLRQPIYLKTAAYGHFGRGDINLPWEKLDKV----EILKKY 403
>gi|83319655|ref|YP_424452.1| S-adenosylmethionine synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|109892640|sp|Q2SS11|METK_MYCCT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|83283541|gb|ABC01473.1| S-adenosylmethionine synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (387 aa)
Score = 965, Expect = 1.9e-102, Identities = 194/372 (52%), Positives = 265/372 (71%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKICDQISDA+LDE LKQD N+KVACEVF     ++IGG+I++   VD  ++A +VL  +GY +  + I +N       + SQS +I   VE  N QIGAGDQG+++GYAT+E + ++PL I IAH+LV  A          + + DMKSQVTIDY +  NPKID I+MS+QH  N  +   + +    I+D V K++NLN+DFK +IN +G+F IGGP GDTGLTGRK++ DTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKN+VAA LA K E+Q+S+AIG S+PI+  ++TF T K     IY+ +   FDFS+ S I+  +++ PI+   S YGHFG+ +L+  WE+LDK+E + E+ K
  S:     7 KRLFTSESVSEGHPDKICDQISDAILDEVLKQDKNAKVACEVFTTTNYLLIGGQISSTAIVDYEQVARDVLKKIGYVDDAYGINANTCKIDIKIESQSPDIAQGVELSNDQIGAGDQGIMFGYATNESKTYLPLAITIAHELVYNATSQRKKGLFKWARPDMKSQVTIDYTNINNPKIDTILMSIQHDPNYNEIEFKKYIKENIMDLVAKEFNLNTDFKVLINPTGRFVIGGPQGDTGLTGRKIIADTYGGYSRHGGGAFSGKDSTKVDRSAAYMCRYVAKNLVAAGLADKIEIQVSYAIGISQPISIFIETFNTHKVDLNTIYKAVYENFDFSVSSMIKTLDLKKPIFFKTSKYGHFGKKDLS--WEKLDKIEVLKEYKK 385
>gi|188159317|ref|ZP_02998698.1| S-adenosylmethionine synthetase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (387 aa)
Score = 964, Expect = 2.3e-102, Identities = 194/372 (52%), Positives = 264/372 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKICDQISDA+LDE LKQD N+KVACEVFA    ++IGG+I++   VD  ++A +VL  +GY +  + I +N       + SQS +I   VE  N QIGAGDQG+++GYAT+E + ++PL I IAH+LV  A          + + DMKSQVTIDY +  NPKID I+MS+QH  N  +   + +    I+D V K++NLN+DFK +IN +G+F IGGP GDTGLTGRK++ DTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKN+VAA LA K E+Q+S+ IG S+PI+  ++TF T K     IY+ +   FDFS+ S I+  +++ PI+   S YGHFG+ +L   WE+LDK+E + E+ K
  S:     7 KRLFTSESVSEGHPDKICDQISDAILDEVLKQDKNAKVACEVFATTNYLLIGGQISSTAIVDYEQVARDVLKKIGYVDDAYGINANTCKIDIKIESQSPDIAQGVELSNDQIGAGDQGIMFGYATNESKTYLPLAITIAHELVYNATSQRKKGLFKWARPDMKSQVTIDYTNINNPKIDTILMSIQHDPNYNEIEFKKYIKENIMDLVAKEFNLNTDFKVLINPTGRFVIGGPQGDTGLTGRKIIADTYGGYSRHGGGAFSGKDSTKVDRSAAYMCRYVAKNLVAAGLADKIEIQVSYGIGISQPISIFIETFNTHKVDLNTIYKAVYENFDFSVSSMIKNLDLKKPIFFKTSKYGHFGKKDLP--WEKLDKIEVLKEYKK 385
>gi|42561027|ref|NP_975478.1| S-adenosylmethionine synthetase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|60390026|sp|Q6MTB6|METK_MYCMS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|42492524|emb|CAE77120.1| methionine adenosyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (387 aa)
Score = 956, Expect = 2.2e-101, Identities = 193/372 (51%), Positives = 264/372 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDN-QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKICDQISDA+LDE LKQD N+KVACEVFA    ++IGG+I++   V+  ++A +VL   GY +  + I +N       + SQS +I   VE  N QIGAGDQG+++GYAT+E + ++PL I IAH+LV  A          + + DMKSQVTIDY +  NPKID I+MS+QH  N  +   + +    I++ V K++NLN+DFK +IN +G+F IGGP GDTGLTGRK++ DTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKN+VAA LA K E+Q+S+AIG S+PI+  ++TF T K     IY+ +   FDFS+ S I+  +++ PI+   S YGHFG+ +L   WE+LDK+E + E+ K
  S:     7 KRLFTSESVSEGHPDKICDQISDAILDEVLKQDKNAKVACEVFATTNYLLIGGQISSTAIVNYEQVARDVLKKNGYVDDAYGINANTCKIDIKIESQSPDIAQGVELSNDQIGAGDQGIMFGYATNESKTYLPLAITIAHELVYNATSQRKKGLFKWARPDMKSQVTIDYTNINNPKIDTILMSIQHDPNYNETEFKKYIKENIMNLVAKEFNLNTDFKVLINPTGRFVIGGPQGDTGLTGRKIIADTYGGYSRHGGGAFSGKDSTKVDRSAAYMCRYVAKNLVAAGLADKIEIQVSYAIGISQPISIFIETFNTHKVDLNTIYKAVYENFDFSVSSMIKTLDLKKPIFFKTSKYGHFGKKDLP--WEKLDKIEVLKEYKK 385
>gi|31544668|ref|NP_853246.1| S-adenosylmethionine synthetase [Mycoplasma gallisepticum R] >gi|31541514|gb|AAP56814.1| MetK [Mycoplasma gallisepticum R] (395 aa)
Score = 952, Expect = 5.5e-101, Identities = 185/373 (49%), Positives = 259/373 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAV-EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + + T+ESVG  HPDK+CDQI+DA+LD CLKQD NS+VACEV A N LI+I GEI+T   VD V  AW V+   GYD SDFTII+N+N QS+EI  +V +K+++IGAGDQG+  GYA DE +N MPL + +AHDLV+ A+++I N   +  K+DMK+QV+++Y D+   ++  I+MS+QH +N      + F    I+D V  KY  N +++ +IN SG F  GGP  DTGLTGRKL+VD++G  A HGGGA+SGKD TKVDRSGAY+AR+IAK+IV AKLA +CEV +S+AIG +KP+   V+ F T     + I +I+   F+  + + IE   +++  YS  + YGHFG++E    +E    +++IL+   K
  S:    20 KGVYTAESVGSAHPDKLCDQIADAILDACLKQDQNSRVACEVMACNHLIIIAGEISTKASVDYVGTAWKVVNQFGYDRSDFTIIANINQQSSEIAQSVDQKNHKIGAGDQGITVGYACDETKNQMPLAVMMAHDLVRLAKELIDNKTFNHAKYDMKAQVSLNYLDNNQVELKTILMSIQHEENVDLSVFKLFVKKFIMDEVATKYGFNKNYEALINPSGLFVSGGPTADTGLTGRKLLVDSFGIYAHHGGGAYSGKDYTKVDRSGAYYARWIAKHIVKAKLASQCEVIISWAIGLTKPLDIVVNCFNTHTVELDLINQIVKKIFNHDLATIIELLKLKTTNYSGLAVYGHFGKSEKQYRFEDTIYLDQILKIVNK 394
>gi|160941948|ref|ZP_02089272.1| hypothetical protein CLOBOL_06841 [Clostridium bolteae ATCC BAA-613] >gi|158435133|gb|EDP12900.1| hypothetical protein CLOBOL_06841 [Clostridium bolteae ATCC BAA-613] (411 aa)
Score = 947, Expect = 2.3e-100, Identities = 181/365 (49%), Positives = 260/365 (71%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R++ TSESV +GHPDK+CD ISDA+LD  ++QDP S+VACE      L+++ GEITT  YVD+ K+    +  +GYD + +        +I+ ++ QS +I   V K              + IGAGDQG+++G+AT+E E FMP PI++AH L K   +V  N  + +++ D KSQVT++Y ++  P ++D +++S QH ++ T+E I +     I D ++ ++ ++ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LA KCE+QLS+AIG + P +  VDT+GT K S+E++ +II + FD      I+  ++R PIY   + YGHFGR +L+  WE+LDKVE
  S:    19 RRLFTSESVTEGHPDKMCDAISDAILDALMEQDPMSRVACETATTTGLVLVMGEITTNAYVDIQKLVRETVREIGYDRAKYGFDCDTCGVITAIDEQSQDIALGVNKALEAKENKMSDQELDAIGAGDQGMMFGFATNETEEFMPYPISLAHKLAKRLTEVRKNGTLKYLRPDGKSQVTVEYDENDKPVRLDAVVLSTQHDESVTQEQIHADVKKYIFDEILPQHMIDGNTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVAHPTSIMVDTYGTGKLSNEKLVDIIRSNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRNDLDLPWERLDKVE 405
>gi|110004080|emb|CAK98419.1| s-adenosylmethionine synthetase protein [Spiroplasma citri] (383 aa)
Score = 947, Expect = 2.3e-100, Identities = 189/370 (51%), Positives = 260/370 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFC-NAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           R + TSESV +GHPDKICDQISDAVLD CLK+DP S+VACE F     ++IGGEITT   VD   +A  VL  +GY+ +++ I          V +QS +I   V+K    GAGDQG+++GYAT+E +N+MPL I+IAH LVK A  +         + DMKSQVT+D  + ++  ID I+MS+QH ++  +   + F    I++ VV+++ +N DFK +IN +G+F IGGP GD GLTGRK +VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA L ++CE+QLS+AIG ++PI+  V+TFGT+  +++ I + I   FDF  ++ IE  +++ PIY   +TYGHFGR      WE+LDKV+ ++++
  S:     5 RILFTSESVSEGHPDKICDQISDAVLDACLKEDPLSRVACECFITTNRVIIGGEITTKAKVDYANVARKVLKEIGYNNAEWGINWQNCEVEILVKTQSPDISIGVDK---AGAGDQGIMFGYATNESDNYMPLAISIAHALVKRASMLRKKGMFIGARPDMKSQVTLDLTNVKHIYIDTILMSIQHDEDIDEAKFKHFVITEIMEPVVQEFKMNLDFKVLINPTGRFVIGGPKGDAGLTGRKNIVDTYGGYARHGGGAFSGKDGTKVDRSAAYMARYVAKNIVAAGLTERCEIQLSYAIGVAEPISIFVETFGTNFVTNDIILQAIKENFDFRPQAMIETLDLQKPIYQQTATYGHFGRYHTELPWEKLDKVQSLIKY 379
>gi|154484262|ref|ZP_02026710.1| hypothetical protein EUBVEN_01974 [Eubacterium ventriosum ATCC 27560] >gi|149734739|gb|EDM50656.1| hypothetical protein EUBVEN_01974 [Eubacterium ventriosum ATCC 27560] (395 aa)
Score = 946, Expect = 2.8e-100, Identities = 186/374 (49%), Positives = 263/374 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +++ TSESV +GHPDKICDQISDA+LDE ++QDP S+VACE      L+++ GEITT GYVD+ K+    +  +GYD + +        +I+ ++ QS +I   V+K              + IGAGDQG+++GYAT+E E +MP PI++AH L +   +V  N  + +++ D KSQVT++Y ++  P ++D +++S QH    ++E I E     + D V+ +  ++ + K  +N +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LA KCE+QLS+AIG + P +  VDTFGT K SDE++ EII   FD      I+  ++R PIY   + YGHFGR +++  WE+ DKVE +    KKY
  S:     3 KRLFTSESVTEGHPDKICDQISDAILDELMRQDPMSRVACETAITTGLVLVMGEITTKGYVDIQKVVRETIREIGYDRAKYGFDCDTCGVITALDEQSADIALGVDKALEAKENKMTDEEIDAIGAGDQGMMFGYATNETEEYMPYPISLAHKLARKLTEVRKNGTLKYLRPDGKSQVTVEYDENGKPARLDAVVLSTQHDPEVSQEQIHEDIKKYVFDTVLPQDMIDENTKFFVNPTGRFVIGGPHGDSGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVAHPTSVMVDTFGTGKLSDEKLVEIIRENFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRNDIDVPWEKTDKVEML----KKY 394
>gi|163814877|ref|ZP_02206265.1| hypothetical protein COPEUT_01028 [Coprococcus eutactus ATCC 27759] >gi|158449816|gb|EDP26811.1| hypothetical protein COPEUT_01028 [Coprococcus eutactus ATCC 27759] (395 aa)
Score = 943, Expect = 5.8e-100, Identities = 182/367 (49%), Positives = 259/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISDAVLD  ++QDP S+VACE      L+++ GEITT  YVD+ K+    +  +GYD + +        +I+ ++ QS++I   V+K                IGAGDQG+++G+AT+E   +MP PI +AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D +++S QH +  ++E I +     I D V+ +  ++ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LA KCE+QLS+AIG ++P +  VDTFGT K SDE++ EII   FD      I   ++R PIY   + YGHFGRT+L+  WE+LD+V+ +
  S:     3 RRLFTSESVTEGHPDKICDQISDAVLDALMEQDPMSRVACETSITTGLVLVMGEITTNAYVDIQKIVRETIREIGYDRAKYGFDCDTCGVITAIDEQSSDIAMGVDKALEAKEHLMSEDDIEAIGAGDQGMMFGFATNETLEYMPYPIALAHKLARKLTEVRKNGTLPYLRPDGKTQVTVEYDENDKPVRLDAVVLSTQHGEEVSQEQIHADVKKHIFDEVLPQELIDENTKFFINPTGRFVIGGPNGDSGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVARPTSIMVDTFGTGKLSDEKLVEIIRENFDLRPAGIIRMLDLRRPIYKQTAAYGHFGRTDLDLPWEKLDRVDAL 391
>gi|160914704|ref|ZP_02076918.1| hypothetical protein EUBDOL_00711 [Eubacterium dolichum DSM 3991] >gi|158433244|gb|EDP11533.1| hypothetical protein EUBDOL_00711 [Eubacterium dolichum DSM 3991] (390 aa)
Score = 943, Expect = 6.4e-100, Identities = 185/377 (49%), Positives = 265/377 (70%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           M  +K  TSESV +GHPDKICDQISDAVLD  L +DP ++VACE      +++I GEI+T  YVD+  +A NV++ +GYD + +       +++++++ QS++I   V+         +   GAGDQG+++GYA +E    MPLPI++AH L K   +V  +  +D+++ D K+QVTI+Y D +  ++D I++S QHS + + ++I +     +ID +V K  ++ D K  IN +G+F IGGP GD+GLTGRKL+VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+KCEVQL++AIG +KP++  VDT+GT K  DE+I EI+   FD    + IE+  +R P+Y   + YGHFGR +L   WE ++  E +    KKY
  S:     1 MVQKKYFTSESVTEGHPDKICDQISDAVLDAILAKDPAARVACETCCTTGMVMIMGEISTNCYVDIPSIARNVVLDIGYDRAKYGFDGTTCSVLTSIDEQSSDIALGVDHSLETKEGGEENNGAGDQGMMFGYACNETPELMPLPISLAHKLAKQLTKVRKDGVLDYLRPDGKTQVTIEYDDGKPKRVDTIVISTQHSDSVSLDTIRKDLKKHVIDVIVDKDMMDEDTKIYINPTGRFVIGGPQGDSGLTGRKLIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKCEVQLAYAIGVAKPVSLLVDTYGTGKLDDEKIAEIVNKEFDLRPTAIIEELELRKPMYRQLAAYGHFGREDLGVKWESVEPAERL----KKY 389
>gi|193216812|ref|YP_002000054.1| S-adenosylmethionine synthetase [Mycoplasma arthritidis 158L3-1] >gi|193002135|gb|ACF07350.1| S-adenosylmethionine synthetase [Mycoplasma arthritidis 158L3-1] (378 aa)
Score = 940, Expect = 1.4e-99, Identities = 188/374 (50%), Positives = 277/374 (74%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDY-ADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           +++++TSESVG GHPDKICDQISDA+LD  LK+D +++VAC+V A N LI IGG+I+T  YVD V  AW +L  LGY + DF I + +  QS +I   V+K   +++GAGDQG+++GYAT+E + ++P  + ++H+LVK AE++    K  + K DMKSQVT++Y  + +  ++++++MS+QH +N   +  + F    I+D+V+K+ N N D++ ++N +G+F IGGP+GDTGLTGRK++VDTYG  A HGGGAFSGKD TK+DRS AY ARYIAKN+VAA +A++ E+QLS+AIG S+P +  V+TFG SKYS+++I   I   FD S++  I   N+++  Y P +T+GHFGR +L+  WE+LDKV+EI +  +K
  S:     1 MKRLITSESVGAGHPDKICDQISDAILDAILKKDKDARVACDVLANNNLIYIGGQISTKTYVDTVAEAWKILKKLGYQDQDFIITNGIQPQSADIAIGVDKTEKHELGAGDQGILFGYATNENKYYLPWALVLSHELVKRAERLRLAKKFPYAKSDMKSQVTLEYDTEIKKFQVEKVLMSIQHEENFDFDKFKRFIKENIVDYVLKENNFNLDYEFLLNPTGRFVIGGPVGDTGLTGRKIIVDTYGGFAHHGGGAFSGKDATKIDRSAAYMARYIAKNMVAADVAEQFELQLSYAIGLSRPQSIFVNTFGASKYSEDKIITTINQIFDLSVEGIINSLNLKNVSYLPLATFGHFGRNDLDLPWERLDKVDEIKKLIEK 378
>gi|167758626|ref|ZP_02430753.1| hypothetical protein CLOSCI_00966 [Clostridium scindens ATCC 35704] >gi|167663822|gb|EDS07952.1| hypothetical protein CLOSCI_00966 [Clostridium scindens ATCC 35704] (395 aa)
Score = 935, Expect = 5.4e-99, Identities = 183/372 (49%), Positives = 262/372 (70%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE-----KDNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           + TSESV +GHPDK+CDQISDA+LD  ++QDP S+VACE      L+++ GEITT  YVD+ K+  + +  +GY    F        +I+ ++ QS++I   V+     K+N+        IGAGDQG+++GYATDE    MP PI +AH L +   +V  N  + +++ D K+QVT++Y ++  P+ +D +++S QH  + ++E I E     + + V+ +  ++ D K  IN +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA +AKKCE+QLS+AIG + P +  VDTFGT +  DE++ EII   FD      I+  ++R P+Y   + YGHFGRT+++  WE+LDKVE +    KKY
  S:     5 LFTSESVTEGHPDKMCDQISDAILDALMEQDPMSRVACETCTTTGLVLVMGEITTNAYVDIQKIVRDTVREIGYTRGKFGFDADTCGVITAIDEQSSDIAMGVDRALEAKENKMSEQEIEAIGAGDQGMMFGYATDETPELMPYPIALAHKLARKLTEVRKNGTLPYLRPDGKTQVTVEYDEAGVPRRLDAVVLSTQHDPDISQEQIHEDIKKHVFEAVIPRGMIDGDTKFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGIAKKCEIQLSYAIGVAHPTSIMVDTFGTGRIDDEKLVEIIRENFDLRPAGIIKMLDLRRPLYKQTAAYGHFGRTDIDLPWEKLDKVEVL----KKY 394
>gi|166031388|ref|ZP_02234217.1| hypothetical protein DORFOR_01077 [Dorea formicigenerans ATCC 27755] >gi|166028793|gb|EDR47550.1| hypothetical protein DORFOR_01077 [Dorea formicigenerans ATCC 27755] (422 aa)
Score = 932, Expect = 1.3e-98, Identities = 182/365 (49%), Positives = 258/365 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-----DNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R + TSESV +GHPDK+CDQISDA+LD  ++QDP S+VACE      L+++ GEITT  YVD+ K+  + +  +GY       D     +I+ ++ QS +I   V+K     +N+        IGAGDQG+++GYA+DE    MP PI++AH L +   +V  +  + +++ D K+QVT++Y ++  PK +D +++S QH  + T+E I E     + D ++ +  ++ + K  IN +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA +AKKCE+QLS+AIG + P +  VDTFGT K SDE++ EII   FD      I+  N+R PIY   + YGHFGRT+++  WE+ DK E
  S:    30 RHLFTSESVTEGHPDKMCDQISDAILDALMEQDPMSRVACETCTTTGLVMVMGEITTNAYVDIQKIVRDTVREIGYTRGKYGFDADTCGVITAIDEQSADIALGVDKALEAKENKMSEEEIAAIGAGDQGMMFGYASDETPELMPYPISLAHKLARKLTEVRKDGTLKYLRPDGKTQVTVEYDENGTPKRLDAVVLSTQHDPDVTQEQIHEDIKKYVFDPIIPEGMVDENTKFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGIAKKCEIQLSYAIGVAHPTSIMVDTFGTGKLSDEKLVEIIRENFDLRPAGIIQMLNLRRPIYKQTAAYGHFGRTDVDLPWEKTDKAE 416
>gi|51891256|ref|YP_073947.1| S-adenosylmethionine synthetase [Symbiobacterium thermophilum IAM 14863] >gi|60389956|sp|Q67T90|METK_SYMTH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|51854945|dbj|BAD39103.1| S-adenosylmethionine synthetase [Symbiobacterium thermophilum IAM 14863] (398 aa)
Score = 931, Expect = 1.8e-98, Identities = 185/369 (50%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV-----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFV---VKKYNLNSDFKR-IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDK+ DQISDAVLD  L  DP ++VACE      L+V+ GEITT  YVD+  +  +V+  +GY       D S   +++ ++ QS +I   V           EK+ +IGAGDQG+++G+A DE    MPLPI++AH L +   QV  N  + +++ D K+QVTI+Y D +  +ID I++S QH  + T+E I      +ID+V   V   NL  D  R  IN +G+F +GGP GDTGLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY AR++AKNIVAA LA+KCEVQ+++AIG + P++  V TFGT K  DE++ +++  TFD    + I   ++R PIY   + YGHFGR +L+  WE+ DKV+ + E
  S:     7 RYLFTSESVTEGHPDKMADQISDAVLDAILALDPRARVACETLLTTGLVVVTGEITTHAYVDIPNLVRDVVRDIGYTRAKYGFDGSTCGVMTAIDPQSPDIAQGVDVAIEVRGEVNEKELEIGAGDQGMMFGFACDETPELMPLPISLAHRLARRLAQVRKNGTLPYLRPDGKTQVTIEYEDGRPKRIDTIVISAQHDPDTTQEQIR---KDVIDYVILDVVDRNLIDDRTRYFINPTGRFVVGGPQGDTGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARWVAKNIVAAGLARKCEVQVAYAIGVAHPVSILVTTFGTGKLPDERLAQLVRETFDLRPGAIIRDLDLRRPIYRQVAAYGHFGRPDLDLPWERTDKVDLLRE 394
>gi|167039106|ref|YP_001662091.1| S-adenosylmethionine synthetase [Thermoanaerobacter sp. X514] >gi|166853346|gb|ABY91755.1| Methionine adenosyltransferase [Thermoanaerobacter sp. X514] (395 aa)
Score = 930, Expect = 2.1e-98, Identities = 184/366 (50%), Positives = 261/366 (71%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRI-INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           +R++ TSESV +GHPDKICDQISDA+LDE LK+DP ++VACE      L+++ GEITT  YVD+ K+   V+  +GY  + F        +I++++ QS +I   V+K          D++I   GAGDQG+++G+A DE E  MP+PI +AH L +   +V  N  + +++ D K+QVT++Y D +  ++D +++S QH+     ++IE     II+ V+K     N+  D  +I +N +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LAKKCEVQL++AIG + P+   +DTFGT K SDE+I EI+   FD    + I   ++R PIY   + YGHFGR +L+  WE+ DKV+
  S:     1 MRRLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAVTTGLVLVMGEITTDCYVDIPKVVRKVVEEIGYTRAKFGFDADTCAVITSIDEQSPDIALGVDKALEAKRGELSDSEIEAIGAGDQGLMFGFACDETEELMPMPIMLAHKLARRLAEVRKNGTLSYLRPDGKTQVTVEYEDDRPVRVDSVVVSAQHAPEIDHDTIE---RDIIEHVIKPIIPENMIDDKTKIFVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLAKKCEVQLAYAIGVATPLEIGIDTFGTGKISDEKISEIVKQVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDKVD 387
>gi|167038185|ref|YP_001665763.1| S-adenosylmethionine synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857019|gb|ABY95427.1| Methionine adenosyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (395 aa)
Score = 929, Expect = 2.8e-98, Identities = 184/366 (50%), Positives = 261/366 (71%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRI-INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           +R++ TSESV +GHPDKICDQISDA+LDE LK+DP ++VACE      L+++ GEITT  YVD+ K+   V+  +GY  + F        +I++++ QS +I   V+K          D++I   GAGDQG+++G+A DE E  MP+PI +AH L +   +V  N  + +++ D K+QVT++Y D +  ++D +++S QH+     ++IE     II+ V+K     N+  D  +I +N +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LAKKCEVQL++AIG + P+   +DTFGT K SDE+I EI+   FD    + I   ++R PIY   + YGHFGR +L+  WE+ DKV+
  S:     1 MRRLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAVTTGLVLVMGEITTQCYVDIPKVVRKVVEEIGYTRAKFGFDADTCAVITSIDEQSPDIALGVDKALEAKRGELSDSEIEAIGAGDQGLMFGFACDETEELMPMPIMLAHKLARRLAEVRKNGTLSYLRPDGKTQVTVEYEDDKPVRVDSVVVSAQHAPEIDHDTIE---RDIIEHVIKPIIPENMIDDKTKIFVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLAKKCEVQLAYAIGVATPLEIGIDTFGTGKISDEKISEIVKQVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDKVD 387
>gi|146295893|ref|YP_001179664.1| S-adenosylmethionine synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166201385|sp|A4XHT8|METK_CALS8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|145409469|gb|ABP66473.1| methionine adenosyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] (396 aa)
Score = 929, Expect = 2.9e-98, Identities = 185/370 (50%), Positives = 260/370 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           +RK+ TSESV +GHPDKICDQISDAVLD  L++DP ++VACEV     L+++ GEITT  YVD+ K+A + +  +GY  + +        +I++++ QS +I   V+K          D++I   GAGDQG+++G+A DE    MP+PI +AH L +    V     + +++ D K+QVT++Y D +  ++D I++S QHS   T   IE+     +I  ++ +  L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS  Y ARY+AKNIVAA LAKKCEVQLS+AIG ++P++  VDTFGT K  DE+I EI+   FD    + I   ++R PIY   + YGHFGR +L+  WE+ DKV+ IL+
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILEKDPYARVACEVAVTTGLVLVMGEITTKCYVDIPKIARDTIREIGYTRAKYGFDADTCAVITSIDEQSPDIAMGVDKALEAKLGEMTDDEIEAIGAGDQGMMFGFACDETPVLMPMPIYLAHKLARRLAYVRKGGILPYLRPDGKTQVTVEYEDDRPIRVDTIVVSTQHSPEVTHAQIEADVIEHVIKPIIPEGMLDKNTKIYINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSATYAARYVAKNIVAAGLAKKCEVQLSYAIGVARPLSIRVDTFGTGKIDDEKIAEIVKRVFDLRPAAIIRDLDLRRPIYKKVAAYGHFGREDLDLPWERTDKVDIILK 391
>gi|160893738|ref|ZP_02074522.1| hypothetical protein CLOL250_01292 [Clostridium sp. L2-50] >gi|156864723|gb|EDO58154.1| hypothetical protein CLOL250_01292 [Clostridium sp. L2-50] (396 aa)
Score = 929, Expect = 2.9e-98, Identities = 184/368 (50%), Positives = 256/368 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  + + TSESV +GHPDKICDQISDAVLD  ++QDP S+VACE      L+++ GEITT  YVD+ K+    +  +GYD + +        +I+ ++ QS +I   V+K                IGAGDQG+++G+AT+E   +MP PI +AH L +   +V  N  + +++ D K+QVT++Y ++   K +D +++S QH +  ++E I E     + D V+    ++ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LA KCE+QLS+AIG ++P +  VDTFGT K SDE++ EII   FD      I+  ++R PIY   + YGHFGRT+L+  WE+LDKV+
  S:     1 MMEKLLFTSESVTEGHPDKICDQISDAVLDALMEQDPMSRVACETSITTGLVLVMGEITTKAYVDIQKIVRETIREIGYDRAKYGFDCDTCGVITAIDEQSADIAMGVDKALEAKEHLMSDDDIEAIGAGDQGMMFGFATNETTEYMPYPIALAHKLARKLTEVRKNGTLSYLRPDGKTQVTVEYDENGKAKRLDAVVLSTQHGEEVSQEQIHEDIKKYVFDPVLPADMVDEDTKFFINPTGRFVIGGPNGDSGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVARPTSIMVDTFGTGKVSDEKLVEIIREHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDLDLPWEKLDKVD 390
>gi|160881992|ref|YP_001560960.1| methionine adenosyltransferase [Clostridium phytofermentans ISDg] >gi|189081708|sp|A9KL72|METK_CLOPH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|160430658|gb|ABX44221.1| Methionine adenosyltransferase [Clostridium phytofermentans ISDg] (396 aa)
Score = 928, Expect = 3.5e-98, Identities = 186/377 (49%), Positives = 261/377 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           M+ + + TSESV +GHPDKICDQISDAVLD  L+QDP S+VACE      L+++ GEITT+GYVD+ K+  + +  +GYD + +        +I  ++ QS +I   V+K                IGAGDQG+++GYA++E E  MP PI++AH L K   +V  +  + +++ D KSQVT++Y +   P  ++ +++S QH  + T+E I E     + + V+ K  ++   K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS +Y ARY+AKNIVA+ LA KCE+QLS+AIG ++P +  +DTFGT K S+E++ EI+   FD      I+  ++R PIY   + YGHFGR +LN  WEQ DK EE+    KKY
  S:     1 MQNKLLFTSESVTEGHPDKICDQISDAVLDALLEQDPMSRVACETAITTGLVLVMGEITTSGYVDIQKIVRDTVKEIGYDRAKYGFDADTCGVIVALDEQSKDIALGVDKALEAKQNEMTDEAIEAIGAGDQGMMFGYASNETEELMPYPISLAHKLTKQLSKVRKDGTLSYLRPDGKSQVTVEYNEEGKPVHLNAVVLSTQHDPDVTQEQIHEDIKKYVFEPVLPKEMVDEKTKFFINPTGRFVIGGPNGDSGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSASYAARYVAKNIVASGLADKCEIQLSYAIGVAQPTSIMIDTFGTGKKSNEELTEIVRKHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRNDLNLPWEQTDKAEEL----KKY 395
>gi|109645811|ref|ZP_01369731.1| S-adenosylmethionine synthetase [Desulfitobacterium hafniense DCB-2] >gi|109643760|gb|EAT53313.1| S-adenosylmethionine synthetase [Desulfitobacterium hafniense DCB-2] (396 aa)
Score = 922, Expect = 1.7e-97, Identities = 177/369 (47%), Positives = 257/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIF----NAVEKDN---------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           +K+ TSESV +GHPDKICDQISDA+LD    +DPN++VACE      L+++ GEITT  YVD+       +  +GY  + +        +++++  QS +I      A+E  N          IGAGDQG+++GYAT+E E++MPL I++AH L +   +V  +  +D+++ D K+QVT++Y D++  +ID I++S QH   AT+E I       ++  VV    L+   +  IN +G+F IGGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA++CE+QL++AIG ++P++  V+TFGT+K  +E+I E++ N FD      I+  N+R PIY   + YGHFGRT+L+  WE+ DK   + E
  S:     3 KKLFTSESVTEGHPDKICDQISDAILDAIFAKDPNARVACETSVTTGLVLVSGEITTNCYVDIPSTVRQTIREIGYTRAKYGFDADTCAVLTSIGEQSADIALGVDRALEAKNGEMSEEEIEAIGAGDQGMMFGYATNETESYMPLAIDLAHRLARRLSEVRKSDILDYLRPDGKTQVTVEYEDNRPVRIDTIVISTQHHPEATQERIRRDLLEHVVFPVVPSELLDESTRYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLAERCEIQLAYAIGVAQPVSVLVETFGTAKIDEEKIGELVKNNFDLRPAGIIKTLNLRRPIYRQTAAYGHFGRTDLDLPWEKTDKAAALRE 392
>gi|187606355|ref|ZP_02992513.1| Methionine adenosyltransferase [Exiguobacterium sp. AT1b] >gi|187481590|gb|EDU19636.1| Methionine adenosyltransferase [Exiguobacterium sp. AT1b] (402 aa)
Score = 921, Expect = 2.3e-97, Identities = 179/374 (47%), Positives = 260/374 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           R++ TSESV +GHPDKICDQISD++LD  L +DPN++VA E      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V             E+ + IGAGDQG+++GYAT+E    MPLPI++AH L +   +V  N  +++++ D K+QVT++Y +  NP +ID I++S QH++  T E I E     +I+ V+    ++++ K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA K EVQL++AIG + P++ AVDTFGT K S+ ++ E++   FD      I+  ++R PIY   + YGHFGRT++   WEQ DK   + E  K++
  S:     6 RRLFTSESVTEGHPDKICDQISDSILDAILAEDPNARVAAETSVTTGLVLVAGEITTSTYVDIPKVVRETIREIGYTRAKYGFDAETCAVLTSIDEQSVDIAQGVDQALEAREGQMTEEELDAIGAGDQGLMFGYATNETPELMPLPISLAHKLSRRLAEVRKNGTLEYLRPDGKTQVTVEYDEDNNPVRIDTIVISTQHAEEITLEQIQEDLKKHVIEAVIPAELIDAETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAHPVSIAVDTFGTGKLSETELVELVRENFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIELPWEQTDKAAILEEGAKRF 401
>gi|126651269|ref|ZP_01723476.1| S-adenosylmethionine synthetase [Bacillus sp. B14905] >gi|126591798|gb|EAZ85881.1| S-adenosylmethionine synthetase [Bacillus sp. B14905] (398 aa)
Score = 921, Expect = 2.6e-97, Identities = 180/370 (48%), Positives = 254/370 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R++ TSESV +GHPDKICDQISDA+LD  L +DPN++VACE      L+++ GEITT+ YVD+  +  + +  +GY       D  +  ++  +  QS +I   V++                IGAGDQG+++GYA +E    MPLPI++AH L +   +V  + ++ +++ D K+QVTI+Y D+  P ++D I++S QH + AT E I++     +I  VV    L++  K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++ EVQL++AIG ++P++ AVDTFGT K  + +I E +   FD      I+  ++R PIY   + YGHFGRT+LN  WEQ DK + +
  S:     1 MTKRRLFTSESVTEGHPDKICDQISDAILDAILAEDPNARVACETTVTTGLVLVAGEITTSTYVDIKGIVRDTVAEIGYTRGKYGFDAENLAVLVAIGEQSPDIAQGVDQALEAREGSMTDADIEAIGAGDQGLMFGYACNETPELMPLPISLAHKLARRLTEVRKSGELAYLRPDGKTQVTIEYDDNNVPVRVDTIVISTQHDEEATLEQIQADLKQLVIAPVVPSELLDTKTKYFINPTGRFVIGGPKGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAERAEVQLAYAIGVAQPVSIAVDTFGTGKVKESEIVEWVRELFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDLNVPWEQTDKADAL 392
>gi|154503589|ref|ZP_02040649.1| hypothetical protein RUMGNA_01413 [Ruminococcus gnavus ATCC 29149] >gi|153795689|gb|EDN78109.1| hypothetical protein RUMGNA_01413 [Ruminococcus gnavus ATCC 29149] (396 aa)
Score = 920, Expect = 3.0e-97, Identities = 177/374 (47%), Positives = 261/374 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +++ TSESV +GHPDK+CD ISDA+LD  +++DP S+VACE      ++++ GEITT  Y+D+ ++    +  +GYD  D+        +++ ++ QS +I   V K              + IGAGDQG+++GYA DE   FMP PI++AH L +   ++  +  + +++ D KSQVTI+Y ++  P ++D +++S QH  + T+E I +     +++ ++    ++ + K  IN +G+F IGGP GD+G+TGRK++VDTYG +A+HGGGAFSGKDCTKVDRS +Y ARY+AKNIVAA LAKKCE+QLS+AIG + P +  VDTFGT K SDE + EII   FD      I+  ++R PIY   + YGHFGR ++N  WE+LD+VEE+    KKY
  S:     3 KRLFTSESVTEGHPDKMCDAISDAILDALMEKDPMSRVACETAITTGMVLVMGEITTNAYIDMQQVVRETIKEIGYDNGDYGFDAHTCAVLTAIDEQSADIALGVNKALEAKEHKMSEEELDAIGAGDQGMMFGYACDETNEFMPYPISLAHKLTRQLTKIRKDGVLPYLRPDGKSQVTIEYDEAGIPHRLDAVVLSTQHDPDVTQEQIHDDIKKYVLEPIIPTELVDENTKFFINPTGRFVIGGPHGDSGVTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSASYAARYVAKNIVAAGLAKKCEIQLSYAIGVAHPTSIMVDTFGTGKISDESLVEIIRREFDLRPAGIIQMLDLRRPIYKQTAAYGHFGRDDINLPWERLDRVEEL----KKY 394
>gi|56964642|ref|YP_176373.1| S-adenosylmethionine synthetase [Bacillus clausii KSM-K16] >gi|60389907|sp|Q5WDZ8|METK_BACSK S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56910885|dbj|BAD65412.1| S-adenosylmethionine synthetase [Bacillus clausii KSM-K16] (405 aa)
Score = 920, Expect = 3.1e-97, Identities = 178/369 (48%), Positives = 256/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISDA+LDE LK+DPN++VACE      L+++ GEITT  YVD+  +    +  +GY  + +        ++++++ QS +I   V+K                IGAGDQG+++G+AT+E E  MPLPI+++H L +   +V  N  + +++ D K+QVTI+Y ++  P ++D I++S QH+   T E I++     +I+ VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LA KCEVQL++AIG ++P++ AV+TFGT K +++ + E++   FD      I   ++R PIY   + YGHFGRT++   WE  DK   + E
  S:     7 RHLFTSESVTEGHPDKICDQISDAILDEILKKDPNARVACETSVTTGLVLVAGEITTNTYVDIPSVVRQTIKGIGYTRAKYGFDAETCAVLTSIDEQSADIAQGVDKALEAREGQMTDAEIEAIGAGDQGLMFGFATNETEELMPLPISLSHKLSRRLTEVRKNGTLGYLRPDGKTQVTIEYDENDTPVRVDTIVLSTQHAPEVTLEQIQADLKEHVIEAVVPSALIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSGAYAARYVAKNIVAAGLADKCEVQLAYAIGVAQPVSIAVNTFGTGKAAEDVLVELVRKHFDLRPAGIIRMLDLRRPIYKQTAAYGHFGRTDVPLPWEATDKAAALKE 397
>gi|167748336|ref|ZP_02420463.1| hypothetical protein ANACAC_03080 [Anaerostipes caccae DSM 14662] >gi|167652328|gb|EDR96457.1| hypothetical protein ANACAC_03080 [Anaerostipes caccae DSM 14662] (406 aa)
Score = 920, Expect = 3.3e-97, Identities = 184/367 (50%), Positives = 251/367 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+CDQISDA+LDE LKQDP S+VACE      L+++ GEITT  YVD+ K+    L  +GY       D S   +I+ ++ QS +I   V+K              + IGAGDQG+++GYAT+E + +MP PI++AH L K   QV  +  + +++ D K+QV+++Y ++  P +++ +++S QH     +E I E     I D V+ K  ++   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVA+ LA KCE+QLS+AIG + P +  VDTFGT K S E + E+I   FD      I   ++R PIY   S YGHFGR +L+  WE+LDK + + E
  S:    15 LFTSESVTEGHPDKVCDQISDAILDELLKQDPMSRVACETCTTTGLVMVMGEITTNAYVDIQKIVRQTLTDIGYTRAKYGFDASTCGVITAIDEQSKDIALGVDKALEAKESDMSDEELDAIGAGDQGMMFGYATNETDEYMPYPISLAHKLSKRLTQVRKDGVLPYLRPDGKTQVSVEYDENGKPFRLEAVVLSAQHDPEVDQEQIHEDVKREIFDKVLPKEMVDDQTKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVASGLADKCEIQLSYAIGVAHPTSINVDTFGTGKISSEDLVELIRKNFDLRPAGIIRMLDLRRPIYRQTSNYGHFGRNDLDLPWERLDKADMLRE 403
>gi|89895472|ref|YP_518959.1| S-adenosylmethionine synthetase [Desulfitobacterium hafniense Y51] >gi|89334920|dbj|BAE84515.1| hypothetical protein [Desulfitobacterium hafniense Y51] (416 aa)
Score = 918, Expect = 4.9e-97, Identities = 176/363 (48%), Positives = 255/363 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIF----NAVEKDN---------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           +K+ TSESV +GHPDKICDQISDA+LD    +DPN++VACE      L+++ GEITT  YVD+       +  +GY  + +        +++++  QS +I      A+E  N          IGAGDQG+++GYAT+E E++MPL I++AH L +   +V  +  +D+++ D K+QVT++Y D++  +ID I++S QH   AT+E I       ++  VV    L+   +  IN +G+F IGGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA++CE+QL++AIG ++P++  V+TFGT+K  +E+I E++ N FD      I+  N+R PIY   + YGHFGRT+L+  WE+ DK
  S:     6 KKLFTSESVTEGHPDKICDQISDAILDAIFAKDPNARVACETSVTTGLVLVSGEITTNCYVDIPSTVRQTIREIGYTRAKYGFDADTCAVLTSIGEQSADIALGVDRALEAKNGEMSEEEIEAIGAGDQGMMFGYATNETESYMPLAIDLAHRLARRLSEVRKSDILDYLRPDGKTQVTVEYEDNRPVRIDTIVISTQHHPEATQERIRRDLLEHVVFPVVPSELLDESTRYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLAERCEIQLAYAIGVAQPVSVLVETFGTAKIDEEKIGELVKNNFDLRPAGIIKTLNLRRPIYRQTAAYGHFGRTDLDLPWEKTDK 389
>gi|15615862|ref|NP_244166.1| S-adenosylmethionine synthetase [Bacillus halodurans C-125] >gi|20138752|sp|Q9K7Q9|METK_BACHD S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|10175923|dbj|BAB07019.1| S-adenosylmethionine synthetase [Bacillus halodurans C-125] (399 aa)
Score = 918, Expect = 5.2e-97, Identities = 177/365 (48%), Positives = 256/365 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADS-QNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R++ TSESV +GHPDKICDQISD++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        ++++++ QS +I   V +                IGAGDQG+++GYA +E    MPLPI+++H L +   +      + +++ D K+QVT++Y ++ Q+ +ID I++S QH    T E IES     +I  VV +  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LA KCEVQL++AIG +KP++ ++DTFGT + S+ ++ E++   FD      I+  ++R PIY   + YGHFGRT++   WEQ DK E
  S:     7 RRLFTSESVTEGHPDKICDQISDSILDEILKEDPNARVACETSVTTGLVLVAGEITTSTYVDIPKVVRDTIRNIGYTRAKYGFDSETCAVLTSIDEQSPDIAQGVNQALEAREGQMTDAEIEAIGAGDQGLMFGYANNETPELMPLPISLSHKLARRLSEARKGEILPYLRPDGKTQVTVEYDENDQSVRIDTIVISTQHHPEVTLEQIESDLKQHVIRSVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLADKCEVQLAYAIGVAKPVSISIDTFGTGQVSEARLVELVREHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVELPWEQTDKAE 393
>gi|192809034|ref|ZP_03037709.1| Methionine adenosyltransferase [Geobacillus sp. Y412MC10] >gi|192801705|gb|EDV78210.1| Methionine adenosyltransferase [Geobacillus sp. Y412MC10] (401 aa)
Score = 917, Expect = 6.9e-97, Identities = 180/369 (48%), Positives = 260/369 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT-AGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKICDQISDAVLD  L  DPN++VACEV  A  L+++ GEI+T + YVD+  +  N +  +GY       D +   +++++N QS +I   V             ++   IGAGDQG+++G+AT+E    MPLPI ++H + +   +V  +  +D+++ D K+QVTI+Y  +   ++D I++S QH++ AT E I+      +I  VV    L+++ K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA KCE+QL++AIG + P++ +VDT+GT K S+E++ E++ N FD      I   ++R PIY   + YGHFGRT+L+  WE++DK E + E
  S:     6 RRLFTSESVTEGHPDKICDQISDAVLDAFLANDPNARVACEVSVATGLVLVIGEISTKSEYVDIPSIVRNTVKEIGYTRAKYGFDSNTCAVLTSLNEQSADIAQGVNAALENRDPSQVDKETENIGAGDQGLMFGFATNETPELMPLPIALSHRIARRLSEVRKDGTLDYLRPDGKTQVTIEYDGNTPVRVDTIVVSTQHAEEATLEQIQKDIKEQVILPVVPAELLDAETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNLVAAGLADKCEIQLAYAIGVANPVSISVDTYGTGKVSEEKLVELVRNNFDLRPAGIIRMLDLRRPIYKQTAAYGHFGRTDLDLPWERVDKAEALKE 396
>gi|194017784|ref|ZP_03056393.1| methionine adenosyltransferase [Bacillus pumilus ATCC 7061] >gi|194010436|gb|EDW20009.1| methionine adenosyltransferase [Bacillus pumilus ATCC 7061] (400 aa)
Score = 915, Expect = 1.0e-96, Identities = 176/367 (47%), Positives = 256/367 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K   + +  +GY  + +        ++++++ QS +I   V+K              + IGAGDQG+++G+A +E E  MPLPI++AH L     +V  +  + +++ D K+QVT++Y D   P +ID +++S QH+   T E I+S     +I  VV    ++   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA  CEVQL++AIG ++P++ ++DTFGT K S+E++ E++   FD      I+  ++R PIY   + YGHFGR +L+  WE+ DK + +
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRDTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAQGVDKALEAREGTMTEEELDAIGAGDQGLMFGFANNETEELMPLPISLAHKLSLRLTEVRKDQTLAYLRPDGKTQVTVEYDDQNKPVRIDTVVISTQHAPEVTLEQIQSDLKEHVISPVVPSELIDEQTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISIDTFGTGKASEEKLIEVVRANFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDLDLPWEKTDKADTL 393
>gi|157693442|ref|YP_001487904.1| S-adenosylmethionine synthetase [Bacillus pumilus SAFR-032] >gi|167011751|sp|A8FGH7|METK_BACP2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157682200|gb|ABV63344.1| methionine adenosyltransferase [Bacillus pumilus SAFR-032] (400 aa)
Score = 915, Expect = 1.0e-96, Identities = 176/367 (47%), Positives = 256/367 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K   + +  +GY  + +        ++++++ QS +I   V+K              + IGAGDQG+++G+A +E E  MPLPI++AH L     +V  +  + +++ D K+QVT++Y D   P +ID +++S QH+   T E I+S     +I  VV    ++   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA  CEVQL++AIG ++P++ ++DTFGT K S+E++ E++   FD      I+  ++R PIY   + YGHFGR +L+  WE+ DK + +
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRDTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAQGVDKALEAREGTMTEEELDAIGAGDQGLMFGFANNETEELMPLPISLAHKLSLRLTEVRKDQTLAYLRPDGKTQVTVEYDDQNKPVRIDTVVISTQHAPEVTLEQIQSDLKEHVISPVVPSELIDEQTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISIDTFGTGKASEEKLIEVVRANFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDLDLPWEKTDKADTL 393
>gi|23099769|ref|NP_693235.1| S-adenosylmethionine synthetase [Oceanobacillus iheyensis HTE831] >gi|29611812|sp|Q8EP05|METK_OCEIH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|22777999|dbj|BAC14270.1| S-adenosylmethionine synthetase [Oceanobacillus iheyensis HTE831] (398 aa)
Score = 915, Expect = 1.1e-96, Identities = 181/372 (48%), Positives = 253/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           R++ TSESV +GHPDK+ DQISDA+LDE LK+DPN++VACE      L+++ GEI+T+ YVD+  +    +  +GY  + +        +++ ++ QS +I   V             E+ + IGAGDQG+++GYA DE E  MPLPI++AH L K    V     +D+++ D K+QVT++Y ++  P +ID I++S QH      E IE      +I  VV    L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LAK CEVQL++AIG ++P++ AV+TFGT K S++++ E +   FD      I   ++R PIY   + YGHFGR ++   WE+ DK EE++  TK
  S:     5 RRLFTSESVTEGHPDKMSDQISDAILDEILKKDPNARVACETTVTTGLVLVSGEISTSTYVDIPALVRETVKEIGYTRAKYGFDFETCAVLTAIDEQSADIAGGVNQALEARQGKMSEEEIDAIGAGDQGLMFGYACDETEELMPLPISLAHQLSKRLADVRKEGIVDYLRPDGKTQVTVEYDENDKPERIDTIVISTQHHSEIQNEQIERDMIEKVIQAVVPSELLDDKTKYFINPTGRFVIGGPQGDVGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAKSCEVQLAYAIGVAQPVSIAVNTFGTGKVSEDRLVEAVRELFDLRPAGIIRMLDLRKPIYKNTAAYGHFGRKDILFPWEKTDKTEELIALTK 398
>gi|160945625|ref|ZP_02092851.1| hypothetical protein FAEPRAM212_03154 [Faecalibacterium prausnitzii M21/2] >gi|158443356|gb|EDP20361.1| hypothetical protein FAEPRAM212_03154 [Faecalibacterium prausnitzii M21/2] (384 aa)
Score = 915, Expect = 1.2e-96, Identities = 176/367 (47%), Positives = 256/367 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQIG-AGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKICDQISDA+LDE L  DPN++VACE  A+  L+ I GEITT  YVD  K+   V+  +GY  + +        +ISN++ QS +I  A+  ++Q+G AGDQG+++GYA DE    MP+PI++AH L K   +V  + ++D+++ D KSQVT++Y ++  P ++D +++S QHS++ + E + +     +I   +    L+ + K  IN +G+F +GGP GDTGLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LAK+CEVQ+++AIG +KP++  VDTFGT   +DE+I + +   FD +  + I   ++R PIY   + YGH GR +L   WE  D+V+ +
  S:     3 RHLFTSESVTEGHPDKICDQISDAILDEILTHDPNARVACETCASTGLVHIMGEITTNCYVDFQKVVREVVADIGYTRAKYGFDADTCAVISNIDGQSPDI--ALGTNDQVGGAGDQGMMFGYACDETPELMPMPISLAHKLAKRLTEVRKSGEMDYLRPDGKSQVTVEYDENNKPVRVDAVVISSQHSESVSMEQLRADVMEKVIKATIPAELLDENTKYYINPTGRFVVGGPQGDTGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLAKQCEVQVAYAIGVAKPVSIMVDTFGTGTVADEKIEQAVEKVFDLTPAAIIRDLDLRKPIYRQLAAYGHMGREDLGVKWENTDRVDAL 377
>gi|149181467|ref|ZP_01859963.1| S-adenosylmethionine synthetase [Bacillus sp. SG-1] >gi|148850868|gb|EDL65022.1| S-adenosylmethionine synthetase [Bacillus sp. SG-1] (399 aa)
Score = 914, Expect = 1.5e-96, Identities = 175/367 (47%), Positives = 259/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LD  L  DPN++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V             E+ + IGAGDQG+++G+A +E +  MPLPI++AH + +   +V  +  + +++ D K+QVT++Y ++  P +ID I++S QH    + E I+ +    +ID VV K  ++ D K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA KCEVQL++AIG ++P++ ++DTFGTS  S+E + E++ N FD      I+  ++R PIY   + YGHFGR++L+  WE+ DK E +
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDAILTNDPNARVACETSVTTGLVLVAGEITTSTYVDIPKIVRETIRGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMSDEEIDAIGAGDQGLMFGFACNETKELMPLPISLAHKISRRLTEVRKDDVLPYLRPDGKTQVTVEYDENDKPVRIDTIVISTQHHPEVSLERIQRNLKEYVIDPVVPKELIDEDTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNLVAAGLADKCEVQLAYAIGVAQPVSISIDTFGTSDVSEETLIEVVRNNFDLRPAGIIKMLDLRRPIYQQTAAYGHFGRSDLDLPWERTDKAEAL 393
>gi|169829682|ref|YP_001699840.1| S-adenosylmethionine synthetase [Lysinibacillus sphaericus C3-41] >gi|168994170|gb|ACA41710.1| S-adenosylmethionine synthetase [Lysinibacillus sphaericus C3-41] (398 aa)
Score = 914, Expect = 1.6e-96, Identities = 179/370 (48%), Positives = 256/370 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R++ TSESV +GHPDKICDQISDA+LD  L +DPN++VACE      L+++ GEITT+ YVD+  +  + +  +GY       D  +  ++  +  QS +I   V++                IGAGDQG+++GYA +E    MPLPI++AH L +   +V  + ++ +++ D K+QVTI+Y D+  P ++D I++S QH + AT E I++     +I  VV    L+++ K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++ EVQL++AIG ++P++ AVDTFGT K ++ +I E +   FD      I+  ++R PIY   + YGHFGRT++N  WEQ DK + +
  S:     1 MTNRRLFTSESVTEGHPDKICDQISDAILDAILAEDPNARVACETTVTTGLVLVAGEITTSTYVDIKGIVRDTVAEIGYTRGKYGFDAENLAVLVAIGEQSPDIAQGVDQALEAREGSMTDADIEAIGAGDQGLMFGYACNETPELMPLPISLAHKLARRLTEVRKSGELAYLRPDGKTQVTIEYDDNNVPVRVDTIVISTQHDEEATLEQIQADLKQFVIAPVVPSELLDTNTKYFINPTGRFVIGGPKGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAERAEVQLAYAIGVAQPVSIAVDTFGTGKVTESKIVEWVRELFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVNVPWEQTDKADAL 392
>gi|172058292|ref|YP_001814752.1| methionine adenosyltransferase [Exiguobacterium sibiricum 255-15] >gi|171990813|gb|ACB61735.1| Methionine adenosyltransferase [Exiguobacterium sibiricum 255-15] (402 aa)
Score = 912, Expect = 2.5e-96, Identities = 176/374 (47%), Positives = 257/374 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           R++ TSESV +GHPDKICDQISD++LD  L  DPN++VA E      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V             E+ + IGAGDQG+++GYAT E    MPLPI+++H L +   +V  N ++D+++ D K+QVT++Y ++  P ++D I++S QH++  T E I++     +I  V+    +++D K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA K EVQL++AIG + P++ AVDTFGT K  + Q+ E++   FD      I   ++R PIY   + YGHFGRT++   WEQ DK   + E  K++
  S:     6 RRLFTSESVTEGHPDKICDQISDSILDAILAADPNARVAAETSVTTGLVLVAGEITTSTYVDIPKVVRETIREIGYTRAKYGFDADTCAVLTSIDEQSADIALGVDQALEAREGNMSDEEIDAIGAGDQGLMFGYATKETPELMPLPISLSHKLARRLAEVRKNGQLDYLRPDGKTQVTVEYNENNEPVRVDTIVISTQHAEEVTLEQIQADLKEHVIAPVIPTEYIDADTKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNLVAAGLADKAEVQLAYAIGVAHPVSIAVDTFGTGKLPEAQLVELVAENFDLRPAGIINMLDLRRPIYRQTAAYGHFGRTDIELPWEQTDKAATLEEQAKRF 401
>gi|171326270|ref|ZP_02914755.1| Methionine adenosyltransferase [Geobacillus sp. WCH70] >gi|171087751|gb|EDT34117.1| Methionine adenosyltransferase [Geobacillus sp. WCH70] (403 aa)
Score = 912, Expect = 2.6e-96, Identities = 175/369 (47%), Positives = 259/369 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKICDQISDA+LD  L++DPN++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        ++++++ QS +I   V+K                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    T+E IE      +I  +V    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVA+ LA KCEVQL++AIG ++P++ ++DTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK E + E
  S:     5 RRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDKALEAREGQMTDEEIEAIGAGDQGLMFGFACNETKELMPLPISLAHRLARRLSEVRKEAILPYLRPDGKTQVTVEYDENGKPVRIDTIVVSAQHHPEITQEQIERDIKEHVIKPIVPAELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVASGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAETLKE 395
>gi|89210635|ref|ZP_01189022.1| S-adenosylmethionine synthetase [Halothermothrix orenii H 168] >gi|89159733|gb|EAR79394.1| S-adenosylmethionine synthetase [Halothermothrix orenii H 168] (402 aa)
Score = 912, Expect = 2.9e-96, Identities = 179/370 (48%), Positives = 258/370 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK---------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRI-INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R + TSESV +GHPDKI DQISDAVLDE L +D  ++VACE F    L+++ GEI+T  YVDV  +A   +  +GYD + +       ++++ ++ QS +I   V+K         +NQ+GAGDQG+++GYA +E    MPLPI +AH L +   +V     + +++ D K+QVT++Y D +  +ID++++S QH  + +   I E     +I++++ + NL  D   I +N +G+F IGGP GDTGLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++  VDTFGT K S + + ++I   FD    S I   ++R PIYS  + YGHFGR++L+  WE+ DK E +
  S:     1 MGRRYLFTSESVTEGHPDKIADQISDAVLDEILSKDSQARVACETFVTTGLVLVSGEISTDCYVDVPHIARETIKKIGYDRAKYGFDGDTCSVLTAIDEQSPDIAIGVDKSLESKVGIDENQLGAGDQGLMFGYACNETPELMPLPIILAHKLARRLAEVRKKGILPYLRPDGKTQVTVEYEDDRPVRIDKVLVSAQHHPDISSTQIKEDITRHVINYIIDE-NLRDDRTEILVNPTGRFVIGGPHGDTGLTGRKIIVDTYGGIARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADRCEVQLAYAIGVARPVSIMVDTFGTGKVSHDILVKLINENFDLRPASIIRNLDLRKPIYSKVAKYGHFGRSDLDLTWERTDKSEAL 387
>gi|116494386|ref|YP_806120.1| S-adenosylmethionine synthetase [Lactobacillus casei ATCC 334] >gi|191637722|ref|YP_001986888.1| S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) [Lactobacillus casei] >gi|122264188|sp|Q03AU4|METK_LACC3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116104536|gb|ABJ69678.1| methionine adenosyltransferase [Lactobacillus casei ATCC 334] >gi|190712024|emb|CAQ66030.1| S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) [Lactobacillus casei BL23] (394 aa)
Score = 912, Expect = 2.9e-96, Identities = 177/373 (47%), Positives = 262/373 (70%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY------DESDFTIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M+ R + TSESV +GHPDKI DQISDA+LD  L+QDP+S+VACE      L+++ GEI+T  YVD+  +    +  +GY      D     ++  ++ QS +I   V++            ++IGAGDQG+++G+A DE EN+MPLPI++AH L++  + +    +I +++ D K+QVT++Y D  NP ++D +++SVQH  + T E I     A II  V+ +  ++ D K  +N +G+F +GGP  D+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LAK+ EVQL++AIG +KP++ +V+TFGTS  S++ I + I   FD      I+  +++ PIY   + YGHFGRT+++  WE LDKV+ +L++
  S:     1 MQERHLFTSESVSEGHPDKIADQISDAILDAMLEQDPDSRVACETTVTTGLVLVVGEISTKAYVDIQSVVRGTIKKIGYTKESGFDPDSVGVLVALDEQSPDIAQGVDESLEARESDTDPLDKIGAGDQGMMFGFAIDETENYMPLPISLAHALMRKTDSLRHKGEISYLRPDAKAQVTVEYDDDDNPIRVDSVVVSVQHDPDVTLEEIRRDVEAKIIRTVIPEALMDDDTKIYVNPTGRFVLGGPQADSGLTGRKIIVDTYGGFARHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLAKRVEVQLAYAIGVAKPVSVSVNTFGTSAVSEDVIEQAIRENFDLRPAGIIKMLDLKRPIYEQTAAYGHFGRTDVDLPWEHLDKVQALLKY 392
>gi|20806993|ref|NP_622164.1| S-adenosylmethionine synthetase [Thermoanaerobacter tengcongensis MB4] >gi|22095882|sp|Q8RCE4|METK_THETN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|20515476|gb|AAM23768.1| S-adenosylmethionine synthetase [Thermoanaerobacter tengcongensis MB4] (395 aa)
Score = 911, Expect = 3.1e-96, Identities = 170/366 (46%), Positives = 256/366 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           +R++ TSESV +GHPDKICDQISDA+LDE LK+DP ++VACE      L+++ GEITT  YVD+ ++A +V+  +GY  + +        +I++++ QS +I   V K                IGAGDQG++ G+A DE E  MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  ++D +++S QH+     ++IE      +++ ++ +  ++ + K  +N +G+F +GGP  D+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LAKKCEVQ+++AIG + P+   ++TFGT K SDE+I EI+   FD    + I   ++R PIY   + YGHFGR +L+  WE+ D+V+
  S:     1 MRRLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAVTTGLVLVMGEITTECYVDIPRIARDVIRDIGYTRAKYGFDADTCAVITSIDEQSPDIAMGVNKALEARRGELTDAEIEAIGAGDQGLMIGFACDETEELMPMPIMLAHKLARRLAEVRKNGTLSYLRPDGKTQVTVEYEEDRPVRVDSVVVSAQHAPEVDHDTIEKDIIEHVVNVIIPENMMDKNTKIFVNPTGRFVLGGPQADSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLAKKCEVQVAYAIGVATPLEVEINTFGTGKISDEKISEIVKKVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDRVD 387
>gi|16080107|ref|NP_390933.1| S-adenosylmethionine synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|6166547|sp|P54419|METK_BACSU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|2293164|gb|AAC00242.1| SAM synthase [Bacillus subtilis] >gi|2635539|emb|CAB15033.1| S-adenosylmethionine synthetase [Bacillus subtilis subsp. subtilis str. 168] (400 aa)
Score = 911, Expect = 3.3e-96, Identities = 174/367 (47%), Positives = 260/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K     +  +GY  + +        ++++++ QS +I   V             E+   IGAGDQG+++GYA +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    T E I+ +    +I+ VV +  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA+LA  CEVQL++AIG ++P++ +++TFG+ K S+E++ E++ N FD      I+  ++R PIY   + YGHFGR +++  WE+ DK E++
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRQTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGTMSDEEIEAIGAGDQGLMFGYACNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKTQVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNIKEHVINPVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAELADSCEVQLAYAIGVAQPVSISINTFGSGKASEEKLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDVDLPWERTDKAEQL 393
>gi|56421384|ref|YP_148702.1| S-adenosylmethionine synthetase [Geobacillus kaustophilus HTA426] >gi|60389890|sp|Q5KW02|METK_GEOKA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56381226|dbj|BAD77134.1| S-adenosylmethionine synthetase [Geobacillus kaustophilus HTA426] (403 aa)
Score = 910, Expect = 4.1e-96, Identities = 175/369 (47%), Positives = 258/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKICDQISDA+LD  L++DPN++VACE      L+++ GEITT+ YVD+ ++  + +  +GY  + +        ++++++ QS +I   V             E+   IGAGDQG+++G+A +E E  MP+PI++AH L +   +V     + +++ D K+QVTI+Y ++  P ++D I++S QH    T+E I+      +I  VV    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCEVQL++AIG ++P++ ++DTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDRALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPMPISLAHRLARRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVVSAQHHPEITQEQIQRDIKEQVIKPVVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAALLKE 395
>gi|124521724|ref|ZP_01696581.1| S-adenosylmethionine synthetase [Bacillus coagulans 36D1] >gi|124496585|gb|EAY44174.1| S-adenosylmethionine synthetase [Bacillus coagulans 36D1] (403 aa)
Score = 909, Expect = 5.6e-96, Identities = 176/374 (47%), Positives = 258/374 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           R + TSESV +GHPDKICDQISDA+LD  L++DPN++VACE      L+++ GEI+T  YVD+ K+    +  +GY  + +        ++++++ QS +I   V             E+   IGAGDQG+++G+A +E E  MPLPI++AH L +   ++     I +++ D K+QVT++Y ++  P +ID I++S QH  + +   I E     +I+ VV  + L++D K +IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+KCEVQL++AIG +KP++ ++DTFGT K  ++ + E +   FD      I+  ++R PIY   + YGHFGR +L+  WE+ DK   + EF + +
  S:     5 RHLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVTGEISTNTYVDIPKVVRKTIKEIGYTRAKYGFDAETCAVLTSIDEQSEDIARGVNQALEAREGGMSDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHKLARRLAELRKQEVIPYLRPDAKTQVTVEYDENNQPARIDTIVISTQHDPDTSAGQIQEDMKKYVIEPVVPAHLLDADTKYLINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKCEVQLAYAIGVAKPVSISIDTFGTGKVPEKVLIEAVEAHFDLRPAGIIKMLDLRRPIYRQIAAYGHFGRDDLDVPWEKTDKAGALNEFARNH 400
>gi|167767536|ref|ZP_02439589.1| hypothetical protein CLOSS21_02055 [Clostridium sp. SS2/1] >gi|167710828|gb|EDS21407.1| hypothetical protein CLOSS21_02055 [Clostridium sp. SS2/1] (393 aa)
Score = 908, Expect = 6.6e-96, Identities = 175/363 (48%), Positives = 255/363 (70%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDKICDQISDA+LD  L+QDP S+VACE      ++++ GEI+T  YVD+ K+  + +  +GY       D     +I+ ++ QS++I   V+K              + IGAGDQG+++G+AT+E E +MP PI++AH L +   +V  +  + +++ D K+QVT++Y D +  ++D +++S QH  + T+E I E     + D ++    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LA KCE+QLS+AIG ++P +  VDTFGT K S++++ ++I   FD      I+  ++R PIY   + YGHFGR +L+  WE+LDKV+
  S:     5 LFTSESVTEGHPDKICDQISDAILDALLEQDPMSRVACETCTTTGIVMVMGEISTKAYVDIQKIVRDTVREIGYTRGKYGFDADTCGVITTIDEQSSDIAMGVDKALEAKENNMTDEEIDAIGAGDQGMMFGFATNETEEYMPYPISLAHKLSRQLTKVRKDGTLSYLRPDGKTQVTVEYDDGKPSRLDAVVLSTQHDPDITQEQIHEDIKREVFDKILPADMVDDETKFFINPTGRFVIGGPHGDAGLTGRKIIVDTYGGYARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVAEPTSIMVDTFGTGKKSNQELVDLIRKHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRNDLDLPWERLDKVD 388
>gi|71894620|ref|YP_278728.1| S-adenosylmethionine synthetase [Mycoplasma synoviae 53] >gi|109892641|sp|Q4A5F4|METK_MYCS5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71851408|gb|AAZ44017.1| S-adenosylmethionine synthetase [Mycoplasma synoviae 53] (382 aa)
Score = 908, Expect = 8.3e-96, Identities = 181/376 (48%), Positives = 258/376 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAV--EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF--TKKYN 378
           ++K+ TSESVG+GHPDKICDQISDA+LD  L  DP+SKVA E   +   + I GE+ +   VDV+++A NVL  +GY  ++ + I+++ SQS  I   V  +  + +GAGDQG ++GYAT+E   +MPL I + + +V  A  +I N +    K DMK+QVT+DY+D QN K+D II S  H++   +   +++    I+  V+ ++NL    + +IN +GKF IGGP  DTGLTGRK++VDTYG  A+HGGGAFSGKD TK+DRSGAY AR+IAKN+VAA +A K EVQ++++IG +KP++  V+TFG +K  ++ + + I+N F+ + K  I+  N+  PIY   S YGHFGR +    WE LDKVE I EF  +K +N
  S:     1 MKKLFTSESVGRGHPDKICDQISDAILDAYLTWDPHSKVAVETMVSGNNVFIAGEVKSKVTVDVIEIAKNVLRNIGYYSNNTSFITDIKSQSENIAMGVNLQDSDDLGAGDQGFMFGYATNETSQYMPLGITLCNKIVSRAGMLIKNQEFKDAKEDMKTQVTLDYSDPQNVKVDTIIFSCHHNEKYNETKFKNYIKTQILKPVLDEFNLELPERILINPTGKFVIGGPFSDTGLTGRKIIVDTYGGSARHGGGAFSGKDATKLDRSGAYMARWIAKNLVAANIADKIEVQIAYSIGVAKPVSVMVNTFGENKVPEDVVLDAILNNFELTPKGIIKSLNLNKPIYQKSSVYGHFGREDFQFTWESLDKVEAIREFVISKGFN 381
>gi|163763662|ref|ZP_02170723.1| Methionine adenosyltransferase [Bacillus selenitireducens MLS10] >gi|160355982|gb|EDP82634.1| Methionine adenosyltransferase [Bacillus selenitireducens MLS10] (404 aa)
Score = 907, Expect = 9.2e-96, Identities = 173/369 (46%), Positives = 260/369 (70%)
  Q:     2 ELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           E  ++ TSESV +GHPDKICDQISDA+LD  +K DPN++VACE      L+++ GEI+T+ YVD+ K     L  +GY  + +        ++++++ QS +I   V++          D++I   GAGDQG+++GYA ++ E  MPLPI+++H L +   +V  +  +++++ D K+QVT++Y ++ +P +ID +++S QHS   T E I+      +I+ V+  + L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ AVDT GT K S++ + +++ N FD      I+  ++R PIY   + YGHFGRT+++  WE  D+ E +
  S:     3 EKTRLFTSESVTEGHPDKICDQISDAILDAIVKNDPNARVACETTVNTGLVLVAGEISTSTYVDIPKTVRETLSGIGYTRAKYGFDSETCAVLTSIDEQSADIAQGVDRALEAREGQMTDDEIEAIGAGDQGLMFGYADNQTEELMPLPISLSHKLARRLTEVRKDGTLNYLRPDGKTQVTVEYGENHHPIRIDTVVISSQHSDKVTLEKIQKDIEEHVINPVIPSHLLDEKTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADRCEVQLAYAIGVAQPVSIAVDTLGTGKVSEDVLVQVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWEATDRAETM 393
>gi|126697702|ref|YP_001086599.1| S-adenosylmethionine synthetase [Clostridium difficile 630] >gi|145956047|ref|ZP_01805044.1| hypothetical protein CdifQ_04000145 [Clostridium difficile QCD-32g58] >gi|168696089|ref|ZP_02728366.1| S-adenosylmethionine synthetase [Clostridium difficile QCD-37x79] >gi|168714313|ref|ZP_02746590.1| S-adenosylmethionine synthetase [Clostridium difficile QCD-63q42] >gi|168725506|ref|ZP_02757783.1| S-adenosylmethionine synthetase [Clostridium difficile QCD-76w55] >gi|168733377|ref|ZP_02765654.1| S-adenosylmethionine synthetase [Clostridium difficile QCD-97b34] >gi|196127045|ref|ZP_03118794.1| S-adenosylmethionine synthetase [Clostridium difficile ATCC 43255] >gi|196159387|ref|ZP_03119948.1| S-adenosylmethionine synthetase [Clostridium difficile CIP 107932] >gi|123174677|sp|Q18CL7|METK_CLOD6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|115249139|emb|CAJ66950.1| S-adenosylmethionine synthetase [Clostridium difficile 630] (397 aa)
Score = 907, Expect = 1.0e-95, Identities = 167/367 (45%), Positives = 257/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKICDQISD++LD  L++DP S+VACE      L+++ GEI+T+ YVD+ K+    +  +GY  + +        +I++++ QS +I   V++               ++GAGDQG+++G+A +E    MPLPI++AH L +   +V     +D+++ D K+QVT++Y  S+  ++  +++S QH +  + + I E   N +I  V+    L+ + K  IN +G+F IGGP GDTGLTGRK+++DTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCE++L++AIG ++P++  +DTFGT K S+E++ E++   FD    + I   ++R P+Y   + YGHFGRT+++  WE+ DKVE++
  S:     3 RHLFTSESVTEGHPDKICDQISDSILDALLEKDPQSRVACETTVTTGLVLVAGEISTSAYVDIPKLVRETVREIGYTRAKYGFDCDTCAVITSIDEQSGDIAMGVDEGLESKTGEEIEEEIEKVGAGDQGIMFGFACNETPELMPLPISLAHKLSRRLTEVRKTGLVDYLRPDGKTQVTVEYEGSKAVRVHTVLISAQHCETVSNDKIREDLINHVIKEVIPAELLDEETKIYINPTGRFVIGGPQGDTGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGIARPLSIFIDTFGTGKVSEEKLVELVNKHFDLRPGAIIRDLDLRKPLYKKVAAYGHFGRTDIDLPWERTDKVEQL 390
>gi|116094702|gb|ABJ59854.1| methionine adenosyltransferase [Lactobacillus gasseri ATCC 33323] (412 aa)
Score = 905, Expect = 1.5e-95, Identities = 177/374 (47%), Positives = 261/374 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV-----------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +++ TSESV +GHPDK+ DQISDA+LD  L +DPN +VACE      L+++ GEI+T+ YVD+  +    ++ +GY       D ++  I+ +++ QS++I   V           +KD+  +IGAGDQG+++G+A  E    MPLPI++AH L++    +    ++D+++ D K+QVT++Y D   PK +D +++S Q     T + I     A+ID V+KK      L+ + K +IN SG+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CE+QL++AIG + P++  VDT GTSK S++ + E + N FD      IE  N+R PIY   + YGHFGRT+++  WE  DKVE + ++  ++
  S:    15 KRLFTSESVSEGHPDKVADQISDAILDAILAKDPNGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNRPELGFDGNNCAILVDIDEQSSDIAGGVNESLETRENHEDKDDLDKIGAGDQGLMFGFAIKETPELMPLPISLAHSLMRRVASLRKEGRLDWLRPDAKAQVTVEYDDDNKPKRVDTVVISTQTDPTVTNDEIRE---AMIDMVIKKVIPSQYLDENTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDLTKVDRSASYAARYVAKNIVAADLAYQCEIQLAYAIGVAHPVSIMVDTHGTSKVSEDLLVEAVRNVFDLRPAGIIEMLNLRRPIYRQTAAYGHFGRTDIDLPWEHTDKVEALKKYVSEH 410
>gi|162139890|ref|YP_814292.2| S-adenosylmethionine synthetase [Lactobacillus gasseri ATCC 33323] (402 aa)
Score = 905, Expect = 1.8e-95, Identities = 177/374 (47%), Positives = 261/374 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV-----------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +++ TSESV +GHPDK+ DQISDA+LD  L +DPN +VACE      L+++ GEI+T+ YVD+  +    ++ +GY       D ++  I+ +++ QS++I   V           +KD+  +IGAGDQG+++G+A  E    MPLPI++AH L++    +    ++D+++ D K+QVT++Y D   PK +D +++S Q     T + I     A+ID V+KK      L+ + K +IN SG+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CE+QL++AIG + P++  VDT GTSK S++ + E + N FD      IE  N+R PIY   + YGHFGRT+++  WE  DKVE + ++  ++
  S:     5 KRLFTSESVSEGHPDKVADQISDAILDAILAKDPNGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNRPELGFDGNNCAILVDIDEQSSDIAGGVNESLETRENHEDKDDLDKIGAGDQGLMFGFAIKETPELMPLPISLAHSLMRRVASLRKEGRLDWLRPDAKAQVTVEYDDDNKPKRVDTVVISTQTDPTVTNDEIRE---AMIDMVIKKVIPSQYLDENTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDLTKVDRSASYAARYVAKNIVAADLAYQCEIQLAYAIGVAHPVSIMVDTHGTSKVSEDLLVEAVRNVFDLRPAGIIEMLNLRRPIYRQTAAYGHFGRTDIDLPWEHTDKVEALKKYVSEH 400
>gi|27262362|gb|AAN87462.1| S-adenosylmethionine synthetase [Heliobacillus mobilis] (397 aa)
Score = 904, Expect = 2.4e-95, Identities = 170/370 (45%), Positives = 258/370 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R++ TSESV +GHPDK+ DQISDAVLD    QDP ++VACE      L+++ GEITT  YVD+ K+    +  +GY  + F        ++++++ QS +I   V+K          D++I   GAGDQG+++GYAT+E   FMP+P+++AH L +   +V    ++++++ D K+QVT++Y   +  ++D +++S QHS   + E+I+S     +I  ++ +  L+   + +IN +G+F IGGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA +CE+Q+++AIG + P++  V+TFGT K  + +I E +   FD      I++ ++R PIY   + YGHFGR +L+  WE+LDKVE +
  S:     1 MNRRRLFTSESVTEGHPDKVADQISDAVLDAIFTQDPMARVACETSVTTGLVLVAGEITTQCYVDIPKVVRQTIREIGYTRAKFGFDCETCAVLTSIDEQSADIAMGVDKALEAKTGEMSDSEIEAIGAGDQGMMFGYATNETPEFMPMPVSLAHKLSRRLSEVRKTGELEYLRPDGKTQVTVEYDGDKPVRVDTVVISTQHSPEVSLETIKSDLIERVILPIIPRELLDEKTRYLINPTGRFVIGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLADRCEIQIAYAIGVAHPVSVMVETFGTGKVDEAKIEEWVKQVFDLRPAGIIKELDLRRPIYRQTAAYGHFGRNDLDLPWERLDKVEAL 391
>gi|196250015|ref|ZP_03148710.1| Methionine adenosyltransferase [Geobacillus sp. G11MC16] >gi|196210529|gb|EDY05293.1| Methionine adenosyltransferase [Geobacillus sp. G11MC16] (404 aa)
Score = 903, Expect = 3.0e-95, Identities = 176/369 (47%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKICDQISDA+LD  L++DPN++VACE      L+++ GEITT+ YVD+ ++  + +  +GY  + F        +++ ++ QS +I   V             E+   IGAGDQG+++G+A +E E  MPLPI++AH L +   +V     + +++ D K+QVTI+Y ++  P ++D I++S QH      + IE      +I  +V    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCEVQL++AIG ++P++ ++DTFGT K S++ + E++ N FD      I+  ++R PIY   S YGHFGRT+++  WE+ DK   + E
  S:     5 RRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKFGFDADTCAVLTAIDEQSPDIAMGVDQALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLSRRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVISTQHHPEIEHDQIERDMKEHVIKPIVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDVLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTSAYGHFGRTDVDLPWERTDKATVLKE 395
>gi|125974736|ref|YP_001038646.1| methionine adenosyltransferase [Clostridium thermocellum ATCC 27405] >gi|158513254|sp|A3DHM4|METK_CLOTH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|125714961|gb|ABN53453.1| methionine adenosyltransferase [Clostridium thermocellum ATCC 27405] (397 aa)
Score = 902, Expect = 3.4e-95, Identities = 175/367 (47%), Positives = 252/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           RK+ TSESV +GHPDKICDQISDAVLD    QDP ++VACE      L+++ GEITT  YVD+ K+  + +  +GYD + +        ++++++ QS +I   V             E+   IGAGDQG+++G+A DE    MP+PI++AH L     QV  N  +++++ D KSQVT++Y   +  ++D +++S QH      ++I+      +I  V+    L+S  K ++N +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+KCEVQL++AIG ++P++  VDTFGT    +E+I  ++   FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK EE+
  S:     3 RKLFTSESVTEGHPDKICDQISDAVLDAIFSQDPMARVACETAVTTGLVLVTGEITTNCYVDIPKIVRSTIREIGYDRAKYGFDCDTCAVLTSIDEQSPDIAMGVNKALEAKTGEMSDEEIEAIGAGDQGMMFGFACDETPELMPMPISLAHKLAMRLSQVRKNGTLNYLRPDGKSQVTVEYDGDKPVRVDTVLISTQHGPEVDYDTIKRDVIEHVIKPVIPAELLDSKTKYLVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARKCEVQLAYAIGVARPVSVRVDTFGTGIIPEEKIESLVNKYFDLRPAGIIKTLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAEEL 390
>gi|52081541|ref|YP_080332.1| S-adenosylmethionine synthetase [Bacillus licheniformis ATCC 14580] >gi|52786920|ref|YP_092749.1| S-adenosylmethionine synthetase [Bacillus licheniformis ATCC 14580] >gi|60389937|sp|Q65FV8|METK_BACLD S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|52004752|gb|AAU24694.1| S-adenosylmethionine synthetase [Bacillus licheniformis ATCC 14580] >gi|52349422|gb|AAU42056.1| MetK [Bacillus licheniformis DSM 13] (400 aa)
Score = 902, Expect = 3.4e-95, Identities = 173/367 (47%), Positives = 257/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K     +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    + E I+ +    +I+ VV K  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA  CEVQL++AIG ++P++ ++DTFGT K S+E + E++   FD      I+  ++R PIY   + YGHFGR +L+  WE+ DK +++
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRETIKEIGYTRAKYGFDAETCAVLTSIDEQSPDIAMGVDQALEAREGAMSDAEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLSRRLTEVRKEEILPYLRPDGKTQVTVEYDENNKPIRIDTIVISTQHHPEISLEQIQRNLKEHVINPVVPKELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISIDTFGTGKASEETLIEVVRKNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRLDLDLPWERTDKADQL 393
>gi|121533705|ref|ZP_01665532.1| Methionine adenosyltransferase [Thermosinus carboxydivorans Nor1] >gi|121307696|gb|EAX48611.1| Methionine adenosyltransferase [Thermosinus carboxydivorans Nor1] (396 aa)
Score = 902, Expect = 3.6e-95, Identities = 176/368 (47%), Positives = 255/368 (69%)
  Q:     1 MELRKIM-TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           ME ++++ TSESV +GHPDKI DQISD++LD  L QDP ++VACE      L+ + GEITT+ YVD+ K+    +  +GY  + F        ++++++ QS +I   V K              IGAGDQG+++GYAT+E   FMPLPI +AH L +   +V  N ++ +++ D K+QVT++Y D +  ++D I++S QHS +    +IE      +I  VV    L++  K  IN +G+F +GGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA KCE+QL++AIG ++P++  V+TFGT+K ++ +I E+I   FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK E
  S:     1 MEKKRVLFTSESVTEGHPDKIADQISDSILDAILAQDPMARVACETLVTTGLVHVVGEITTSCYVDIPKIVRETIKEIGYTRAKFGFDGDTCGVMTSIDEQSPDIAMGVNKALEAKRGEMDEVEAIGAGDQGMMFGYATNETPEFMPLPIALAHRLARRLAEVRKNGELAYLRPDGKTQVTVEYVDGKPVRVDTIVVSAQHSPDVDLATIEKDIIAKVITPVVPGDMLDAQTKYYINPTGRFVVGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLADKCEIQLAYAIGIARPVSIMVETFGTAKIAESRIVELIQKHFDLRPAGIIKSLDLRRPIYRQTAAYGHFGRTDIDLPWERTDKAE 388
>gi|167014868|ref|ZP_02277401.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL J1-194] >gi|167214603|ref|ZP_02284910.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL R2-503] >gi|167454244|ref|ZP_02320467.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL J2-064] (407 aa)
Score = 902, Expect = 3.8e-95, Identities = 173/373 (46%), Positives = 259/373 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E++ +  +K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEDLKKINRK 399
>gi|1389732|gb|AAB17066.1| S-adenosylmethionine synthetase (400 aa)
Score = 902, Expect = 3.9e-95, Identities = 172/367 (46%), Positives = 258/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQI D++LDE LK+DPN++VACE      L+++ GEITT+ YVD+ K     +  +GY  + +        ++++++ QS +I   V             E+   IGAGDQG+++GY  +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    T E I+ +    +I+ VV +  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA+LA  CEVQL++AIG ++P++ +++TFG+ K S+E++ E++ N FD      I+  ++R PIY   + YGHFGR +++  WE+ DK E++
  S:     5 RRLFTSESVTEGHPDKICDQIYDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRQTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDPALEAREGTMSDEEIEAIGAGDQGLMFGYVCNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKTQVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNIKEHVINPVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAELADSCEVQLAYAIGVAQPVSISINTFGSGKASEEKLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDVDLPWERTDKAEQL 393
>gi|196164343|ref|ZP_03124874.1| S-adenosylmethionine synthetase [Clostridium difficile QCD-23m63] (397 aa)
Score = 902, Expect = 4.1e-95, Identities = 166/367 (45%), Positives = 257/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKICDQISD++LD  L++DP S+VACE      L+++ GEI+T+ YVD+ K+    +  +GY  + +        +I++++ QS +I   V++               ++GAGDQG+++G+A +E    MPLPI++AH L +   +V     +D+++ D K+QVT++Y  ++  ++  +++S QH +  + + I E   N +I  V+    L+ D K  IN +G+F IGGP GDTGLTGRK+++DTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVA+ LA KCE++L++AIG ++P++  +DTFGT K S+E++ E++   FD    + I   ++R P+Y   + YGHFGRT+++  WE+ DKVE++
  S:     3 RHLFTSESVTEGHPDKICDQISDSILDALLEKDPQSRVACETTVTTGLVLVAGEISTSAYVDIPKLVRETVREIGYTRAKYGFDCDTCAVITSIDEQSGDIAMGVDEGLESKTGEEIEEEIEKVGAGDQGIMFGFACNETPELMPLPISLAHKLSRRLTEVRKTGIVDYLRPDGKTQVTVEYEGNKAVRVHTVLISAQHCETVSNDKIREDLINHVIKEVIPAELLDEDTKIYINPTGRFVIGGPQGDTGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVASGLADKCEIELAYAIGIARPLSIFIDTFGTGKVSEEKLVELVNKHFDLRPGAIIRDLDLRKPLYKKVAAYGHFGRTDIDLPWERTDKVEQL 390
>gi|78043882|ref|YP_359010.1| S-adenosylmethionine synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|109892625|sp|Q3AFS4|METK_CARHZ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|77995997|gb|ABB14896.1| S-adenosylmethionine synthetase [Carboxydothermus hydrogenoformans Z-2901] (396 aa)
Score = 901, Expect = 4.9e-95, Identities = 172/365 (47%), Positives = 256/365 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R++ TSESV +GHPDKI DQISDAVLD  L QDP ++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        +I++++ QS +I   V +          D++I   GAGDQG+++GYAT+E    MP+PI++AH L +   +V  +  + +++ D K+QVT++Y   +  ++D I++S QH  + ++E I +     ++  V+ ++ L+ + +  +N +G+F IGGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA +A K E+QL++AIG +KP++  VDTFGT K +DE+I E+I   FD      I   ++R PIY   + YGHFGRT+++  WE++DK E
  S:     3 RRLFTSESVTEGHPDKIADQISDAVLDAILAQDPQARVACETAVTTGLVLVIGEITTSCYVDIPKVVRETIREIGYTRAKYGFDGDTCAVITSIDEQSPDIALGVNRALEAKTGEMTDDEIEAIGAGDQGMMFGYATNETPELMPMPISLAHRLARRLAEVRKSRLLPYLRPDGKTQVTVEYDGDKPVRVDTIVVSTQHHPDVSQEEIRKDIIEHVVKPVIPEHLLDENTRYFVNPTGRFVIGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGIADKIEIQLAYAIGVAKPVSIMVDTFGTGKIADEKIVELIKKHFDLRPAGIIRMLDLRRPIYKQTAAYGHFGRTDIDLPWERIDKAE 388
>gi|138896387|ref|YP_001126840.1| S-adenosylmethionine synthetase [Geobacillus thermodenitrificans NG80-2] >gi|158513837|sp|A4IRZ1|METK_GEOTN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|134267900|gb|ABO68095.1| S-adenosylmethionine synthetase [Geobacillus thermodenitrificans NG80-2] (404 aa)
Score = 901, Expect = 5.4e-95, Identities = 175/369 (47%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKICDQISDA+LD  L++DPN++VACE      L+++ GEITT+ YVD+ ++  + +  +GY  + F        +++ ++ QS +I   V             E+   IGAGDQG+++G+A +E E  MPLPI++AH L +   +V     + +++ D K+QVTI+Y ++  P ++D I++S QH      + IE      +I  +V    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCEVQL++AIG ++P++ ++DTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKFGFDADTCAVLTAIDEQSPDIAMGVDQALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLSRRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVISTQHHPEIEHDQIERDMKEHVIKPIVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDVLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKAAVLKE 395
>gi|167217715|ref|ZP_02287351.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL J1-175] (413 aa)
Score = 900, Expect = 5.8e-95, Identities = 173/373 (46%), Positives = 259/373 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E++ +  +K
  S:    11 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEDLKKINRK 405
>gi|168266113|ref|ZP_02688078.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL J2-071] (416 aa)
Score = 900, Expect = 6.3e-95, Identities = 173/373 (46%), Positives = 259/373 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E++ +  +K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEDVKKINRK 399
>gi|167756741|ref|ZP_02428868.1| hypothetical protein CLORAM_02288 [Clostridium ramosum DSM 1402] >gi|167702916|gb|EDS17495.1| hypothetical protein CLORAM_02288 [Clostridium ramosum DSM 1402] (380 aa)
Score = 900, Expect = 6.6e-95, Identities = 193/368 (52%), Positives = 263/368 (71%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDNQIG-AGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M+ + + TSESV KGHPDK+CDQISDA+LD CLK+DPNS+VACEVFA   L+VIGGEITT   V+  ++A +VL  +GYD+SD  I          ++ QS +I  A+  ++++G AGDQG+++GYA  E + +MPLPI+IAH LV+ A +     +    + DMK+QVTIDY +S  PKID I+MS+QH  +  +   + +    I+D VV+KYNLN+D+K +IN +G+F IGGP GDTGLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY  RYIAKNIVAA L  K E+Q+S+AIG  +P +  ++T+GT     + I + I + FD +    I+  ++R P+Y   + YGHFGR + N  WE+LDKVE
  S:     1 MKEKVLFTSESVSKGHPDKVCDQISDAILDACLKEDPNSRVACEVFATTDLVVIGGEITTTAEVNYEQVARDVLKDIGYDDSDKGIDYRTCKVQVVMDLQSPDI--ALGTNDEVGGAGDQGIMFGYACKETKGYMPLPISIAHHLVRYATEKKDTGEFKSARPDMKAQVTIDYTES-TPKIDTILMSIQHDPDFDETEFKRYIKEEIMDAVVRKYNLNTDYKVLINPTGRFVIGGPHGDTGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYMLRYIAKNIVAANLCDKLEIQVSYAIGVKEPTSIFIETYGTEHVDHDIILKAIRDNFDLTPGGIIKTLDLRQPLYLKTAAYGHFGRGDNNLPWEELDKVE 374
>gi|160932691|ref|ZP_02080080.1| hypothetical protein CLOLEP_01532 [Clostridium leptum DSM 753] >gi|156867765|gb|EDO61137.1| hypothetical protein CLOLEP_01532 [Clostridium leptum DSM 753] (455 aa)
Score = 899, Expect = 8.6e-95, Identities = 170/367 (46%), Positives = 252/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE-------SDFTIISNVNSQSNEIFNAV-----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +K+ TSESV +GHPDK+CDQISDAVLD   +QDP + VACEV A   +I + GEI+T  YVD+  +   V+  +GYD+       +   +++++++QS +I   V           + D+QIGAGDQG+++GYA DE    MPLPI++AH L K   +V     + +++ D KSQVT++Y     P +++ +++S QH    T E I E     +I  ++ +  ++ D K  +N +G+F +GGP+GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY AR++AKN+V A LA+KCE+QL++AIG ++P++  VDTFGT K  D+ + + I   FD    + I    +R PIY   + YGH GR +L   WE+L++V+E+
  S:    61 KKLFTSESVTEGHPDKVCDQISDAVLDAIFEQDPQAHVACEVTATTGMIHVMGEISTTCYVDIPAVTREVVKSIGYDDPACGFDGNTCAVLTSIDAQSPDIAMGVNESLEVKEGAGDADDQIGAGDQGMMFGYACDETPELMPLPISLAHKLSKQLAKVRKEGILTYLRPDGKSQVTVEYDGDDRPVRVEAVVVSTQHDSGVTLERIREDIQREVIRPIIPEELMDQDTKIYVNPTGRFVVGGPVGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARWVAKNVVGAGLARKCELQLAYAIGVARPVSVRVDTFGTGKLDDQLLAKAIQKVFDLRPAAIIRALKLRQPIYRSLAAYGHMGREDLGVEWEKLNRVDEL 447
>gi|116873099|ref|YP_849880.1| S-adenosylmethionine synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458518|sp|A0AJB9|METK_LISW6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116741977|emb|CAK21101.1| metK [Listeria welshimeri serovar 6b str. SLCC5334] (399 aa)
Score = 899, Expect = 8.8e-95, Identities = 174/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQL++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGSEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTKKLDYLRPDAKTQVTVEYDELNQPVRIDTIVVSTQHHPDITQEEIAKDLHTYLFPEVIDPSFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQLAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 399
>gi|169188223|ref|ZP_02848369.1| Methionine adenosyltransferase [Paenibacillus sp. JDR-2] >gi|169004872|gb|EDS51727.1| Methionine adenosyltransferase [Paenibacillus sp. JDR-2] (402 aa)
Score = 898, Expect = 1.0e-94, Identities = 181/367 (49%), Positives = 260/367 (70%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT-AGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEI---FNA---------VEKDNQ-IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKICDQISDAVLD  L+ DP ++VACEV  A  L+++ GEI++ A YVD+  +A   +  +GY       D S   +++++N QS +I    NA         V+K+N+ IGAGDQG+++G+AT+E    MPLPI ++H + +   +V  N  + +++ D K+QVTI+Y D +  ++D I++S QH++  + E I+      +I  VV    L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCE+QL++AIG ++P++  VDT+GT K S+E + ++I   FD      I+  ++R PIY+  + YGHFGRT+++  WE++DK E +
  S:     6 RHLFTSESVTEGHPDKICDQISDAVLDAFLEADPYARVACEVSVATGLVLVIGEISSRADYVDISAIARRTIKEIGYTRAKYGFDSSTCAVLTSLNEQSADIAQGVNAALESRDGKDVQKENEDIGAGDQGLMFGFATNETPELMPLPIALSHRIARRLSEVRKNDTLGYLRPDGKTQVTIEYVDGKPVRVDTIVVSTQHAEEISLEQIQKDILEHVIKPVVPVEWLDEQTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEIQLAYAIGVAQPVSINVDTYGTGKVSEELLVDVIKKNFDLRPAGIIKMLDLRRPIYAQTAAYGHFGRTDVDLPWERVDKAENL 394
>gi|159898874|ref|YP_001545121.1| methionine adenosyltransferase [Herpetosiphon aurantiacus ATCC 23779] >gi|159891913|gb|ABX04993.1| Methionine adenosyltransferase [Herpetosiphon aurantiacus ATCC 23779] (405 aa)
Score = 897, Expect = 1.3e-94, Identities = 177/361 (49%), Positives = 253/361 (70%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE-----KDNQ---------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           TSESV +GHPDKICDQ+SDA+LDE L QDP S+VACE      LIV+ GE+TT GYV+V  +   V+  +GY    F        II  ++ QS +I   V+     +D+Q         +GAGDQG+V+G+A +E + FMPL I++AH L +   +V    ++ +++ D KSQVT++Y+  +  ++D +++S QH  N   E I +     +I  V+ +  L+ + K  IN +G+F  GGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++ E+Q+S+AIG SKP++ + +TFGT+K SDE++ E+I   FD    + I   ++R PIY   + YGHFGR +++  WE+ DK E
  S:    15 TSESVTEGHPDKICDQVSDAILDELLAQDPMSRVACETATTTGLIVVLGEVTTKGYVEVQDIVRKVVSDIGYTRGKFGFDAETCGIIVALHGQSPDIAQGVDVALEVRDDQASREAEIEKVGAGDQGMVFGFACNETDEFMPLTISLAHQLTRRLAKVRKTGEVGYLRPDGKSQVTVEYSHGKPVRVDTVLISTQHDPNVDNERIHKDVIELVIKPVIPEGMLDENTKIFINPTGRFVTGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDSTKVDRSAAYAARYVAKNIVAAGLAERFELQVSYAIGVSKPLSISFETFGTAKVSDEKLLELINKHFDLRPGAIIRDLDLRRPIYRQTAAYGHFGRADIDLPWERTDKAE 397
>gi|47094312|ref|ZP_00232014.1| S-adenosylmethionine synthetase [Listeria monocytogenes str. 4b H7858] >gi|47017311|gb|EAL08142.1| S-adenosylmethionine synthetase [Listeria monocytogenes str. 4b H7858] (412 aa)
Score = 897, Expect = 1.3e-94, Identities = 173/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:    18 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 412
>gi|164687117|ref|ZP_02211145.1| hypothetical protein CLOBAR_00743 [Clostridium bartlettii DSM 16795] >gi|164604002|gb|EDQ97467.1| hypothetical protein CLOBAR_00743 [Clostridium bartlettii DSM 16795] (396 aa)
Score = 897, Expect = 1.6e-94, Identities = 172/369 (46%), Positives = 254/369 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDK+CDQISDA+LD  L++DP S+VACE      L+++ GEI+T  YVD+ K+    +  +GY  + F        +I+ ++ QS +I   V             E+  ++GAGDQG+++G+A +E E  MPLPI++AH L +   +V  +  +D+++ D K+QVT++Y  ++  ++  +++S QHS++   E+I       +I  V+    L+ +    IN +G+F IGGP GDTGLTGRK+++DTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCE++L++AIG +KP++  VDTFGT K S+E + E+I   FD    + I   ++R PIY   + YGHFGRT+++  WE+ DK E + E
  S:     3 RHLFTSESVTEGHPDKMCDQISDAILDALLEKDPQSRVACETTTTTGLVLVAGEISTNAYVDIPKLVRETVEGIGYTRAKFGFDCNTCAVITAIDEQSGDIAMGVDEGLESKSGEQTEEEIEKVGAGDQGIMFGFACNETEELMPLPISLAHKLSRRLTEVRKSGLLDYLRPDGKTQVTVEYEGNKAVRVHTVLISSQHSESVDNETIRRDLIEHVIKAVIPAELLDEETMYYINPTGRFVIGGPQGDTGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGVAKPLSIFVDTFGTGKVSEEVLVELINKNFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDLPWERTDKAETLKE 392
>gi|154687185|ref|YP_001422346.1| S-adenosylmethionine synthetase [Bacillus amyloliquefaciens FZB42] >gi|166201377|sp|A7Z7Y9|METK_BACA2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|154353036|gb|ABS75115.1| MetK [Bacillus amyloliquefaciens FZB42] (400 aa)
Score = 896, Expect = 1.8e-94, Identities = 172/367 (46%), Positives = 256/367 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISD++LDE LK DPN++VACE      L+++ GEITT+ YVD+ K     +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++GYA +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    T E I+ +    +I+ VV +  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA  CEVQL++AIG ++P++ +++TF T K S+E++ E++ N FD      I+  ++R PIY   + YGHFGR +++  WE+ DK + +
  S:     5 RRLFTSESVTEGHPDKICDQISDSILDEILKNDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRETIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGTMSDAEIEAIGAGDQGLMFGYACNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKTQVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNLKEHVINPVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISINTFDTGKASEEKLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDVDLPWERTDKADAL 393
>gi|46907895|ref|YP_014284.1| S-adenosylmethionine synthetase [Listeria monocytogenes str. 4b F2365] >gi|153167342|ref|ZP_01927585.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL N1-017] >gi|153202579|ref|ZP_01944115.1| S-adenosylmethionine synthetase [Listeria monocytogenes HPB2262] >gi|60390035|sp|Q71Z03|METK_LISMF S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|46881164|gb|AAT04461.1| S-adenosylmethionine synthetase [Listeria monocytogenes str. 4b F2365] >gi|133727069|gb|EBA28767.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL N1-017] >gi|133735354|gb|EBA37052.1| S-adenosylmethionine synthetase [Listeria monocytogenes HPB2262] (399 aa)
Score = 895, Expect = 2.5e-94, Identities = 173/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 399
>gi|42518599|ref|NP_964529.1| S-adenosylmethionine synthetase [Lactobacillus johnsonii NCC 533] >gi|60390056|sp|Q74KS4|METK_LACJO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|41582884|gb|AAS08495.1| S-adenosylmethionine synthetase [Lactobacillus johnsonii NCC 533] (402 aa)
Score = 895, Expect = 2.5e-94, Identities = 176/374 (47%), Positives = 260/374 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVE-----KDNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +++ TSESV +GHPDK+ DQISDA+LD  L +DP+ +VACE      L+++ GEI+T+ YVD+  +    ++ +GY       D ++  I+ +++ QS++I + V      ++NQ        IGAGDQG+++G+A  E    MPLPI++AH L++    +    ++D+++ D K+QVT++Y D   PK ID +++S Q     + + I     A+ID V+KK      L+ D K +IN SG+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CE+QL++AIG + P++  VDT GTSK S++ + E + N FD      IE  N++ PIY   + YGHFGRT+++  WE  DKVE +  +  ++
  S:     5 KRLFTSESVSEGHPDKVADQISDAILDAILAKDPDGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNRPELGFDGNNCAILVDIDEQSSDIADGVNESLETRENQQDKDDLDKIGAGDQGLMFGFAIKETPELMPLPISLAHSLMRRVASLRKEGRLDWLRPDAKAQVTVEYDDENKPKRIDTVVISTQTDATVSNDEIRE---AMIDMVIKKVIPSQYLDKDTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDLTKVDRSASYAARYVAKNIVAAGLAYQCEIQLAYAIGVAHPVSIMVDTHGTSKVSEDLLVEAVRNVFDLRPAGIIEMLNLKRPIYRQTAAYGHFGRTDVDLPWEHTDKVEALKTYVSEH 400
>gi|150388551|ref|YP_001318600.1| methionine adenosyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149948413|gb|ABR46941.1| Methionine adenosyltransferase [Alkaliphilus metalliredigens QYMF] (394 aa)
Score = 895, Expect = 2.6e-94, Identities = 168/367 (45%), Positives = 251/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +++ TSESV +GHPDKICDQISDAVLD   ++DP ++VACE   +  L+++ GEITT  YVD+ K+    +  +GY  + F        +++ +N QS +I   V +               IGAGDQG+++G+A +E    MPLPI++AH L K    V  N  +D+++ D K+QVT++Y   +  ++D I++S QHS     ++IE      +I+ +V    +++  + +IN +G+F +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCE++L++AIG ++P++  V+TFGT K  ++++ E++   FD    + I   ++R PIY   + YGHFGRT+++  WE+ DK E +
  S:     3 KRLFTSESVTEGHPDKICDQISDAVLDAIFEKDPKARVACETSVSTGLVLVAGEITTDCYVDIPKVVRRTIAEIGYTRAKFGFDSDTCAVLTAINEQSPDIAQGVNEALENRAGEVTDGLESIGAGDQGIMFGFACNETPELMPLPISLAHKLAKRLSDVRKNGTLDYLRPDGKTQVTVEYDGDKPKRVDTIVISTQHSPEVDHKTIERDLIEYVINNIVPAELIDAKTRYLINPTGRFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGVAQPVSILVETFGTGKVDEDKMIELVHKYFDLRPAAIIRDLDLRRPIYRQIAAYGHFGRTDVDLPWERTDKAEAL 389
>gi|152977126|ref|YP_001376643.1| S-adenosylmethionine synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189081704|sp|A7GU40|METK_BACCN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|152025878|gb|ABS23648.1| Methionine adenosyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (399 aa)
Score = 894, Expect = 3.1e-94, Identities = 173/369 (46%), Positives = 256/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  +++++ D K+QVT++Y ++  P ++D I++S QH    T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG +KP++ +VDTFGT K S+E + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK  ++ E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDRALEAREGQMTDAEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLARRLTEVRKDETLEYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPEITWEQIDRDLKEHVIKAVVPAELMDEETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAKPVSISVDTFGTGKVSEEVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKAADLKE 395
>gi|153174821|ref|ZP_01930290.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL N3-165] >gi|153196702|ref|ZP_01941029.1| S-adenosylmethionine synthetase [Listeria monocytogenes 10403S] >gi|127633585|gb|EBA22993.1| S-adenosylmethionine synthetase [Listeria monocytogenes 10403S] >gi|133730052|gb|EBA31750.1| S-adenosylmethionine synthetase [Listeria monocytogenes FSL N3-165] (399 aa)
Score = 894, Expect = 3.2e-94, Identities = 173/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGNEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTHLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 399
>gi|16803704|ref|NP_465189.1| S-adenosylmethionine synthetase [Listeria monocytogenes EGD-e] >gi|153179678|ref|ZP_01932897.1| S-adenosylmethionine synthetase [Listeria monocytogenes F6900] >gi|153186018|ref|ZP_01936465.1| S-adenosylmethionine synthetase [Listeria monocytogenes J0161] >gi|153191108|ref|ZP_01938404.1| S-adenosylmethionine synthetase [Listeria monocytogenes J2818] >gi|22095839|sp|Q8Y6M0|METK_LISMO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|16411100|emb|CAC99742.1| metK [Listeria monocytogenes] >gi|126941431|gb|EBA19318.1| S-adenosylmethionine synthetase [Listeria monocytogenes J0161] >gi|127765465|gb|EBA25814.1| S-adenosylmethionine synthetase [Listeria monocytogenes J2818] >gi|133733163|gb|EBA34861.1| S-adenosylmethionine synthetase [Listeria monocytogenes F6900] (399 aa)
Score = 894, Expect = 3.6e-94, Identities = 173/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGNEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 399
>gi|13507799|ref|NP_109748.1| S-adenosylmethionine synthetase [Mycoplasma pneumoniae M129] >gi|2500686|sp|P78003|METK_MYCPN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|1673749|gb|AAB95742.1| S-adenosylmethionine synthetase 2 [Mycoplasma pneumoniae M129] (383 aa)
Score = 893, Expect = 3.7e-94, Identities = 176/369 (47%), Positives = 253/369 (68%)
  Q:     9 SESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNS-DFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSK-YSDEQIYEIIVNTFDFSIKSFIEKFNMRSPI-YSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +E+VG+GHPDKICDQI+D++LDEC+KQ P S VACEVFA+  LI++GGEI T GYVDVV+  W VL  LGY E+DF+ +S +NSQS+EI  AV+ +++IGAGDQG+  GYA  E E  MPL   +A  LV+ A ++I   +  FIKHDMKSQV ++Y  ++  + + ++MSVQH+Q+ + + + ++  N +I  V+ +Y LN    K ++N  G F +GGP+ DTGLTGRK++VDTYG  A HGGG+FSGKD TKVDR+GAYFAR+IAK+IV+   A++CEV +S+      P +  V  F  +K +S++ I ++I   F++S+   I K  +   + Y  ++ YGHFG       WEQL + + +    K +
  S:    15 AEAVGRGHPDKICDQIADSILDECIKQSPTSHVACEVFASKNLIMVGGEILTTGYVDVVQTGWKVLNRLGYTENDFSFLSCINSQSSEINQAVQSNDEIGAGDQGITVGYACSETEQLMPLGSIVAQALVQRAARII--DQYPFIKHDMKSQVVLNYTGNK-VQCESVLMSVQHTQDVSLDQLRQTIINQVILPVLTEYGLNDPKIKHLVNPGGSFVVGGPMADTGLTGRKIIVDTYGPYANHGGGSFSGKDPTKVDRTGAYFARFIAKHIVSLGWAEECEVSISWVFSQPLPQSIQVKCFNINKEFSEQLINQVISQYFNWSVAKIIAKLKLLDQVEYFRYAVYGHFGHQ--TAPWEQLSERDSLQCLIKNF 382
>gi|168333929|ref|ZP_02692161.1| S-adenosylmethionine synthetase [Epulopiscium sp. 'N.t. morphotype B'] (386 aa)
Score = 892, Expect = 4.7e-94, Identities = 172/364 (47%), Positives = 255/364 (70%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIF----NAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           K  TSESV +GHPDKI DQISDAVLD   ++D N++VACE      L+++ GEITT  Y+D+ K+A N +  +GY++ ++        ++ +++ QS +I     +A+E D+QIGAGDQG+++GYA +E E FMPLPI +AH L K   +V     + +++ D K+QV+++Y D    ++D +++S QH+++ + E I +     +I  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A HGGGAFSG D TKVDRSGAY ARYIAKNIVAA+LA KCE+++++AIG + P++  V+T GT    D+++ EI+   FD +    I+  ++R PIY   +TYGHFGR +++  WE+ DK+E
  S:     4 KFFTSESVTEGHPDKIADQISDAVLDAIYEKDKNARVACETAVTTGLVLVMGEITTNCYIDINKIARNTIKEIGYNKPEYGFDGNTCGVLVSLDEQSRDIAMGVDSALEADDQIGAGDQGMMFGYACNETEEFMPLPIALAHRLTKRLTEVRKRRTLAYLRPDGKAQVSVEYHDGAPVRVDTVVVSSQHAEDVSNEQIHKDILEEVIMKVIPAKLLDENTKYYINPTGRFVIGGPVGDAGLTGRKIIVDTYGGYASHGGGAFSGXDPTKVDRSGAYAARYIAKNIVAAELATKCEIEIAYAIGVANPVSLLVNTHGTGIIEDDRLAEIVKANFDLTPNGIIKMLDLRRPIYKQTATYGHFGRHDIDIPWEKTDKIE 379
>gi|24372516|ref|NP_716558.1| S-adenosylmethionine synthetase [Shewanella oneidensis MR-1] >gi|29611811|sp|Q8EIB4|METK_SHEON S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|24346518|gb|AAN54003.1|AE015537_11 S-adenosylmethionine synthetase [Shewanella oneidensis MR-1] (383 aa)
Score = 892, Expect = 4.9e-94, Identities = 175/367 (47%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E +  MP PI  AH LVK   +V  N  + +++ D KSQVT  Y D++   ID I++S QHS + A  + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT K S+E + +++   FD       E  N+  PIY   + YGHFGR+E    WE  DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYIHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYASNETDILMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYEDNKIVGIDAIVLSTQHSPDIAQADLIEGVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISVETFGTGKVSEEVLIKLVRQHFDLRPYGLTEMLNLARPIYQATAAYGHFGRSEFP--WEATDKAEAL 377
>gi|157826229|ref|YP_001493949.1| S-adenosylmethionine synthetase [Rickettsia akari str. Hartford] >gi|166201408|sp|A8GPW6|METK_RICAH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157800187|gb|ABV75441.1| S-adenosylmethionine synthetase [Rickettsia akari str. Hartford] (380 aa)
Score = 892, Expect = 5.0e-94, Identities = 172/363 (47%), Positives = 250/363 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH-SQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           I TSESV +GHPDK+ DQISD VLDE LK DP+ +VACE F    L+++GGEITT+ YVD+ ++  + +  +GY+  ++        +IS++  QS +I   V+   D++IGAGDQG+V+GYA +E ++ MP PI  AH L++    +     + +++ D KSQVT+ Y +++   ID +++S QH  +   K+ IE+    II   +    LN D K +IN +G+F IGGP+ D GLTGRK++VD+YG +A+HGGG FSGKD TK+DRS AY ARYIAKN+V A LA +CE+Q+S+AIG + P++   +TFGTSK S+EQI ++I   FD      I+   +R+P Y   ++YGHFGR + +  WE+LDKV+
  S:     5 IFTSESVSEGHPDKMADQISDTVLDEILKHDPSGRVACETFVTTGLVLVGGEITTSTYVDIEQIVRSKIQEIGYNNPNYGFDGSCCAVISSIMKQSPDIAMGVDNANDDEIGAGDQGMVFGYACNETDSLMPAPIYYAHLLMRRQAYLRKQNVLPWLRPDAKSQVTLRYENNKPVAIDAVVLSTQHHPEIQQKDLIEAVIEEIIKPTLPSSWLNKDTKYLINPTGRFVIGGPVADCGLTGRKIIVDSYGGMARHGGGCFSGKDPTKIDRSAAYMARYIAKNVVGAGLADRCEIQISYAIGVAAPVSVYTETFGTSKLSNEQITKLITQHFDMRPGKIIKHLALRTPCYQKTASYGHFGREDADFTWEKLDKVD 377
>gi|82656903|emb|CAI81334.1| S-adenosylmethionine synthetase [Staphylococcus aureus RF122] (431 aa)
Score = 891, Expect = 6.2e-94, Identities = 180/372 (48%), Positives = 256/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-------DNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKI DQ+SDA+LD  LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     I++ ++ QS +I   V+K       D++      GAGDQG+++GYAT+E E +MPL I ++H L K    V  +  +++++ D K QVT++Y ++ NP +ID I++S QH+++ T E I+    A + +     NL N   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ A+DTFGT K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKVEE+ +  K
  S:    39 KRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK 431
>gi|16800841|ref|NP_471109.1| S-adenosylmethionine synthetase [Listeria innocua Clip11262] >gi|22095847|sp|Q92AZ5|METK_LISIN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|16414260|emb|CAC97004.1| metK [Listeria innocua] (399 aa)
Score = 891, Expect = 7.2e-94, Identities = 172/373 (46%), Positives = 257/373 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           R + TSESV  GHPDKI DQISDA+LD  + +DP+++VACE      L+++ GEITT+ YVD+ K+  + +  +GY  + +        +++ ++ QS +I   V++                IGAGDQG+++G+ATDE E  MPLPI +AH L +   ++    K+D+++ D K+QVT++Y +   P +ID I++S QH  + T+E I +     +   V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKNIVAA LAKK EVQ+++AIG ++P++ ++DT+GTS YS++++ + +   FD      I   ++R PIY   + +GHFGR++L+  WE+ DK E + +   K
  S:     5 RHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGSEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTHLFPEVIDASFLDENTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK 399
>gi|1709003|sp|P50307|METK_STAAU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|1020317|gb|AAA79506.1| S-adenosylmethionine synthetase (397 aa)
Score = 890, Expect = 1.0e-93, Identities = 180/372 (48%), Positives = 257/372 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-------DNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKI DQ+SDA+LD  LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     I++ ++ QS +I   V+K       D++      GAGDQG+++GYAT+E E +MPL I ++H L K    V  +  +++++ D K QVT++Y ++ NP +ID I++S QH+++ T E I+    A + +     NL N   K  IN +G+F IGGP GD GLTGRK++VDTYG +A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ A+DTFGT K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKVEE+ +  K
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGIARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK 397
>gi|83589745|ref|YP_429754.1| S-adenosylmethionine synthetase [Moorella thermoacetica ATCC 39073] >gi|109892639|sp|Q2RK28|METK_MOOTA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|83572659|gb|ABC19211.1| methionine adenosyltransferase [Moorella thermoacetica ATCC 39073] (395 aa)
Score = 889, Expect = 1.1e-93, Identities = 170/367 (46%), Positives = 251/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           RK+ TSESV +GHPDKI D+I+DAVLD    +D  ++VACE   +  LI++ G+ITT  YVD+ ++A   +  +GY  + F        +I++++ QS +I   V            ++   +GAGDQG+++GYAT E   FMP+PI +AH L +    V     + +++ D KSQVT++Y D +  ++D +++S QH  +    ++ +     +I  V+    L++  +  IN +G+F IGGP GDTGLTGRKL+VDTYG +A+HGGGA SGKD TKVDRS AY ARY+AKN+VAA LA +CEVQ+++AIG ++P++ +V+TFGT K SD+++ E+I   FD    + I   ++R PIY   S YGHFGR +L+  WE+LDKVE +
  S:     3 RKLFTSESVTEGHPDKIADRIADAVLDAIYAKDNQARVACECLVSTGLILVAGQITTDCYVDIPRVARETVREIGYTRAKFGFDCDTCAVITSIDEQSPDIAMGVNEAWEKKQGEARDEVETLGAGDQGMMFGYATSETPEFMPMPIALAHALTRRLAAVRKERILPYLRPDGKSQVTVEYEDGRPVRVDTVVISTQHRPDIDMATLRDEVLETVIKPVIPAEMLDNRTRYFINPTGRFVIGGPQGDTGLTGRKLIVDTYGGMARHGGGALSGKDPTKVDRSAAYAARYVAKNVVAAGLADRCEVQVAYAIGVARPVSISVETFGTGKVSDDRLVELIRAHFDLRPGAIIRDLDLRRPIYKAVSVYGHFGRPDLDLPWERLDKVEAL 389
>gi|30264834|ref|NP_847211.1| S-adenosylmethionine synthetase [Bacillus anthracis str. Ames] >gi|47530320|ref|YP_021669.1| S-adenosylmethionine synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187651|ref|YP_030904.1| S-adenosylmethionine synthetase [Bacillus anthracis str. Sterne] >gi|52140738|ref|YP_086092.1| S-adenosylmethionine synthetase [Bacillus cereus E33L] >gi|65322135|ref|ZP_00395094.1| COG0192: S-adenosylmethionine synthetase [Bacillus anthracis str. A2012] >gi|165869794|ref|ZP_02214452.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0488] >gi|166996459|ref|ZP_02262919.1| S-adenosylmethionine synthetase [Bacillus cereus AH820] >gi|167633914|ref|ZP_02392237.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0442] >gi|167638094|ref|ZP_02396372.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0193] >gi|170685967|ref|ZP_02877190.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0465] >gi|170705482|ref|ZP_02895946.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0389] >gi|177651315|ref|ZP_02934146.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0174] >gi|190568307|ref|ZP_03021215.1| S-adenosylmethionine synthetase [Bacillus anthracis Tsiankovskii-I] >gi|196032746|ref|ZP_03100159.1| S-adenosylmethionine synthetase [Bacillus cereus W] >gi|196041426|ref|ZP_03108719.1| S-adenosylmethionine synthetase [Bacillus cereus NVH0597-99] >gi|33301232|sp|Q81KI0|METK_BACAN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|60389925|sp|Q632S5|METK_BACCZ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|30259509|gb|AAP28697.1| S-adenosylmethionine synthetase [Bacillus anthracis str. Ames] >gi|47505468|gb|AAT34144.1| S-adenosylmethionine synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181578|gb|AAT56954.1| S-adenosylmethionine synthetase [Bacillus anthracis str. Sterne] >gi|51974207|gb|AAU15757.1| S-adenosylmethionine synthetase (methionine adenosyltransferase) [Bacillus cereus E33L] >gi|164714623|gb|EDR20142.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0488] >gi|167513911|gb|EDR89279.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0193] >gi|167530715|gb|EDR93417.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0442] >gi|170129607|gb|EDS98470.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0389] >gi|170670431|gb|EDT21171.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0465] >gi|172083141|gb|EDT68203.1| S-adenosylmethionine synthetase [Bacillus anthracis str. A0174] >gi|190560563|gb|EDV14540.1| S-adenosylmethionine synthetase [Bacillus anthracis Tsiankovskii-I] >gi|195994175|gb|EDX58130.1| S-adenosylmethionine synthetase [Bacillus cereus W] >gi|196027674|gb|EDX66288.1| S-adenosylmethionine synthetase [Bacillus cereus NVH0597-99] (399 aa)
Score = 889, Expect = 1.1e-93, Identities = 172/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKE 395
>gi|15644406|ref|NP_229458.1| S-adenosylmethionine synthetase [Thermotoga maritima MSB8] >gi|148270263|ref|YP_001244723.1| S-adenosylmethionine synthetase [Thermotoga petrophila RKU-1] >gi|170288960|ref|YP_001739198.1| methionine adenosyltransferase [Thermotoga sp. RQ2] >gi|166201417|sp|A5ILS4|METK_THEP1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|7387883|sp|Q9X1Y8|METK_THEMA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|4982232|gb|AAD36725.1|AE001807_16 S-adenosylmethionine synthetase [Thermotoga maritima MSB8] >gi|147735807|gb|ABQ47147.1| methionine adenosyltransferase [Thermotoga petrophila RKU-1] >gi|170176463|gb|ACB09515.1| Methionine adenosyltransferase [Thermotoga sp. RQ2] (395 aa)
Score = 889, Expect = 1.2e-93, Identities = 167/368 (45%), Positives = 254/368 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDNQI-------------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +R++ TSESV +GHPDKI DQISDA+LD  L+QDP S+VA E      L++I GE+TT  YV++  +A   ++ +GY  + +        ++++++SQS +I   V+K  ++             GAGDQG+++GYAT+E   +MPLPI +AH L     +V  N  + F++ D K+QVTI+Y D +  ++D +++S QH  + ++  + E+    +I+ V+ +   +   K ++N +G+F +GGP+ DTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS  Y ARY+AKN+VAA LA K  +QLS+AIG +KP++  +DT+GT+K  ++++ ++I   FDF   + I+K N+  PIY   + YGHFGR E    WE+LD V+E+
  S:     1 MRRLFTSESVTEGHPDKIADQISDAILDAMLEQDPRSRVAVETLVTTGLVIIAGEVTTRAYVEIPDIARKTILEIGYTRAKYGFDGETCGVLTSIHSQSPDIALGVDKALEVKTGEEVADEFEALGAGDQGIMFGYATNETPEYMPLPITLAHKLAMRLAEVRKNGTLPFLRPDGKTQVTIEYEDDKPVRVDTVLISTQHDPDISQADLREAIIEHVINPVIPEQYRDDKMKILVNPTGRFVLGGPMADTGLTGRKIIVDTYGGWVPHGGGAFSGKDPTKVDRSAHYMARYVAKNVVAAGLADKFLIQLSYAIGVAKPVSIMIDTYGTAKVDEDKLLKVITELFDFRPGAIIKKLNLLRPIYRKTAAYGHFGRNEEEFTWEKLDMVDEL 389
>gi|81428082|ref|YP_395081.1| S-adenosylmethionine synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|109892637|sp|Q38YF8|METK_LACSS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|78609723|emb|CAI54769.1| Methionine adenosyltransferase (S-adenosylmethionine synthetase) [Lactobacillus sakei subsp. sakei 23K] (399 aa)
Score = 889, Expect = 1.3e-93, Identities = 176/378 (46%), Positives = 260/378 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV-------EKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKYN 378
           M+ R + TSESV +GHPDKI DQISDA+LD  L+QDP ++VACE      L+++ GEI+T  YVD+ K+    +  +GY       D  +  +I  ++ QS +I   V       EKD    ++IGAGDQG+++G+A D+    MPLPI ++H L++   ++  + ++ +++ D K+QVT++Y +++ PK +D +++S QH ++ T E+I+      +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LA+KCEVQL++AIG ++P++ +V+TF T   S+E I   I   FD      I+  +++ PIY   + YGHFGRT+++  WE+LDKV+ +     K N
  S:     1 MQERHLFTSESVSEGHPDKIADQISDAILDAMLEQDPQARVACETTVTTGLVLVVGEISTTAYVDIQKVVRETIKKIGYRDGQYGFDGDNCAVIVALDEQSPDIAQGVDDSLESREKDEDPLDKIGAGDQGLMFGFAVDQTPELMPLPIALSHRLMRKVAELRKSGQLAYLRPDAKAQVTVEYDENEQPKRVDTVVISTQHDEDVTLETIQKDMLEQVIKTVIPAEYLDDKTKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKCEVQLAYAIGVAQPVSVSVNTFETGTVSEEAIQTAIRENFDLRPAGIIKMLDLQRPIYKQTAAYGHFGRTDVDLSWERLDKVDALKASIAKLN 398
>gi|49478753|ref|YP_038812.1| S-adenosylmethionine synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166985545|ref|ZP_02256824.1| S-adenosylmethionine synthetase [Bacillus cereus AH187] >gi|60390013|sp|Q6HCB4|METK_BACHK S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|49330309|gb|AAT60955.1| S-adenosylmethionine synthetase (methionine adenosyltransferase) [Bacillus thuringiensis serovar konkukian str. 97-27] (399 aa)
Score = 888, Expect = 1.4e-93, Identities = 172/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAAALKE 395
>gi|56461315|ref|YP_156596.1| S-adenosylmethionine synthetase [Idiomarina loihiensis L2TR] >gi|60389901|sp|Q5QVM7|METK_IDILO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56180325|gb|AAV83047.1| S-adenosylmethionine synthetase [Idiomarina loihiensis L2TR] (381 aa)
Score = 888, Expect = 1.5e-93, Identities = 168/367 (45%), Positives = 253/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLD  L +DP ++VACE +    ++++GGEI+T  +VDV  +A   +  +GY  SD         +++ +  QS +I   V++ N  + GAGDQG+++GYA++E    MP PI  AH +++   +V  N  +D+++ D KSQ+T  Y + +   ID +++S QH ++ T+E++ E+    II  V+ +  ++ D +  IN +G+F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++CE+Q+S+AIG ++P + ++DTFGTSK+S+EQ+  ++   FD      I+  ++  PIY   + YGHFGR  L   WEQ DK  ++
  S:     3 RHLFTSESVSEGHPDKIADQISDAVLDAILAKDPKARVACETYVKTGMVLVGGEISTKAWVDVEDLARQTVKDIGYRHSDMGFDGASCAVLNAIGKQSGDINQGVDRANPEEQGAGDQGLMFGYASNETSVLMPAPITYAHRVMQRQSEVRNNGTLDWLRPDAKSQLTFVYENGKPVAIDTVVLSTQHREDITQETLREAVMEEIIKPVLPEQWVSKDTQFHINPTGRFVVGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNLVAAGLAERCELQISYAIGVAEPTSISIDTFGTSKHSEEQLIALVRRHFDLRPYGLIKMLDLERPIYKQTAAYGHFGRDNLP--WEQTDKAADL 377
>gi|154496602|ref|ZP_02035298.1| hypothetical protein BACCAP_00894 [Bacteroides capillosus ATCC 29799] >gi|150274235|gb|EDN01326.1| hypothetical protein BACCAP_00894 [Bacteroides capillosus ATCC 29799] (393 aa)
Score = 888, Expect = 1.5e-93, Identities = 176/365 (48%), Positives = 253/365 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK---------DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVK----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKICDQISDAVLD  L++DP ++VACE      ++ + GEI+T  YVD+  +A  V+  +GYD + F        ++++++ QS +I   V+K         D ++  GAGDQG+++GYA DE    MPL I++AH L     QV     +D+++ D KSQVT++Y ++  P ++D +++S QHS  AT E I    N +++ V+K       L+ + K  +N +G+F +GGP GD+GLTGRK++VDTYG  A HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LAKKC+++L++AIG +KP++  +DTFGT   SDE +   +   FD    + I K ++R PIY   + YGHFGRT+++  WE+ D  E +
  S:     5 LFTSESVTEGHPDKICDQISDAVLDAILEKDPAARVACETTVTTGMVHVMGEISTTCYVDIPHIAREVIREIGYDRAKFGFDCDTCAVLTSIDEQSPDIAMGVDKSLEAKEGGADAELENGAGDQGMMFGYACDETPELMPLAISLAHKLSYRLAQVRKQGLVDYLRPDGKSQVTVEYDENGVPVRVDTVVISTQHSPEATLEQIR---NDMVELVIKPTIPAQLLDENTKYYVNPTGRFVVGGPQGDSGLTGRKIIVDTYGGSAPHGGGAFSGKDPTKVDRSAAYMARYVAKNIVAAGLAKKCQIELAYAIGVAKPVSVLIDTFGTGTVSDEALSAAVSKVFDLRPTAIIRKLDLRRPIYRQTAAYGHFGRTDVDLPWERTDMTEAL 389
>gi|168162773|ref|ZP_02598006.1| S-adenosylmethionine synthetase [Bacillus cereus H3081.97] (399 aa)
Score = 888, Expect = 1.7e-93, Identities = 172/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVHNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAAALKE 395
>gi|118479896|ref|YP_897047.1| S-adenosylmethionine synthetase [Bacillus thuringiensis str. Al Hakam] >gi|196043896|ref|ZP_03111133.1| S-adenosylmethionine synthetase [Bacillus cereus 03BB108] >gi|158512518|sp|A0RJZ7|METK_BACAH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|118419121|gb|ABK87540.1| methionine adenosyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|196025232|gb|EDX63902.1| S-adenosylmethionine synthetase [Bacillus cereus 03BB108] (399 aa)
Score = 888, Expect = 1.7e-93, Identities = 172/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAVALKE 395
>gi|182420244|ref|ZP_02951473.1| methionine adenosyltransferase [Clostridium butyricum 5521] >gi|182375839|gb|EDT73431.1| methionine adenosyltransferase [Clostridium butyricum 5521] (391 aa)
Score = 887, Expect = 1.9e-93, Identities = 183/375 (48%), Positives = 265/375 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDK+CDQISD VLD  L++DPN++VACE      ++++ GEI+T  YVD+ K+    +  +GYD + F       ++++ ++ QS +I   V         EKDN   +GAGDQG+++G+AT+E + +MPLPI +AH L +   +V  N+ + +++ D K+QVT++Y D +  +ID I++S QH ++ T E IE      +I  VV    L+   +  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VA+++A K E+QL++AIG +KP++  VDTFGT K SD++I EI+   FD    + I   ++R PIY   + YGHFGR +LN  WEQL+KVEEI    KKY
  S:     1 MRRLFTSESVTEGHPDKMCDQISDGVLDAILEKDPNARVACETCTTTGMVMVMGEISTNCYVDIPKVVRETVREIGYDRAKFGFDCDTCSVMTTIDEQSADIAQGVDEALESRQGEKDNVEAVGAGDQGMMFGFATNETDAYMPLPIYMAHKLSRRLTEVRKNSTLSYLRPDGKTQVTVEYEDEKPVRIDTIVISTQHDEHVTLEQIEKDLKEYVIKAVVPAELLDEKTRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVASEVADKLEIQLAYAIGVAKPVSITVDTFGTGKLSDDKIVEIVEKVFDLRPGAIIRDLDLRRPIYKQTAAYGHFGRNDLNLPWEQLNKVEEI----KKY 390
>gi|153816510|ref|ZP_01969178.1| hypothetical protein RUMTOR_02763 [Ruminococcus torques ATCC 27756] >gi|145846168|gb|EDK23086.1| hypothetical protein RUMTOR_02763 [Ruminococcus torques ATCC 27756] (426 aa)
Score = 887, Expect = 1.9e-93, Identities = 187/377 (49%), Positives = 265/377 (70%)
  Q:     1 MELRKIM-TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPL-------GYDESDFTIISNVNSQSNEIFNAVEK-----DNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           ME  KI+ TSESV +GHPDK+CDQISDA+LDE +KQDP S+VACE      ++++ GEITT  YVD+ K+  + +  +       G+D     +I+ ++ QS++I   V+K     +N+        IGAGDQG+++GYA+DE E +MP P  +AH L +   +V  N  + +++ D K+QVT++Y ++  PK +D +++S QH    T+E I E     + D V+     + + K  IN +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKDCTKVDRS AY ARY AKNIVAA LA++CE+QLS+AIG ++P + +VDTFGT K SD ++ EII   FDF     I+  ++R PIY   + YGHFGR ++   WE+LDK +++    KKY
  S:    28 MEREKILFTSESVTEGHPDKMCDQISDAILDELMKQDPMSRVACETCCTTGVVMVMGEITTKAYVDIPKIVRDTVREISYTRGKYGFDADTCGVITTIDEQSSDIAMGVDKALEAKENKMSEDDIEAIGAGDQGMMFGYASDETEEYMPYPAAMAHKLARRLTEVRKNGTLPYLRPDGKTQVTVEYDENGVPKRLDAVVLSTQHDPEVTQERIHEDIKKYVFDEVIPANMTDDETKFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSAAYAARYAAKNIVAAGLARRCEIQLSYAIGVAQPTSVSVDTFGTGKVSDTKLVEIIRENFDFRPAGIIKMLDLRRPIYKQTAAYGHFGRLDVELPWEKLDKADDL----KKY 423
>gi|21283457|ref|NP_646545.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49486609|ref|YP_043830.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650575|ref|YP_186668.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87160443|ref|YP_494422.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|88195604|ref|YP_500410.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221892|ref|YP_001332714.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510002|ref|YP_001575661.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|161777618|ref|YP_417113.2| S-adenosylmethionine synthetase [Staphylococcus aureus RF122] >gi|168728118|ref|ZP_02760395.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122540469|sp|Q2G1W4|METK_STAA8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|172048953|sp|A6QHX0|METK_STAAE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081737|sp|A8Z4L2|METK_STAAT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|24211975|sp|Q8NVZ9|METK_STAAW S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56749191|sp|Q6G8E3|METK_STAAS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71151913|sp|Q5HEY9|METK_STAAC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892667|sp|Q2FFV6|METK_STAA3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892668|sp|Q2YTK1|METK_STAAB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21204898|dbj|BAB95593.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49245052|emb|CAG43514.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284761|gb|AAW36855.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87126417|gb|ABD20931.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203162|gb|ABD30972.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374692|dbj|BAF67952.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368811|gb|ABX29782.1| methionine adenosyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (397 aa)
Score = 887, Expect = 2.1e-93, Identities = 180/372 (48%), Positives = 256/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-------DNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKI DQ+SDA+LD  LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     I++ ++ QS +I   V+K       D++      GAGDQG+++GYAT+E E +MPL I ++H L K    V  +  +++++ D K QVT++Y ++ NP +ID I++S QH+++ T E I+    A + +     NL N   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ A+DTFGT K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKVEE+ +  K
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK 397
>gi|30022834|ref|NP_834465.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 14579] >gi|47565194|ref|ZP_00236237.1| S-adenosylmethionine synthetase [Bacillus cereus G9241] >gi|167935141|ref|ZP_02522216.1| S-adenosylmethionine synthetase [Bacillus cereus AH1134] >gi|168137692|ref|ZP_02580921.1| S-adenosylmethionine synthetase [Bacillus cereus B4264] >gi|33301228|sp|Q816Q8|METK_BACCR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|29898393|gb|AAP11666.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 14579] >gi|47557980|gb|EAL16305.1| S-adenosylmethionine synthetase [Bacillus cereus G9241] (399 aa)
Score = 886, Expect = 2.4e-93, Identities = 171/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKE 395
>gi|120600096|ref|YP_964670.1| S-adenosylmethionine synthetase [Shewanella sp. W3-18-1] >gi|158512983|sp|A1RN71|METK_SHESW S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|120560189|gb|ABM26116.1| Methionine adenosyltransferase [Shewanella sp. W3-18-1] (383 aa)
Score = 886, Expect = 2.5e-93, Identities = 173/367 (47%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E E  MP PI  AH LVK   +V  N  + +++ D KSQVT  Y +++   ID I++S QHS + A  + IE    +II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S+E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYASNETEILMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYENNKIVGIDAIVLSTQHSPDIAQADLIEGVMESIIKPVLPAQWLSKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTGKVSEEVLIKLVRQHFDLRPYGLTEMLNLARPIYQATAAYGHFGRNEFP--WEATDKAEAL 377
>gi|161506359|ref|YP_001573471.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189081729|sp|A9MRD1|METK_SALAR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|160867706|gb|ABX24329.1| hypothetical protein SARI_04556 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (384 aa)
Score = 886, Expect = 2.8e-93, Identities = 172/365 (47%), Positives = 249/365 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVSSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKTDKAQ 375
>gi|7387879|sp|P56878|METK_RICPR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|5912307|emb|CAB56090.1| S-adenosylmethionine synthetase [Rickettsia prowazekii] (380 aa)
Score = 886, Expect = 2.8e-93, Identities = 176/363 (48%), Positives = 247/363 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH-SQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDKI DQISDAVLDE LK DPN +VACE F    L+++GGEITT  YVD+ ++  N +  +GY+  ++        +IS++  QS +I   ++ +N+  IGAGDQG+V+GYA +E ++ MP PI  AH L+K    +     + +++ D KSQVT+ Y +++   ID +++S QH  +   K+ IE+    II   +    L+ D K +IN +G+F IGGP+ D GLTGRK++VD+YG +AKHGGG FSGKD TK+DRS AY ARYIAKNIV A LA +CE+Q+S+AIG + P++   +TFGTSK S+EQ  ++I   FD      I+   + +  Y   +TYGHFGR + N  WEQLDKV+
  S:     5 VFTSESVSEGHPDKIADQISDAVLDEILKHDPNGRVACETFVTTGLVLVGGEITTNTYVDIEQVVRNKIQEIGYNNPNYGFDGSCCAVISSIIKQSPDIAMGIDNENEEEIGAGDQGMVFGYACNETKSLMPAPIYYAHLLMKRQAYLRKQNILSWLRPDAKSQVTLRYENNKPIVIDSVVLSTQHHPEIQQKDLIEAVIEEIIKPTLPTNLLHKDTKYLINPTGRFVIGGPVADCGLTGRKIIVDSYGGMAKHGGGCFSGKDPTKIDRSAAYMARYIAKNIVGAGLADRCEIQISYAIGVADPVSVYAETFGTSKLSNEQTTKLITEHFDMRPGKIIKNLKLHTQCYQKTATYGHFGREDENFTWEQLDKVD 377
>gi|108744027|gb|ABG02285.1| S-adenosylmethionine synthetase [Bacillus thuringiensis] (399 aa)
Score = 885, Expect = 3.2e-93, Identities = 171/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RPLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQVTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKE 395
>gi|77359622|ref|YP_339197.1| S-adenosylmethionine synthetase [Pseudoalteromonas haloplanktis TAC125] >gi|109892653|sp|Q3IDQ1|METK_PSEHT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|76874533|emb|CAI85754.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Pseudoalteromonas haloplanktis TAC125] (383 aa)
Score = 885, Expect = 3.2e-93, Identities = 173/367 (47%), Positives = 252/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QD +++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E E  MP PI  +H LV+   QV  + ++++++ D KSQVT  Y + +   ID +++S QHS++ + K+ IE+    II  V+    + S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA KCE+Q+S+AIG ++P + +V+TFGTSK  + ++ E+I   FD      I+  ++  PIY P + YGHFGR E    WE+ DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDSHARVACETYVKTGMVMVGGEITTSAWVDIEEITRKTIRDIGYTNSDMGFDADSCAILNTIGKQSPDINQGVDRTSPEEQGAGDQGLMFGYACNETEVLMPAPITYSHRLVQRQAQVRKSGELNWLRPDAKSQVTFAYENGKPVGIDAVVLSTQHSEDISQKDLIEAVMETIIKPVLPAELITSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADKCELQVSYAIGIAEPTSISVETFGTSKLEESRLIELIREHFDLRPYGLIKMLDLERPIYLPTAAYGHFGREEFP--WERTDKAEAL 377
>gi|124545701|ref|ZP_01704876.1| S-adenosylmethionine synthetase [Shewanella putrefaciens 200] >gi|146291975|ref|YP_001182399.1| S-adenosylmethionine synthetase [Shewanella putrefaciens CN-32] >gi|166201411|sp|A4Y3R7|METK_SHEPC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|124510677|gb|EAY54745.1| S-adenosylmethionine synthetase [Shewanella putrefaciens 200] >gi|145563665|gb|ABP74600.1| Methionine adenosyltransferase [Shewanella putrefaciens CN-32] (383 aa)
Score = 885, Expect = 3.5e-93, Identities = 173/367 (47%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E E  MP PI  AH LVK   +V  N  + +++ D KSQVT  Y +++   ID I++S QHS + A  + IE     II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S+E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYASNETEILMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYENNKIVGIDAIVLSTQHSPDIAQADLIEGVMETIIKPVLPAQWLSKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTGKVSEEVLIKLVRQHFDLRPYGLTEMLNLARPIYQATAAYGHFGRNEFP--WEATDKAEAL 377
>gi|15924780|ref|NP_372314.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927364|ref|NP_374897.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus N315] >gi|148268262|ref|YP_001247205.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150394331|ref|YP_001317006.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|156980106|ref|YP_001442365.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|166201413|sp|A7X3N2|METK_STAA1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081735|sp|A6U2Q1|METK_STAA2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081736|sp|A5ITV6|METK_STAA9 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|54037784|sp|P66767|METK_STAAN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|54041552|sp|P66766|METK_STAAM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|13701583|dbj|BAB42876.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus N315] >gi|14247562|dbj|BAB57952.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|147741331|gb|ABQ49629.1| methionine adenosyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149946783|gb|ABR52719.1| Methionine adenosyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156722241|dbj|BAF78658.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus Mu3] (398 aa)
Score = 885, Expect = 3.8e-93, Identities = 180/372 (48%), Positives = 255/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-------DNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKI DQ+SDA+LD  LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     I++ ++ QS +I   V+K       D++      GAGDQG+++GYAT+E E +MPL I ++H L K    V  +  +++++ D K QVT++Y ++ NP +ID I++S QH+ + T E I+    A + +     NL N   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ A+DTFGT K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKVEE+ +  K
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK 397
>gi|147679094|ref|YP_001213309.1| S-adenosylmethionine synthetase [Pelotomaculum thermopropionicum SI] >gi|189081723|sp|A5CYJ7|METK_PELTS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|146275191|dbj|BAF60940.1| S-adenosylmethionine synthetase [Pelotomaculum thermopropionicum SI] (396 aa)
Score = 885, Expect = 3.8e-93, Identities = 165/367 (44%), Positives = 252/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI-------------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISDAVLD   ++DP ++VACE      L+++ GEITT  YVD+ ++A   +  +GY  + +        +I++++ QS++I   V++  ++             GAGDQG+++GYAT E    MPLPI++AH L +   +V  +  + +++ D K+QVT++Y + +  ++D I++S QH    T + I S     ++  VV    L+   +  +N +G+F IGGP GDTGLTGRK++VDTYG +A+HGGG+FSGKD TKVDRS +Y ARY+AKNIVAA LA+KCE Q+++AIG + P++  VDTFGT +  ++ + +++   FD    + I++ ++R PIY   S YGHFGR +L+  WE+ DK E +
  S:     3 RRLFTSESVTEGHPDKIADQISDAVLDAIFEKDPLARVACETLVTTGLVLVAGEITTDCYVDIPRVARETIREIGYTRAKYGFDCDTCAVITSIDEQSSDIAQGVDRALEVRERYGNEDELEATGAGDQGMMFGYATTETPELMPLPISLAHRLARRLAEVRKSRLLPYLRPDGKTQVTVEYENGRPVRVDTIVISTQHHPRVTLDEIRSGVLEHVVKPVVPPEFLDGSTRFFVNPTGRFVIGGPQGDTGLTGRKIIVDTYGGMARHGGGSFSGKDPTKVDRSASYAARYVAKNIVAAGLAEKCEFQVAYAIGVAHPVSMMVDTFGTGRVDEQTLVKLVKEHFDLRPAAIIKELDLRRPIYRQVSVYGHFGRNDLDLPWERTDKAEAL 390
>gi|49484032|ref|YP_041256.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749226|sp|Q6GFR6|METK_STAAR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|49242161|emb|CAG40861.1| S-adenosylmethionine synthetase [Staphylococcus aureus subsp. aureus MRSA252] (397 aa)
Score = 885, Expect = 3.8e-93, Identities = 180/372 (48%), Positives = 255/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK-------DNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDKI DQ+SDA+LD  LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     I++ ++ QS +I   V+K       D++      GAGDQG+++GYAT+E E +MPL I ++H L K    V  +  +++++ D K QVT++Y ++ NP +ID I++S QH+ + T E I+    A + +     NL N   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ A+DTFGT K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKVEE+ +  K
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK 397
>gi|42783960|ref|NP_981207.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 10987] >gi|60390048|sp|Q72YV6|METK_BACC1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|42739890|gb|AAS43815.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 10987] (399 aa)
Score = 885, Expect = 3.9e-93, Identities = 171/369 (46%), Positives = 255/369 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKE 395
>gi|88858385|ref|ZP_01133027.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Pseudoalteromonas tunicata D2] >gi|88820002|gb|EAR29815.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Pseudoalteromonas tunicata D2] (383 aa)
Score = 884, Expect = 4.7e-93, Identities = 171/367 (46%), Positives = 248/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E E  MP PI  +H LV+   QV  +  + +++ D KSQVT  Y + +   ID +++S QH    ++ + IE+    II  V+    ++S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA KCE+Q+S+AIG ++P + +V+TFGTSK  + ++ E+I   FD      I+  ++  PIY P + YGHFGR E    WE+ DK + +
  S:     3 RHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAILNTIGKQSPDINQGVDRKSPEEQGAGDQGLMFGYACNETEVLMPAPITYSHRLVQRQAQVRKDGTLPWLRPDAKSQVTFAYENGKPVAIDAVVLSTQHCDTISQADLIEAVMETIIKPVLPAELISSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADKCELQVSYAIGVAEPTSISVETFGTSKLEESRLIELIREHFDLRPYGLIQMLDLERPIYLPTAAYGHFGRDEFP--WEKTDKADAL 377
>gi|118725919|ref|ZP_01574553.1| Methionine adenosyltransferase [Clostridium cellulolyticum H10] >gi|118664618|gb|EAV71246.1| Methionine adenosyltransferase [Clostridium cellulolyticum H10] (396 aa)
Score = 884, Expect = 4.8e-93, Identities = 170/362 (46%), Positives = 250/362 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLD 365
           +++ TSESV +GHPDKICDQISDAVLD   ++DP ++VACE      ++++ GEITT  YVD+ K+  N +  +GYD + +        ++++++ QS++I   V+K                IGAGDQG+++G+A DE    MP+PI +AH L     +V  N K+ +++ D KSQVT++Y   +  ++D +++S QH  + + ++IE      +I  V+ +  L+   K  IN +G+F +GGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVA+ +A+KCEVQL++AIG +KP++  VDTFGT+   +E+I E++   FD    + I K N+R PIY   + YGHFGR +    WE+ D
  S:     3 KRLFTSESVTEGHPDKICDQISDAVLDAIYEKDPQARVACETAVTTGMVMVMGEITTNCYVDIPKVVRNTIREIGYDRAKYGFDCDTCAVMTSIDEQSSDIAMGVDKALEAKVGEMSEEQVQAIGAGDQGMMFGFACDETPELMPMPIILAHKLTMKLSEVRKNGKVKYLRPDGKSQVTVEYDGDKPVRVDTVVISTQHGADVSHDTIEKDIMEHVIIPVIPRELLDEGTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVASGIARKCEVQLAYAIGVAKPVSVLVDTFGTAVIPEEKISELVNKHFDLRPAAIINKLNLRRPIYRKTAAYGHFGRDDAEFSWEKTD 385
>gi|167630199|ref|YP_001680698.1| s-adenosylmethionine synthetase [Heliobacterium modesticaldum Ice1] >gi|167592939|gb|ABZ84687.1| s-adenosylmethionine synthetase [Heliobacterium modesticaldum Ice1] (397 aa)
Score = 884, Expect = 5.0e-93, Identities = 166/370 (44%), Positives = 256/370 (69%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  +++ TSESV +GHPDK+ DQISD+VLD  L QDP ++VACE      L+++ GEITT  YVD+ K+    +  +GY  + F        ++++++ QS +I   V+K          +++I   GAGDQG+++GYAT+E E +MP+PI++AH L +   +V    ++++++ D K+QVT++Y   +  ++D +++S QHS   + ++I +     +I  ++    L+   +  IN +G+F IGGP GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY AR++AKN+VAA LA +CE+QL++AIG + P++  V+TFGT+K  +  I + +   FD      I++  +R PIY   + YGHFGR +L+  WE+LDKVE +
  S:     1 MSRKRLFTSESVTEGHPDKVADQISDSVLDAILAQDPMARVACETSVTTGLVLVAGEITTKCYVDIPKVVRQTIREIGYTRAKFGFDCETCAVLTSIDEQSPDIAMGVDKALEARTGEMSESEIEATGAGDQGMMFGYATNETEEYMPMPISLAHKLARRLSEVRKTAELEYLRPDGKTQVTVEYDGDKPVRVDTVVISAQHSPEVSLDTIKQDLIERVILPIIPPGLLDDKTRYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAARHVAKNVVAAGLADRCEIQLAYAIGVAHPVSVLVETFGTAKVDEASIEKWVKEVFDLRPAGIIKELQLRRPIYRQTAAYGHFGRVDLDLPWERLDKVEAL 391
>gi|168144394|ref|ZP_02587623.1| S-adenosylmethionine synthetase [Bacillus cereus G9842] (399 aa)
Score = 883, Expect = 5.2e-93, Identities = 171/369 (46%), Positives = 254/369 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKE 395
>gi|167559738|ref|ZP_02352743.1| hypothetical protein Sententeri_23173 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (384 aa)
Score = 883, Expect = 5.7e-93, Identities = 171/365 (46%), Positives = 249/365 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE++DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPAEQLILLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKIDKAQ 375
>gi|161507945|ref|YP_001577909.1| S-adenosylmethionine synthetase [Lactobacillus helveticus DPC 4571] >gi|172048351|sp|A8YWU7|METK_LACH4 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|160348934|gb|ABX27608.1| S-adenosylmethionine synthetase [Lactobacillus helveticus DPC 4571] (399 aa)
Score = 883, Expect = 5.8e-93, Identities = 169/372 (45%), Positives = 256/372 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           R++ TSESV +GHPDK+ DQISDA+LD  L++DPNS VACE      ++ + GEI+T  YVD+  +    ++ +GYD  +         ++ +++ QS +I   V+               +QIGAGDQG+++G+A  E    MPLPI++AH L++    +  +  +D+++ D K+QVT++Y ++ NP ++D +++S Q     + + I     A+ID V+K+      L+   K +IN SG+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CEVQL++AIG + P++  +DT GT K  D+ + E + + FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK +++L++ K
  S:     3 RRLFTSESVSEGHPDKVADQISDAILDAMLEKDPNSHVACETIVTTGMVFVFGEISTNAYVDIQDVVRKTILRIGYDRPELGFDGNNCAVMVDIDEQSPDIAGGVDHSLETRENESDQDELDQIGAGDQGLMFGFAIKETPELMPLPISLAHRLMRRVASLRKDHTLDWLRPDAKAQVTVEYDENNNPLRVDTVVISTQTDAEVSNKEIR---RAMIDLVIKEVIPARYLDEKTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDSTKVDRSASYAARYVAKNIVAAGLAYRCEVQLAYAIGVAHPVSIMIDTAGTGKVDDDLLTEAVRHVFDLRPAGIIKMLDLRRPIYEQTAAYGHFGRTDVDLSWEKTDKTQDLLDYIK 396
>gi|53802578|ref|YP_112678.1| S-adenosylmethionine synthetase [Methylococcus capsulatus str. Bath] >gi|60389919|sp|Q60CG7|METK_METCA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|53756339|gb|AAU90630.1| S-adenosylmethionine synthetase [Methylococcus capsulatus str. Bath] (389 aa)
Score = 883, Expect = 5.9e-93, Identities = 166/367 (45%), Positives = 248/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           I TSESV +GHPDKI DQ+SDAVLD  L QDP ++VA E      ++V+ GE+TT+ +VD  ++   V+  +GYD  +         +++ +  QS +I   V++  D++ GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  +  + +++ D KSQVT  Y + +   +D +++S QH+ +  ++ I E+    II  V+ +  L+ D K  IN +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA++CE+Q+S+AIG ++P + +++TFGT + ++E + +++   FD   K  I   ++  PIY P + YGHFGRTE    WE+ DK + + E
  S:     6 IFTSESVSEGHPDKIADQVSDAVLDAILAQDPKARVAVETLVKTGMVVLAGEVTTSAWVDTEELVRKVVHEIGYDNPEIGFDWQSCAVLTAIGKQSPDIAMGVDEFDDHEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKHKVLPWLRPDAKSQVTFRYEEGKPVAVDAVVLSTQHAPDVAQKDIREAVMEEIIYHVLPREWLHKDTKYFINPTGSFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYMGRYVAKNIVAAGLAERCEIQVSYAIGVAEPTSISIETFGTGRIAEETLVKLVREHFDLRPKGLITMLDLLRPIYRPTAAYGHFGRTEGTFTWERTDKADLLRE 382
>gi|153206925|ref|ZP_01945743.1| methionine adenosyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|120576998|gb|EAX33622.1| methionine adenosyltransferase [Coxiella burnetii 'MSU Goat Q177'] (393 aa)
Score = 883, Expect = 6.1e-93, Identities = 167/367 (45%), Positives = 249/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+ DQISDAVLD  + QDPN +VACE    + ++ + GEITT  + DV ++  N ++ +GY++           +++ +  QS +I   V+  +D ++GAGDQG+++GYA+ E + FMP PI  AH LV+    +  N ++ +++ D KSQVT+ Y + +    D I++S QHS   ++ES+ E+  + II  ++  + L+   + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRSGAY ARY+AKNIVA  LA +CE+Q+S+AIG ++P + +V+TFGT K  + +I ++I   FD      IE+ N+   IY   +TYGHFGR E    WE+ DK E + E
  S:     6 LFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGEACAVVTAIGKQSPDIVMGVDGREDQELGAGDQGLMFGYASRETDVFMPAPITYAHRLVRQQALLRKNGRLPWLRPDAKSQVTLRYENGKPVAADCIVLSTQHSPEISQESLREAVIDEIIKPIMPPHWLDKHTRFLVNPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSGAYAARYVAKNIVAGGLADRCEIQVSYAIGVAEPTSISVETFGTGKIDEVRIQQLIKEHFDLRPGKIIEELNLLRSIYKATATYGHFGREEPEFTWERTDKAEILRE 382
>gi|160947407|ref|ZP_02094574.1| hypothetical protein PEPMIC_01341 [Peptostreptococcus micros ATCC 33270] >gi|158446541|gb|EDP23536.1| hypothetical protein PEPMIC_01341 [Peptostreptococcus micros ATCC 33270] (400 aa)
Score = 883, Expect = 6.2e-93, Identities = 185/370 (50%), Positives = 263/370 (71%)
  Q:     1 MELRKIM-TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++++K++ TSESV +GHPDKICDQ+SDA+LDE LK DP ++VACE      ++++ GEITT+ YVD+  +  NVL  +GY       D S  ++++++N QS +I   V+           K N +GAGDQG+++GYA  E + FMPLPI +AH L K    V  N  + +++ D KSQVT++Y D    +I+ I++S QHS +   E I+      +ID V+ +Y ++ + K  +N +G+F IGGP+GD+GLTGRKL+VDTYG   +HGGGAFSGKD TKVDRS  Y ARYIAKNIVA+ + +K E+ +S+AIG +KP++  VDTFGT K SD++I EII   FD    + I+  ++R PIY   + YGHFGR +L+  WE+LDKVE+I
  S:     7 VKMKKVLFTSESVTEGHPDKICDQVSDAILDEILKVDPVARVACETLTTTGIVMVVGEITTSQYVDIQSIVRNVLKEIGYTRAKFGFDASTCSVVTSINEQSRDIALGVDSALEYKNGNEDKYNSVGAGDQGMMFGYACTETDEFMPLPITLAHKLSKRLSYVRKNDILGYLRPDGKSQVTVEYIDGVPSRIEAIVVSTQHSPSVKLEQIQKDIKEFVIDEVIPEYLIDENTKIYVNPTGRFEIGGPMGDSGLTGRKLIVDTYGGFGRHGGGAFSGKDPTKVDRSATYMARYIAKNIVASGICEKLEIGISYAIGVAKPLSIYVDTFGTGKISDDRIIEIINKVFDLRPAAIIDTLDLRRPIYRQIAAYGHFGRNDLDLPWEKLDKVEDI 396
>gi|161831401|ref|YP_001595948.1| S-adenosylmethionine synthetase [Coxiella burnetii RSA 331] >gi|165918198|ref|ZP_02218284.1| methionine adenosyltransferase [Coxiella burnetii RSA 334] >gi|189081710|sp|A9N9E2|METK_COXBR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|161763268|gb|ABX78910.1| methionine adenosyltransferase [Coxiella burnetii RSA 331] >gi|165918058|gb|EDR36662.1| methionine adenosyltransferase [Coxiella burnetii RSA 334] (393 aa)
Score = 883, Expect = 6.7e-93, Identities = 167/367 (45%), Positives = 249/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+ DQISDAVLD  + QDPN +VACE    + ++ + GEITT  + DV ++  N ++ +GY++           +++ +  QS +I   V+  +D ++GAGDQG+++GYA+ E + FMP PI  AH LV+    +  N ++ +++ D KSQVT+ Y + +    D I++S QHS   ++ES+ E+  + II  ++  + L+   + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRSGAY ARY+AKNIVA  LA +CE+Q+S+AIG ++P + +V+TFGT K  + +I ++I   FD      IE+ N+   IY   +TYGHFGR E    WE+ DK E + E
  S:     6 LFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDGREDQELGAGDQGLMFGYASRETDVFMPAPITYAHRLVRQQALLRKNGRLPWLRPDAKSQVTLRYENGKPVAADCIVLSTQHSPEISQESLREAVIDEIIKPIMPPHWLDKHTRFLVNPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSGAYAARYVAKNIVAGGLADRCEIQVSYAIGVAEPTSISVETFGTGKIDEVRIQQLIKEHFDLRPGKIIEELNLLRSIYKATATYGHFGREEPEFTWERTDKAEILRE 382
>gi|5912312|emb|CAB56109.1| S-adenosylmethionine synthetase [Rickettsia typhi] (382 aa)
Score = 883, Expect = 6.7e-93, Identities = 174/363 (47%), Positives = 246/363 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH-SQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDKI DQISDAVLDE LK DPN +VACE F    L+++GGEITT  YVD+ ++  N +  +GY+   +        +IS++  QS +I   ++  N+  IGAGDQG+V+GYA +E ++ MP PI  AH L+K    +     + +++ D KSQVT+ Y +++   ID +++S QH  +   K+ IE+    II   +  + L+ D K +IN +G+F IGGP+ D GLTGRK++VD+YG +AKHGGG FSGKD TK+DRS AY ARYIAKNIV + LA +CE+Q+S+AIG + P++   +TFGTSK S+EQ  ++I   FD      I+   + +  Y   ++YGHFGR + N  WEQLDKV+
  S:     5 VFTSESVSEGHPDKIADQISDAVLDEILKHDPNGRVACETFVTTGLVLVGGEITTNTYVDIEQVVRNKIHEIGYNNPSYGFDGSCCAVISSIVKQSPDIAMGIDNANEEEIGAGDQGMVFGYACNETKSLMPAPIYYAHLLMKRQAYLRKQNILSWLRPDAKSQVTLRYENNKPIVIDSVVLSTQHHPEIQQKDLIEAVIEEIIKPTLPTHLLHKDTKYLINPTGRFVIGGPVADCGLTGRKIIVDSYGGMAKHGGGCFSGKDPTKIDRSAAYMARYIAKNIVGSGLADRCEIQISYAIGVASPVSVYAETFGTSKLSNEQTTKLITEHFDMRPGKIIKNLKLHTQCYQKTASYGHFGREDENFTWEQLDKVD 377
>gi|29375375|ref|NP_814529.1| S-adenosylmethionine synthetase [Enterococcus faecalis V583] >gi|33301255|sp|Q837P9|METK_ENTFA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|29342835|gb|AAO80599.1| S-adenosylmethionine synthetase [Enterococcus faecalis V583] (394 aa)
Score = 882, Expect = 7.1e-93, Identities = 175/370 (47%), Positives = 250/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R + TSESV +GHPDK+ DQ+SDA+LD  L++DP ++VACE      L+++ GEI+T  YVD+ K+    +  +GY  + +        ++  ++ QS +I   V          EKD+ IGAGDQG+++G+A DE    MPLPI ++H LV+   ++     + +++ D KSQVT++Y D   P ++D I++S QH    T E IE      +I+ V+    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++ +++TFGTS   + ++ E +   FD      IE  ++R PIY   + YGHFGRT+++  WEQ DKVE +
  S:     1 MTERHLFTSESVSEGHPDKVADQVSDAILDAILEKDPMARVACETSVTTGLVLVFGEISTTAYVDIQKIVRQTVKDIGYTRAKYGFDGETVAVLVAIDEQSPDIAQGVDAALEVRDQDEKDD-IGAGDQGLMFGFAVDETPELMPLPIALSHRLVRRLAELRKEKVLPYLRPDAKSQVTVEYDDQGQPQRVDTIVISTQHDDETTLEQIEKDIKEQVINEVIPHELLDDETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKVEVQLAYAIGVAQPVSISINTFGTSDLPESKLIEAVRKNFDLRPAGIIEMLDLRRPIYKQTAAYGHFGRTDIDLPWEQTDKVEAL 388
>gi|58337882|ref|YP_194467.1| S-adenosylmethionine synthetase [Lactobacillus acidophilus NCFM] >gi|75507553|sp|Q5FIN8|METK_LACAC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|58255199|gb|AAV43436.1| S-adenosylmethionine synthetase [Lactobacillus acidophilus NCFM] (399 aa)
Score = 882, Expect = 8.1e-93, Identities = 173/372 (46%), Positives = 258/372 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE---------KDN----QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCNAIIDFVVK-----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +++ TSESV +GHPDK+ DQISDA+LD  LK+DPNS VACE      ++ + GEI+T+ YVD+  +    ++ +GYD  +         ++ +++ QS +I + V+          DN    QIGAGDQG+++G+A  E    MPLPI+++H L++    +  +  +++++ D K+QVT++Y ++  P  +D +++S Q     + E I   C A+ID V+K     KY L+ + K +IN SG+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CEVQL++AIG + P++  +DT GT    DE + E + N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK + +L++ K
  S:     3 KRLFTSESVSEGHPDKVADQISDAILDAMLKKDPNSHVACETIVTTGMVFVFGEISTSAYVDIQDVVRKTILKIGYDRPELGFDGNNCAVMVDIDEQSPDIADGVDHSLETRENKSDNDELDQIGAGDQGLMFGFAIKETPELMPLPISLSHRLMRRVASLRKDHTLEWLRPDAKAQVTVEYDENGKPLCVDTVVISTQTDAEVSNEEI---CRAMIDLVIKEVIPAKY-LDENTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLAYRCEVQLAYAIGVAHPVSIMIDTAGTGTVDDELLTEAVRNVFDLRPAGIIKMLDLRRPIYEQTAAYGHFGRTDVDLPWEKTDKTQALLDYIK 396
>gi|146312985|ref|YP_001178059.1| S-adenosylmethionine synthetase [Enterobacter sp. 638] >gi|167011755|sp|A4WE78|METK_ENT38 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|145319861|gb|ABP62008.1| methionine adenosyltransferase [Enterobacter sp. 638] (384 aa)
Score = 882, Expect = 8.2e-93, Identities = 172/363 (47%), Positives = 246/363 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS++  ++S+ E+    II  V+    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGSLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDIDQKSLQEAVMEEIIKPVLPTEWLNASTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKLPTEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDK 373
>gi|113969116|ref|YP_732909.1| S-adenosylmethionine synthetase [Shewanella sp. MR-4] >gi|114048741|ref|YP_739291.1| S-adenosylmethionine synthetase [Shewanella sp. MR-7] >gi|117921792|ref|YP_870984.1| S-adenosylmethionine synthetase [Shewanella sp. ANA-3] >gi|123130724|sp|Q0HM65|METK_SHESM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123131097|sp|Q0HRM1|METK_SHESR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158512323|sp|A0L0K9|METK_SHESA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|113883800|gb|ABI37852.1| S-adenosylmethionine synthetase [Shewanella sp. MR-4] >gi|113890183|gb|ABI44234.1| S-adenosylmethionine synthetase [Shewanella sp. MR-7] >gi|117614124|gb|ABK49578.1| S-adenosylmethionine synthetase [Shewanella sp. ANA-3] (383 aa)
Score = 881, Expect = 9.1e-93, Identities = 173/367 (47%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y D++   ID I++S QHS + A  + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT K S+E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DK + +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYASNETDILMPAPITYAHALVKRQSEVRKDGTLPWLRPDAKSQVTFAYEDNKIVGIDAIVLSTQHSPDIAQADLIEGVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISVETFGTGKVSEEVLIKLVRQHFDLRPYGLTEMLNLARPIYQATAAYGHFGRNEFP--WEATDKADAL 377
>gi|29655311|ref|NP_821003.1| methionine adenosyltransferase [Coxiella burnetii RSA 493] >gi|33301257|sp|Q83A78|METK_COXBU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|29542583|gb|AAO91517.1| S-adenosylmethionine synthetase [Coxiella burnetii RSA 493] (393 aa)
Score = 881, Expect = 9.8e-93, Identities = 167/367 (45%), Positives = 248/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+ DQISDAVLD  + QDPN +VACE    + ++ + GEITT  + DV ++  N ++ +GY++           +++ +  QS +I   V+  +D ++GAGDQG+++GYA+ E   FMP PI  AH LV+    +  N ++ +++ D KSQVT+ Y + +    D I++S QHS   ++ES+ E+  + II  ++  + L+   + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRSGAY ARY+AKNIVA  LA +CE+Q+S+AIG ++P + +V+TFGT K  + +I ++I   FD      IE+ N+   IY   +TYGHFGR E    WE+ DK E + E
  S:     6 LFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDGREDQELGAGDQGLMFGYASRETNVFMPAPITYAHRLVRQQALLRKNGRLPWLRPDAKSQVTLRYENGKPVAADCIVLSTQHSPEISQESLREAVIDEIIKPIMPPHWLDKHTRFLVNPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSGAYAARYVAKNIVAGGLADRCEIQVSYAIGVAEPTSISVETFGTGKIDEVRIQQLIKEHFDLRPGKIIEELNLLRSIYKATATYGHFGREEPEFTWERTDKAEILRE 382
>gi|119946833|ref|YP_944513.1| S-adenosylmethionine synthetase [Psychromonas ingrahamii 37] >gi|158513122|sp|A1SZJ9|METK_PSYIN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|119865437|gb|ABM04914.1| methionine adenosyltransferase [Psychromonas ingrahamii 37] (382 aa)
Score = 881, Expect = 1.1e-92, Identities = 178/367 (48%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLD  LKQD  ++VACE +    ++++GGEITT  +VD+ ++  N +  +GY  S+         I++ +  QS +I   V++ +  + GAGDQG+++GYAT+E + FMP PI  AH LVK   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS++  +E  +E+    II  V+    L+   K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT K   + I ++I   FD      IE  N+  PIY   + YGHFGR E    WE LDKVE +
  S:     3 RDLFTSESVSEGHPDKIADQISDAVLDAILKQDKKARVACETYVKTGMVMVGGEITTDAWVDIEEITRNTVRNIGYTSSEMGFDADSCAILNVIGKQSPDINQGVDRSDPREQGAGDQGLMFGYATNETDVFMPAPITYAHHLVKRQAKVRKNKTLPWLRPDAKSQVTFAYDHGKIVGIDAVVLSTQHSEDIKQEDLVEAVMEEIIKPVLPAEWLSERTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISVETFGTEKVKKDLIIQLIREHFDLRPYGLIEMLNLIQPIYQSTAAYGHFGRNEFP--WEALDKVEAL 377
>gi|161616052|ref|YP_001590017.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|161365416|gb|ABX69184.1| hypothetical protein SPAB_03853 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (388 aa)
Score = 881, Expect = 1.1e-92, Identities = 171/365 (46%), Positives = 248/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK +
  S:     7 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPAEQLILLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKTDKAQ 379
>gi|16761865|ref|NP_457482.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766391|ref|NP_462006.1| S-adenosylmethionine synthetase [Salmonella typhimurium LT2] >gi|29143352|ref|NP_806694.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415028|ref|YP_152103.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181600|ref|YP_218017.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167545349|ref|ZP_02340918.1| hypothetical protein Sentent_18844 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167553204|ref|ZP_02346954.1| hypothetical protein Sentente_22142 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167990384|ref|ZP_02571484.1| hypothetical protein Sententer_01000002_0100003000 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168225783|ref|ZP_02651014.1| hypothetical protein Sententeric_08418 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234360|ref|ZP_02659418.1| hypothetical protein Sententerica_25497 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168236158|ref|ZP_02661216.1| hypothetical protein Senteenterica_08198 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168264465|ref|ZP_02686438.1| hypothetical protein Salmentericaenterica_25608 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463724|ref|ZP_02697641.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478132|ref|ZP_02707155.1| hypothetical protein Salmoentericaenterica_26076 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168819881|ref|ZP_02831881.1| hypothetical protein Salentericaenterica_10883 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194443932|ref|YP_002042348.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194470071|ref|ZP_03076055.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194733921|ref|YP_002116037.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|54037783|sp|P66765|METK_SALTI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|54041551|sp|P66764|METK_SALTY S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|60389899|sp|Q5PJJ2|METK_SALPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|75505562|sp|Q57K26|METK_SALCH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|25287057|pir||AB0877 S-adenosylmethionine synthetase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16421643|gb|AAL21965.1| methionine adenosyltransferase 1 [Salmonella typhimurium LT2] >gi|16504167|emb|CAD02914.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138986|gb|AAO70554.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129285|gb|AAV78791.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129233|gb|AAX66936.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|194402595|gb|ACF62817.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194456435|gb|EDX45274.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194709423|gb|ACF88644.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633475|gb|EDX51889.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (384 aa)
Score = 880, Expect = 1.2e-92, Identities = 171/365 (46%), Positives = 248/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPAEQLILLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKTDKAQ 375
>gi|109899636|ref|YP_662891.1| S-adenosylmethionine synthetase [Pseudoalteromonas atlantica T6c] >gi|123170793|sp|Q15QK1|METK_PSEA6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109701917|gb|ABG41837.1| methionine adenosyltransferase [Pseudoalteromonas atlantica T6c] (383 aa)
Score = 880, Expect = 1.4e-92, Identities = 170/367 (46%), Positives = 248/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK---DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  LKQDP ++VACE +    ++++GGE+TT  +VD+ ++  N +  +GY  SD         +++ +  QS +I   V++   ++Q GAGDQG+++GYA+DE +  MP P+  AH LVK   ++  + ++D+++ D KSQVT  Y D+    ID +++S QH  + T E + E+    II  V+    L +  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LAK+CE+Q+S+AIG ++P +  V+TFGT + SDE +  ++   F+      I+  ++  PIY   + YGHFGR E    WE+ DK + +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILKQDPKARVACETYVKTGMVMVGGEVTTNAWVDIEELTRNTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRTRPEDQ-GAGDQGLMFGYASDETDVLMPAPVTYAHRLVKRQAEIRKSGQLDWLRPDAKSQVTFVYEDNVPVGIDAVVLSTQHCDSVTTEQLREAVMEEIIKPVLPAKWLTAQTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAKRCEIQISYAIGVAEPTSINVETFGTGQVSDEVLTTLVREHFELRPYGLIKMLDLERPIYQATAAYGHFGREEFP--WEKTDKADAL 377
>gi|157148491|ref|YP_001455810.1| S-adenosylmethionine synthetase [Citrobacter koseri ATCC BAA-895] >gi|166201386|sp|A8APG1|METK_CITK8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157085696|gb|ABV15374.1| hypothetical protein CKO_04317 [Citrobacter koseri ATCC BAA-895] (384 aa)
Score = 879, Expect = 1.6e-92, Identities = 170/365 (46%), Positives = 246/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH++   ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEEIDQKSLQEAVMEEIIKPILPSEWLNASTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 375
>gi|170725238|ref|YP_001759264.1| methionine adenosyltransferase [Shewanella woodyi ATCC 51908] >gi|169810585|gb|ACA85169.1| Methionine adenosyltransferase [Shewanella woodyi ATCC 51908] (384 aa)
Score = 879, Expect = 1.6e-92, Identities = 172/367 (46%), Positives = 252/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDY-ADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++  N +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E + FMP PI  +H LVK   +V  +  + +++ D KSQVT  Y +D     ID +++S QHS++ T+ + IE    +II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT+K ++E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DKVE +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRNTVREIGYTHSDMGFDADSCAILNVIGKQSPDINQGVDRADPKEQGAGDQGLMFGYANNETDVFMPAPITYSHMLVKRQSEVRKDKTLPWLRPDAKSQVTFAYNSDGSIAGIDAVVLSTQHSEDVTQADLIEGVMESIIKPVLPAKWLSKETKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTAKVAEELLIDLVRRHFDLRPYGLTEMLNLARPIYKSTAAYGHFGREEFP--WEATDKVEAL 378
>gi|168221624|ref|ZP_02646856.1| hypothetical protein Senterenterica_14606 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (384 aa)
Score = 879, Expect = 1.7e-92, Identities = 170/365 (46%), Positives = 248/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPAEQLILLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKTDKAQ 375
>gi|154705812|ref|YP_001425435.1| S-adenosylmethionine synthetase [Coxiella burnetii Dugway 5J108-111] >gi|189081709|sp|A9KD87|METK_COXBN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|154355098|gb|ABS76560.1| methionine adenosyltransferase [Coxiella burnetii Dugway 5J108-111] (393 aa)
Score = 879, Expect = 1.8e-92, Identities = 166/367 (45%), Positives = 248/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+ DQISDAVLD  + QDPN +VACE    + ++ + GEITT  + DV ++  N ++ +GY++           +++ +  QS +I   V+  +D ++GAGDQG+++GYA+ E + FMP PI  AH LV+    +  N ++ +++ D KSQVT+ Y + +    D I++S QHS   ++ES+ E+  + II  ++  + L+   + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRSGAY ARY+AKNIVA  LA +CE+Q+S+AIG ++P + +V+TFGT K  + +  ++I   FD      IE+ N+   IY   +TYGHFGR E    WE+ DK E + E
  S:     6 LFTSESVSEGHPDKVADQISDAVLDALISQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDGREDQELGAGDQGLMFGYASRETDVFMPAPITYAHRLVRQQALLRKNGRLPWLRPDAKSQVTLRYENGKPVAADCIVLSTQHSPEISQESLREAVIDEIIKPIMPPHWLDKHTRFLVNPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSGAYAARYVAKNIVAGGLADRCEIQVSYAIGVAEPTSISVETFGTGKIDEVRTQQLIKEHFDLRPGKIIEELNLLRSIYKATATYGHFGREEPEFTWERTDKAEILRE 382
>gi|168242892|ref|ZP_02667824.1| hypothetical protein Senterienterica_14721 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194448947|ref|YP_002047077.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194407251|gb|ACF67470.1| S-adenosylmethionine synthetase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (384 aa)
Score = 879, Expect = 1.9e-92, Identities = 171/365 (46%), Positives = 248/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILQQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPSEWLNTSTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPVEQLILLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGRE--NFPWEKTDKAQ 375
>gi|169334773|ref|ZP_02861966.1| hypothetical protein ANASTE_01179 [Anaerofustis stercorihominis DSM 17244] >gi|169257511|gb|EDS71477.1| hypothetical protein ANASTE_01179 [Anaerofustis stercorihominis DSM 17244] (387 aa)
Score = 878, Expect = 2.1e-92, Identities = 176/370 (47%), Positives = 257/370 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK--------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           +   TSESV KGHPDKICDQISD+VLD  + QDP ++VACE      L+++ GEITT+GYVD+ K+    +  +GY       D S   IIS+++ QS++I   V K        + + GAGDQG+++G+A +E E +MPLPI++A+ L     +V  +  +D+++ D K+QVT++Y   +  ++D I++S QH +  + ++I E   N ++  V+ +  L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVA+ +  K E+++++AIG ++P++  V+T+GTSK SDE+I EII   FD      IE  ++R PIY   + YGHFGR E    WE+LDK E + ++
  S:     3 KHFFTSESVTKGHPDKICDQISDSVLDAIIAQDPYARVACECAVNTGLVLVMGEITTSGYVDISKIVRKTIKDIGYTRAKYGFDGSTCGIISSIDEQSSDIAMGVNKSLDSDDSTEEENGAGDQGIMFGFACNETEEYMPLPISLANKLAFKLTEVREDGTLDYLRPDGKTQVTVEYDGDKPVRVDTIVISTQHDEKVSLDTIKEDMINHVVKAVIDESLLDENTKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYMARYIAKNIVASGICDKIEIEVAYAIGVARPVSIYVNTYGTSKLSDEKIVEIINENFDLRPTRIIEHLDLRRPIYRKTAAYGHFGRNEFP--WEKLDKAEVLKKY 386
>gi|134300927|ref|YP_001114423.1| methionine adenosyltransferase [Desulfotomaculum reducens MI-1] >gi|172044347|sp|A4J945|METK_DESRM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|134053627|gb|ABO51598.1| methionine adenosyltransferase [Desulfotomaculum reducens MI-1] (397 aa)
Score = 878, Expect = 2.2e-92, Identities = 172/367 (46%), Positives = 242/367 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDFKR-IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           RK+ TSESV +GHPDK+ DQISDA+LD  L +DP ++VACE F    L+++GGEI+   YVD+ K+    ++ +GY  + +        +++ ++ QS +I   V+K                IGAGDQG+++GYATDE    MPLPI++AH + +   +V     +D+++ D K+QVT++Y   +  +ID +++S QH      E+I       +   V    L  D  R +IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LAK+CEVQL++AIG + P++  V TFGT   SDE I ++I   FD      I+   +R PIY   + YGHFGR +L+  WE  DK + +
  S:     3 RKLFTSESVTEGHPDKVADQISDAILDSILAKDPMARVACETFVTTGLVLVGGEISCQCYVDIPKVVRETILEIGYTRAKYGFDGDTCAVLTAIDEQSPDIAMGVDKALEAKTGETTEAEIEAIGAGDQGMMFGYATDETPELMPLPISLAHTMARRLSEVRKTGIVDYLRPDGKTQVTVEYDGDKPSRIDTVVISTQHHPEVDLETIRKDMIEKVALHVLPAELVDDKTRFLINPTGRFVIGGPHGDAGLTGRKIIVDTYGGSARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLAKRCEVQLAYAIGVAHPVSVRVQTFGTGAVSDEVIIDLINRHFDLRPAGIIKSLELRRPIYKQTAAYGHFGRPDLDLPWECTDKADAL 390
>gi|90407129|ref|ZP_01215317.1| S-adenosylmethionine synthetase [Psychromonas sp. CNPT3] >gi|90311705|gb|EAS39802.1| S-adenosylmethionine synthetase [Psychromonas sp. CNPT3] (382 aa)
Score = 878, Expect = 2.3e-92, Identities = 177/367 (48%), Positives = 249/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLD  LKQD  ++VACE +    ++++GGEITT  +VD+ ++    +  +GY  S+         +++ +  QS +I   V++D+  + GAGDQG+++GYAT+E E +MP PI  AH LVK   +V  + K+ +++ D KSQVT  Y +     ID +++S QHS++ A K+ +E+    II  V+    L+   K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CE+Q+S+AIG ++P + +V+TFGT K S + I E+I   FD      I+  ++  PIY   + YGHFGR E    WE LDKVE +
  S:     3 RDLFTSESVSEGHPDKIADQISDAVLDAILKQDKKARVACETYVKTGMVMVGGEITTDAWVDIEEITRKTIRDIGYTSSEMGFDADSCAVLNVIGKQSPDINQGVDRDDPYEQGAGDQGLMFGYATNETEVYMPAPITYAHRLVKQQAEVRKSGKLGWLRPDAKSQVTFAYENGVIVGIDAVVLSTQHSEDIAHKDLVEAVMEEIIKPVLPAELLSKHTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGTARHGGGAFSGKDPSKVDRSAAYAARYVAKNLVAAGLADRCEIQISYAIGVAEPTSISVETFGTEKVSKDLIIELIRKHFDLRPYGLIKMLDLIQPIYLSTAAYGHFGREEFP--WEALDKVETL 377
>gi|157374012|ref|YP_001472612.1| S-adenosylmethionine synthetase [Shewanella sediminis HAW-EB3] >gi|189081734|sp|A8FRL1|METK_SHESH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157316386|gb|ABV35484.1| Methionine adenosyltransferase [Shewanella sediminis HAW-EB3] (383 aa)
Score = 878, Expect = 2.3e-92, Identities = 171/367 (46%), Positives = 244/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA +E E  MP PI  AH LVK   +V     + +++ D KSQVT  Y D +   ID I++S QH  + ++ + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S+E +  ++   FD       E  ++  PIY   + YGHFGR E    WE+ DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYANNETELLMPAPITYAHALVKRQSEVRKAKTLPWLRPDAKSQVTFAYEDHKIVGIDAIVLSTQHCDSVSQADLIEGVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTGKVSEEALIALVRQHFDLRPYGLTEMLDLARPIYQSTAAYGHFGRNEFP--WERTDKAEAL 377
>gi|152971893|ref|YP_001337002.1| S-adenosylmethionine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166201396|sp|A6TDV1|METK_KLEP7 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|150956742|gb|ABR78772.1| S-adenosylmethionine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (384 aa)
Score = 878, Expect = 2.5e-92, Identities = 170/369 (46%), Positives = 248/369 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QH+++  ++S+ E+    II  ++    LN+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK   + E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPTEWLNASTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAALLRE 379
>gi|119775892|ref|YP_928632.1| S-adenosylmethionine synthetase [Shewanella amazonensis SB2B] >gi|158513094|sp|A1S9A6|METK_SHEAM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|119768392|gb|ABM00963.1| Methionine adenosyltransferase [Shewanella amazonensis SB2B] (383 aa)
Score = 877, Expect = 2.6e-92, Identities = 170/367 (46%), Positives = 245/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         ++S +  QS +I   V++ +  + GAGDQG+++GYA++E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y + +   ID I++S QH  + ++   +E     II  VV    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K  ++++  ++   FD       E  N+  PIY   + YGHFGR E    WEQ +K E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLSAIGKQSPDINQGVDRADPREQGAGDQGLMFGYASNETDVLMPAPITYAHALVKRQSEVRKDGTLSWLRPDAKSQVTFAYDEGKIVGIDAIVLSTQHCDSVSQSDLVEGVMETIIKPVVPAQWLNKDTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTGKLPEDKLIALVRQHFDLRPYGLTEMLNLARPIYQATAAYGHFGRNEFP--WEQTNKAEAL 377
>gi|26109771|gb|AAN81976.1|AE016766_64 S-adenosylmethionine synthetase [Escherichia coli CFT073] >gi|91073898|gb|ABE08779.1| S-adenosylmethionine synthetase [Escherichia coli UTI89] (388 aa)
Score = 877, Expect = 2.8e-92, Identities = 171/365 (46%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     7 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 379
>gi|21672667|ref|NP_660734.1| S-adenosylmethionine synthetase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008737|sp|Q8K9E5|METK_BUCAP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21623304|gb|AAM67945.1| S-adenosylmethionine synthetase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (379 aa)
Score = 877, Expect = 2.8e-92, Identities = 174/367 (47%), Positives = 249/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDKI DQISDA+LDE +KQD  ++VACE +    +++IGGEITT  +VDV ++  N +  +GY       D +   ++S +  QS +I   V++ N +  GAGDQG+++GYAT+E E  MP PI  AH LVK   ++     + +++ D KSQVT  Y + +   ID ++ S QH ++ T++ + E+    II  V+    L  + K  IN +G+F IGGP+GD GLTGRK++VDTYG +++HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  ++TF T K S++ +  ++ N FD      IE  ++  PIY   + YGHFGR E    WE+LDKV+E+L+
  S:     5 LFTSESVSEGHPDKIADQISDALLDEIIKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRNTINNIGYINSETGFDANSCAVLSTIGKQSPDITQGVDRCNPLEQGAGDQGIIFGYATNETEVLMPAPITYAHLLVKKQSELRKKNILHWLRPDAKSQVTFKYKNGRIIGIDTVVFSTQHKESITQDVLKEAVMEEIIKPVLPNKWLTKNTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMSRHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGIAEPTSIMIETFRTGKISNKSLINLVRNIFDLRPYGLIEMLDLLRPIYLNTAVYGHFGREEFP--WEKLDKVDELLQ 379
>gi|15803481|ref|NP_289514.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 EDL933] >gi|15833072|ref|NP_311845.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. Sakai] >gi|16130843|ref|NP_417417.1| methionine adenosyltransferase 1 [Escherichia coli str. K-12 substr. MG1655] >gi|30064258|ref|NP_838429.1| S-adenosylmethionine synthetase [Shigella flexneri 2a str. 2457T] >gi|56480215|ref|NP_708707.2| S-adenosylmethionine synthetase [Shigella flexneri 2a str. 301] >gi|74313499|ref|YP_311918.1| S-adenosylmethionine synthetase [Shigella sonnei Ss046] >gi|82778286|ref|YP_404635.1| S-adenosylmethionine synthetase [Shigella dysenteriae Sd197] >gi|89109719|ref|AP_003499.1| methionine adenosyltransferase 1 [Escherichia coli W3110] >gi|110643090|ref|YP_670820.1| S-adenosylmethionine synthetase [Escherichia coli 536] >gi|110806850|ref|YP_690370.1| S-adenosylmethionine synthetase [Shigella flexneri 5 str. 8401] >gi|117625169|ref|YP_854157.1| S-adenosylmethionine synthetase [Escherichia coli APEC O1] >gi|157158353|ref|YP_001464293.1| S-adenosylmethionine synthetase [Escherichia coli E24377A] >gi|157162400|ref|YP_001459718.1| S-adenosylmethionine synthetase [Escherichia coli HS] >gi|161486127|ref|NP_755403.2| S-adenosylmethionine synthetase [Escherichia coli CFT073] >gi|162138378|ref|YP_542310.2| S-adenosylmethionine synthetase [Escherichia coli UTI89] >gi|168708490|ref|ZP_02740767.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4045] >gi|168718357|ref|ZP_02750634.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4206] >gi|168734455|ref|ZP_02766732.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4115] >gi|168747567|ref|ZP_02772589.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4113] >gi|168753893|ref|ZP_02778900.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4401] >gi|168760083|ref|ZP_02785090.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4501] >gi|168766948|ref|ZP_02791955.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4486] >gi|168773420|ref|ZP_02798427.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4196] >gi|168781800|ref|ZP_02806807.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4076] >gi|168785799|ref|ZP_02810806.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC869] >gi|168791755|ref|ZP_02816762.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4042] >gi|168797516|ref|ZP_02822523.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC508] >gi|170018817|ref|YP_001723771.1| non-specific protein-tyrosine kinase [Escherichia coli ATCC 8739] >gi|170082496|ref|YP_001731816.1| methionine adenosyltransferase 1 [Escherichia coli str. K12 substr. DH10B] >gi|170681721|ref|YP_001745103.1| S-adenosylmethionine synthetase [Escherichia coli SMS-3-5] >gi|188492685|ref|ZP_02999955.1| S-adenosylmethionine synthetase [Escherichia coli 53638] >gi|191167939|ref|ZP_03029742.1| S-adenosylmethionine synthetase [Escherichia coli B7A] >gi|191171869|ref|ZP_03033415.1| S-adenosylmethionine synthetase [Escherichia coli F11] >gi|193063469|ref|ZP_03044558.1| S-adenosylmethionine synthetase [Escherichia coli E22] >gi|193067353|ref|ZP_03048321.1| S-adenosylmethionine synthetase [Escherichia coli E110019] >gi|194426447|ref|ZP_03059002.1| S-adenosylmethionine synthetase [Escherichia coli B171] >gi|194436893|ref|ZP_03068993.1| S-adenosylmethionine synthetase [Escherichia coli 101-1] >gi|195936564|ref|ZP_03081946.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4024] >gi|67468706|sp|P0A817|METK_ECOLI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123047917|sp|Q0T0V0|METK_SHIF8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123048890|sp|Q0TDR0|METK_ECOL5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|167011753|sp|A7ZR64|METK_ECO24 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|167011754|sp|A8A481|METK_ECOHS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081713|sp|B1IT65|METK_ECOLC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|67468707|sp|P0A818|METK_ECOL6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|67468708|sp|P0A819|METK_ECO57 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|67468709|sp|P0A820|METK_SHIFL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892664|sp|Q32C11|METK_SHIDS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892665|sp|Q3YXS9|METK_SHISS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|12517485|gb|AAG58073.1|AE005524_9 methionine adenosyltransferase 1 (AdoMet synthetase); methyl and propylamine donor, corepressor of met genes [Escherichia coli O157:H7 EDL933] >gi|882471|gb|AAA69109.1| CG Site No. 507 >gi|1789311|gb|AAC75979.1| methionine adenosyltransferase 1 [Escherichia coli str. K-12 substr. MG1655] >gi|13363290|dbj|BAB37241.1| methionine adenosyltransferase 1 [Escherichia coli O157:H7 str. Sakai] >gi|30042515|gb|AAP18239.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Shigella flexneri 2a str. 2457T] >gi|56383766|gb|AAN44414.2| methionine adenosyltransferase 1 (AdoMet synthetase) [Shigella flexneri 2a str. 301] >gi|73856976|gb|AAZ89683.1| methionine adenosyltransferase 1 (AdoMet synthetase); methyl and propylamine donor, corepressor of met genes [Shigella sonnei Ss046] >gi|81242434|gb|ABB63144.1| methionine adenosyltransferase 1 [Shigella dysenteriae Sd197] >gi|85675752|dbj|BAE77005.1| methionine adenosyltransferase 1 [Escherichia coli W3110] >gi|110344682|gb|ABG70919.1| S-adenosylmethionine synthetase [Escherichia coli 536] >gi|110616398|gb|ABF05065.1| S-adenosylmethionine synthetase [Shigella flexneri 5 str. 8401] >gi|115514293|gb|ABJ02368.1| S-adenosylmethionine synthetase [Escherichia coli APEC O1] >gi|157068080|gb|ABV07335.1| S-adenosylmethionine synthetase [Escherichia coli HS] >gi|157080383|gb|ABV20091.1| S-adenosylmethionine synthetase [Escherichia coli E24377A] >gi|169753745|gb|ACA76444.1| Non-specific protein-tyrosine kinase [Escherichia coli ATCC 8739] >gi|169890331|gb|ACB04038.1| methionine adenosyltransferase 1 [Escherichia coli str. K12 substr. DH10B] >gi|170519439|gb|ACB17617.1| S-adenosylmethionine synthetase [Escherichia coli SMS-3-5] >gi|187770947|gb|EDU34791.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4196] >gi|188017763|gb|EDU55885.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4113] >gi|188487884|gb|EDU62987.1| S-adenosylmethionine synthetase [Escherichia coli 53638] >gi|189000642|gb|EDU69628.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4076] >gi|189358493|gb|EDU76912.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4401] >gi|189363617|gb|EDU82036.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4486] >gi|189369445|gb|EDU87861.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC4501] >gi|189373892|gb|EDU92308.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC869] >gi|189379804|gb|EDU98220.1| S-adenosylmethionine synthetase [Escherichia coli O157:H7 str. EC508] >gi|190902024|gb|EDV61770.1| S-adenosylmethionine synthetase [Escherichia coli B7A] >gi|190907904|gb|EDV67497.1| S-adenosylmethionine synthetase [Escherichia coli F11] >gi|192930746|gb|EDV83351.1| S-adenosylmethionine synthetase [Escherichia coli E22] >gi|192959310|gb|EDV89745.1| S-adenosylmethionine synthetase [Escherichia coli E110019] >gi|194415755|gb|EDX32022.1| S-adenosylmethionine synthetase [Escherichia coli B171] >gi|194424375|gb|EDX40362.1| S-adenosylmethionine synthetase [Escherichia coli 101-1] (384 aa)
Score = 877, Expect = 3.0e-92, Identities = 171/365 (46%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 375
>gi|194431749|ref|ZP_03064040.1| S-adenosylmethionine synthetase [Shigella dysenteriae 1012] >gi|194420105|gb|EDX36183.1| S-adenosylmethionine synthetase [Shigella dysenteriae 1012] (384 aa)
Score = 877, Expect = 3.1e-92, Identities = 171/365 (46%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKADKAQ 375
>gi|163942494|ref|YP_001647378.1| S-adenosylmethionine synthetase [Bacillus weihenstephanensis KBAB4] >gi|163864691|gb|ABY45750.1| Methionine adenosyltransferase [Bacillus weihenstephanensis KBAB4] (399 aa)
Score = 877, Expect = 3.1e-92, Identities = 170/369 (46%), Positives = 253/369 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA K EVQL++AIG ++P++ +VDT GT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK   + E
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILAKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAQPVSISVDTLGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAATLKE 395
>gi|1827907|pdb|1FUG|A Chain A, S-Adenosylmethionine Synthetase >gi|1827908|pdb|1FUG|B Chain B, S-Adenosylmethionine Synthetase >gi|46015188|pdb|1P7L|A Chain A, S-Adenosylmethionine Synthetase Complexed With Amppnp And Met. >gi|46015189|pdb|1P7L|B Chain B, S-Adenosylmethionine Synthetase Complexed With Amppnp And Met. >gi|46015190|pdb|1P7L|C Chain C, S-Adenosylmethionine Synthetase Complexed With Amppnp And Met. >gi|46015191|pdb|1P7L|D Chain D, S-Adenosylmethionine Synthetase Complexed With Amppnp And Met. >gi|46015496|pdb|1RG9|A Chain A, S-Adenosylmethionine Synthetase Complexed With Sam And Ppnp >gi|46015497|pdb|1RG9|B Chain B, S-Adenosylmethionine Synthetase Complexed With Sam And Ppnp >gi|46015498|pdb|1RG9|C Chain C, S-Adenosylmethionine Synthetase Complexed With Sam And Ppnp >gi|46015499|pdb|1RG9|D Chain D, S-Adenosylmethionine Synthetase Complexed With Sam And Ppnp >gi|157832067|pdb|1MXA|A Chain A, S-Adenosylmethionine Synthetase With Ppi >gi|157832068|pdb|1MXB|A Chain A, S-Adenosylmethionine Synthetase With Adp >gi|157832069|pdb|1MXC|A Chain A, S-Adenosylmethionine Synthetase With 8-Br-Adp >gi|157834259|pdb|1XRA|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase >gi|157834261|pdb|1XRC|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase (383 aa)
Score = 877, Expect = 3.1e-92, Identities = 171/365 (46%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     2 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 374
>gi|94970688|ref|YP_592736.1| S-adenosylmethionine synthetase [Acidobacteria bacterium Ellin345] >gi|94552738|gb|ABF42662.1| methionine adenosyltransferase [Acidobacteria bacterium Ellin345] (393 aa)
Score = 876, Expect = 3.4e-92, Identities = 180/369 (48%), Positives = 248/369 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKI DQISDA+LD CLK DP S+VACE   A  L+VI GEITT  YVD   +   V+  +GYD + +        +IS++N QS +I   V+     GAGDQG+++GYAT+E    MP PI++AH L     +V  N  + +++ D KSQVT++Y     P ++D +++S QH++  + E + +     +I   V    L++D K  IN +G+F IGGP+GDTGLTGRK++VDTYG + +HGGGAFSGKD TKVDRS AY ARYIAKNIVAA LA +CEV+L++AIG ++P++  V+TFGT K  + +I E++   F  + K  +E  N+R PIY   + YGHFGR + +  WE  DK E + E
  S:     6 RFLFTSESVTEGHPDKIADQISDAILDACLKDDPTSRVACETLTATGLVVIAGEITTKAYVDFQTLVRGVVQTIGYDNALYGFDSNTCAVISSINKQSGDIAMGVDTG---GAGDQGMMFGYATNETPELMPAPISLAHKLTLKLTEVRKNGTLPYLRPDGKSQVTVEYDQHSKPVRVDAVVVSTQHAETVSTEDLRADILKHVIQAAVPANLLDADTKYHINPTGRFVIGGPMGDTGLTGRKIIVDTYGGMGRHGGGAFSGKDPTKVDRSAAYMARYIAKNIVAAGLADRCEVELAYAIGVAEPVSVLVETFGTGKVEEAKIEELVRKNFKLTPKGIMESLNLRRPIYRKTAAYGHFGRNDKDFTWEATDKAEALRE 380
>gi|187777243|ref|ZP_02993716.1| hypothetical protein CLOSPO_00790 [Clostridium sporogenes ATCC 15579] >gi|187774171|gb|EDU37973.1| hypothetical protein CLOSPO_00790 [Clostridium sporogenes ATCC 15579] (391 aa)
Score = 875, Expect = 5.3e-92, Identities = 178/368 (48%), Positives = 259/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y D +  +ID I++S QH    + E IE      +I  +V    L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYEDGKPVRIDAIVISTQHGPEVSLEQIEKDIKEHVIRVIVPSELLDENTKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKMADEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|154505267|ref|ZP_02042005.1| hypothetical protein RUMGNA_02781 [Ruminococcus gnavus ATCC 29149] >gi|153794465|gb|EDN76885.1| hypothetical protein RUMGNA_02781 [Ruminococcus gnavus ATCC 29149] (395 aa)
Score = 875, Expect = 5.6e-92, Identities = 182/372 (48%), Positives = 258/372 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----------DNQ---IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           + TSESV +GHPDKICD ISDA+LD  ++QDP S+VACE      ++++ GEITT  YVD+ K+  + +  +GY    F       ++++ ++ QS +I   V+K          DN+   IGAGDQG+++GYA++E   FMP PI +AH L     +V  +  + +++ D K+QVT++Y ++  PK +D +++S QH  + T+E I +     + D ++    ++   K  IN +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKDCTKVDRS AY ARY AKNIVAA LA KCE+QLS+AIG ++P +  VDTFGT K S+E++ EI+   FD      I+  ++R PIY   S+YGHFGR +LN  WE+LDK E +    KKY
  S:     5 LFTSESVTEGHPDKICDAISDAILDALMEQDPMSRVACETCVTTGMVMVMGEITTKAYVDIPKIVRDTVREIGYTRGKFGFDADTCSVLTTIDEQSADIALGVDKALEAKENKMSDNELEAIGAGDQGMMFGYASNETAEFMPYPIAMAHKLALQLTKVRKDGTLSYLRPDGKTQVTVEYDENGTPKRLDAVVLSTQHDPDVTQEQIHADIKKYVFDEIIPAEMVDEHTKFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSAAYAARYAAKNIVAAGLADKCEIQLSYAIGVAQPTSIMVDTFGTGKVSEEKLVEIVRENFDLRPAGIIKMLDLRRPIYKQTSSYGHFGRNDLNLPWEKLDKAEVL----KKY 394
>gi|51473945|ref|YP_067702.1| S-adenosylmethionine synthetase [Rickettsia typhi str. Wilmington] >gi|55584184|sp|Q9RL99|METK_RICTY S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|51460257|gb|AAU04220.1| methionine adenosyltransferase; Adomet synthetase.; S-adenosylmethionine synthetase. [Rickettsia typhi str. Wilmington] (382 aa)
Score = 875, Expect = 5.7e-92, Identities = 173/363 (47%), Positives = 245/363 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH-SQNATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDKI DQISDAVLDE LK DPN +VACE F    L+++GGEITT  YVD+ ++  N +  +GY+   +        +IS++  QS +I   ++  N+  IGAGDQ +V+GYA +E ++ MP PI  AH L+K    +     + +++ D KSQVT+ Y +++   ID +++S QH  +   K+ IE+    II   +  + L+ D K +IN +G+F IGGP+ D GLTGRK++VD+YG +AKHGGG FSGKD TK+DRS AY ARYIAKNIV + LA +CE+Q+S+AIG + P++   +TFGTSK S+EQ  ++I   FD      I+   + +  Y   ++YGHFGR + N  WEQLDKV+
  S:     5 VFTSESVSEGHPDKIADQISDAVLDEILKHDPNGRVACETFVTTGLVLVGGEITTNTYVDIEQVVRNKIHEIGYNNPSYGFDGSCCAVISSIVKQSPDIAMGIDNANEEEIGAGDQEMVFGYACNETKSLMPAPIYYAHLLMKRQAYLRKQNILSWLRPDAKSQVTLRYENNKPIVIDSVVLSTQHHPEIQQKDLIEAVIEEIIKPTLPTHLLHKDTKYLINPTGRFVIGGPVADCGLTGRKIIVDSYGGMAKHGGGCFSGKDPTKIDRSAAYMARYIAKNIVGSGLADRCEIQISYAIGVASPVSVYAETFGTSKLSNEQTTKLITEHFDMRPGKIIKNLKLHTQCYQKTASYGHFGREDENFTWEQLDKVD 377
>gi|119468970|ref|ZP_01611995.1| S-adenosylmethionine synthetase [Alteromonadales bacterium TW-7] >gi|119447622|gb|EAW28889.1| S-adenosylmethionine synthetase [Alteromonadales bacterium TW-7] (383 aa)
Score = 874, Expect = 7.4e-92, Identities = 168/367 (45%), Positives = 250/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QD +++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E E  MP PI  +H LV+   QV  + ++++++ D KSQVT  Y + +   ID +++S QHS++ ++   +E+    II  V+    + S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA KCE+Q+S+AIG ++P + +V+TFGT K  + ++ E+I   FD      I+  ++  PIY P + YGHFGR E    WE+ DK + +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDSHARVACETYVKTGMVMVGGEITTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAILNTIGKQSPDINQGVDRTSPEEQGAGDQGLMFGYACNETEVLMPAPITYSHRLVQRQAQVRKSGELNWLRPDAKSQVTFAYENGKPVGIDAVVLSTQHSEDISQNDLVEAVMETIIKPVLPAELITSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADKCELQVSYAIGVAEPTSISVETFGTGKLEEARLIELIREHFDLRPYGLIQMLDLERPIYLPTAAYGHFGRDEFP--WERTDKADAL 377
>gi|149911561|ref|ZP_01900174.1| S-adenosylmethionine synthetase [Moritella sp. PE36] >gi|149805340|gb|EDM65352.1| S-adenosylmethionine synthetase [Moritella sp. PE36] (383 aa)
Score = 873, Expect = 8.9e-92, Identities = 168/365 (46%), Positives = 246/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  + QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY  S+         +++ +  QS +I   V++D+ +  GAGDQG+++GYA +E E  MP PI  +H LVK   +V  N  + +++ D KSQ+T  Y D +   ID +++S QHS++  + + +E+    II  V+    LN + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P + +++TFGT K S+E + +++   F+      IE  ++  PIY   + YGHFGR E    WE  DK E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAIIAQDPKARVACETYVKTGMVMVGGEVTTDAWVDIEEITRKTIREIGYINSEMGFDADSCAVLNTIGKQSPDINQGVDRDDPLEQGAGDQGLMFGYANNETEELMPAPITYSHKLVKRQAEVRKNGTLPWLRPDAKSQITFAYDDGKIVGIDAVVLSTQHSEDIKQADLVEAVMETIIKPVLPAEWLNKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQLSYAIGVAEPTSISIETFGTGKVSEELLIKLVREHFELRPHGLIEMLDLMRPIYLSTAAYGHFGRNEFP--WEATDKAE 375
>gi|127511685|ref|YP_001092882.1| S-adenosylmethionine synthetase [Shewanella loihica PV-4] >gi|158513467|sp|A3QAX5|METK_SHELP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|126636980|gb|ABO22623.1| Methionine adenosyltransferase [Shewanella loihica PV-4] (383 aa)
Score = 872, Expect = 1.2e-91, Identities = 169/367 (46%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y D++   ID +++S QH  + ++   IE     II  V+    LN + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT K S+E +  ++   FD       E  ++  PIY   + YGHFGR E    WE+ DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQGLMFGYASNETDVLMPAPITYAHALVKRQSEVRKDNTLPWLRPDAKSQVTFAYEDNKIVGIDAVVLSTQHCDSVSQSDLIEGVMETIIKPVLPAQWLNKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISVETFGTGKVSEEVLIGLVRQHFDLRPYGLTEMLDLARPIYKATAAYGHFGRNEFP--WERTDKAEAL 377
>gi|82545435|ref|YP_409382.1| S-adenosylmethionine synthetase [Shigella boydii Sb227] >gi|187730688|ref|YP_001881715.1| S-adenosylmethionine synthetase [Shigella boydii CDC 3083-94] >gi|109892663|sp|Q31WK4|METK_SHIBS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|81246846|gb|ABB67554.1| methionine adenosyltransferase 1 [Shigella boydii Sb227] >gi|187427680|gb|ACD06954.1| S-adenosylmethionine synthetase [Shigella boydii CDC 3083-94] (384 aa)
Score = 872, Expect = 1.3e-91, Identities = 170/365 (46%), Positives = 244/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S     IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATTFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 375
>gi|170765655|ref|ZP_02900466.1| S-adenosylmethionine synthetase [Escherichia albertii TW07627] >gi|170124801|gb|EDS93732.1| S-adenosylmethionine synthetase [Escherichia albertii TW07627] (384 aa)
Score = 871, Expect = 1.3e-91, Identities = 170/365 (46%), Positives = 244/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS+   ++ + E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKCLQEAVMEEIIKPILPSEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIKMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 375
>gi|182623999|ref|ZP_02951787.1| S-adenosylmethionine synthetase [Clostridium perfringens D str. JGS1721] >gi|177910892|gb|EDT73246.1| S-adenosylmethionine synthetase [Clostridium perfringens D str. JGS1721] (391 aa)
Score = 871, Expect = 1.4e-91, Identities = 182/375 (48%), Positives = 261/375 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDKICDQISDAVLD    +DPN++VACE      L+++ GEITT  YVD+ K+A   +  +GYD + +       ++++ ++ QS++I   V++            + +GAGDQG+++G+AT+E E FMP PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH    ++E I++     +I  V+    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K EVQ+++AIG +KP++  VDTFGT K SDE+I  II   FD    + I   ++R PIY   + YGHFGRT+L+  WE L+KVEEI    KKY
  S:     1 MRRLFTSESVTEGHPDKICDQISDAVLDAIFAKDPNARVACETAVTTGLVMVMGEITTNCYVDIPKIARETIKSIGYDRAKYGFDCETCSVMTTIDEQSSDIAMGVDEALESRAGEKIDIDAVGAGDQGMMFGFATNETEEFMPAPIAMAHRLSRRLTEVRKNGTLPYLRPDGKTQVTVEYENDKPVRIDAIVISTQHGPEVSQEQIQADLMEHVIKAVIPAELLDENAKYYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGIADKLEVQVAYAIGVAKPVSIIVDTFGTGKISDEEIVNIINKVFDLRPGAIIRDLDLRRPIYRQTAAYGHFGRTDLDLPWENLNKVEEI----KKY 390
>gi|169824855|ref|YP_001692466.1| S-adenosylmethionine synthetase [Finegoldia magna ATCC 29328] >gi|167831660|dbj|BAG08576.1| S-adenosylmethionine synthetase [Finegoldia magna ATCC 29328] (392 aa)
Score = 871, Expect = 1.4e-91, Identities = 173/367 (47%), Positives = 254/367 (69%)
  Q:     7 MTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----KDNQ------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           +TSESV +GHPDK+CDQISDA+LD  +K+D +++VACE  +   L+++ GEITT  YVD+  +    L  +GYD +D+        II+++  QS +I   V+     KDN+       GAGDQG+V+GYAT+E E+ +PLP+ ++H L +    V     +++++ D K+QVT++Y +    +I+ I++S QH  +   E + E     +I  +V +  ++ + K  IN +GKF IGGP+GD GLTGRK++VDTYG    HGGGAFSGKD TK DRS AYFARYIAKN+VAA L  KCEV  S+AIG +KPI+  ++TFGT+K  +E+I + I   FD   K+ I+K +++ PIY   ++YGHFGR +L+  WE+ DK E + ++
  S:     6 LTSESVTEGHPDKVCDQISDAILDAIIKEDKDARVACETCSTTGLVMVMGEITTTSYVDIRSIVRKTLAEIGYDNADYGIDARTCAIITSLEEQSKDIAQGVDESEEYKDNKSDEYDRYGAGDQGMVFGYATNETESGLPLPLELSHKLARRLATVRKEKILNYLRPDGKTQVTVEYENDAPKRIEAIVVSTQHDPDVDYEQLKEDIKREVILKIVDESMIDENTKFFINPTGKFVIGGPMGDAGLTGRKIIVDTYGGFCNHGGGAFSGKDPTKTDRSAAYFARYIAKNVVAAGLCDKCEVGFSYAIGVAKPISMFINTFGTNKIEEEKIIQAINENFDARPKAIIDKLDLQRPIYREVASYGHFGRNDLDLSWEKCDKAEALKKY 391
>gi|78486162|ref|YP_392087.1| S-adenosylmethionine synthetase [Thiomicrospira crunogena XCL-2] >gi|109892681|sp|Q31EL0|METK_THICR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|78364448|gb|ABB42413.1| methionine adenosyltransferase [Thiomicrospira crunogena XCL-2] (385 aa)
Score = 870, Expect = 1.7e-91, Identities = 168/361 (46%), Positives = 245/361 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDKI DQISDA+LD  +KQDP ++VACE F    ++++GGEITT+ +VD  ++   V+  +GY+  D         ++S++  QS EI   V++  D++ GAGDQG+++GYA++E +  MP PI  AH L++   ++    K+D+++ D KSQVT+ Y D Q   +D +++S QHS     + + E+    II  V+ +  L+S  +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG + P + +++TFGT K +   I +++   FD   K  I   ++  PIY   ++YGHFGR      WE+ DK
  S:     5 VFTSESVSEGHPDKIADQISDAMLDAIMKQDPKARVACETFVKTGMVMLGGEITTSAWVDQEELVRQVVNDIGYNHGDLGFDGETCAVLSSIGKQSPEIAQGVDEYEDHEQGAGDQGLMFGYASNETDVLMPAPIYFAHRLMEKQAELRKAGKLDWLRPDAKSQVTLRYEDGQPVAVDAVVLSTQHSPEVDNKDLHEAVMEEIIKPVLPEGWLHSGTQYHINPTGRFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAAPTSISIETFGTEKVAVSLIEKLVREHFDLRPKGLIAMLDLYRPIYQKTASYGHFGRELPEFTWEKTDK 375
>gi|194683429|emb|CAR44186.1| S-adenosylmethionine synthetase [Proteus mirabilis HI4320] (384 aa)
Score = 870, Expect = 1.8e-91, Identities = 170/367 (46%), Positives = 244/367 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT  +VD+ ++    +  +GY  SD         +IS +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   QV  N  + +++ D KSQ+T  Y ++    ID +++S QH+++ +++ + E+    II  ++    LN   K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K    Q+  ++   FD      I+  ++  PIY   + YGHFGR E    WE  DK E + E
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTKAWVDIEEITRKTVREIGYTSSDMGFDANSCAVISAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAQVRKNGTLPWLRPDAKSQITFQYDNNNIVGIDAVVLSTQHAEDISQKDLHEAVMEEIIKPILPTEWLNEQTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIPTSQLILLVREFFDLRPYGLIQMLDLLHPIYQKTAAYGHFGRAEFP--WEATDKAEILRE 379
>gi|196157960|ref|YP_002127449.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Alteromonas macleodii 'Deep ecotype'] >gi|88774873|gb|EAR06125.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Alteromonas macleodii 'Deep ecotype'] >gi|196113739|gb|ACG67455.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Alteromonas macleodii 'Deep ecotype'] (381 aa)
Score = 870, Expect = 1.8e-91, Identities = 163/365 (44%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++  N +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA+DE +  MP PI  +H LV+   +V  + K+D+++ D KSQ+T  Y + +   ID +++S QH  + + E++ E+    II  V+    ++ + +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LAK+CE+Q+S+AIG ++P + ++DTFGT    ++ +  ++   FD      I+  ++  PIY P + YGHFGR E    WE  DK + +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILEQDPRARVACETYVKTGMVLVGGEVTTSAWVDIEELTRNTVKEIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRASLEEQGAGDQGLMFGYASDETDVLMPAPITYSHRLVQKQAEVRKSGKLDWLRPDAKSQITFKYENDKPVGIDAVVLSTQHCDSVSTETVREAVMEEIIKPVLPSEWIDGNTRFHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAKRCEIQVSYAIGVAEPTSISIDTFGTGVVDEKTLVALVREHFDLRPYGLIQMLDLERPIYRPTAAYGHFGRDEFP--WEATDKAQAL 377
>gi|110799593|ref|YP_696856.1| S-adenosylmethionine synthetase [Clostridium perfringens ATCC 13124] >gi|110802704|ref|YP_699452.1| S-adenosylmethionine synthetase [Clostridium perfringens SM101] >gi|161485642|ref|NP_563093.2| S-adenosylmethionine synthetase [Clostridium perfringens str. 13] >gi|168205586|ref|ZP_02631591.1| S-adenosylmethionine synthetase [Clostridium perfringens E str. JGS1987] >gi|168210107|ref|ZP_02635732.1| S-adenosylmethionine synthetase [Clostridium perfringens B str. ATCC 3626] >gi|168213719|ref|ZP_02639344.1| S-adenosylmethionine synthetase [Clostridium perfringens CPE str. F4969] >gi|168215806|ref|ZP_02641431.1| S-adenosylmethionine synthetase [Clostridium perfringens NCTC 8239] >gi|169344215|ref|ZP_02865197.1| S-adenosylmethionine synthetase [Clostridium perfringens C str. JGS1495] >gi|122958721|sp|Q0TND4|METK_CLOP1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123047206|sp|Q0SR05|METK_CLOPS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|110674240|gb|ABG83227.1| S-adenosylmethionine synthetase [Clostridium perfringens ATCC 13124] >gi|110683205|gb|ABG86575.1| S-adenosylmethionine synthetase [Clostridium perfringens SM101] >gi|169297674|gb|EDS79774.1| S-adenosylmethionine synthetase [Clostridium perfringens C str. JGS1495] >gi|170662925|gb|EDT15608.1| S-adenosylmethionine synthetase [Clostridium perfringens E str. JGS1987] >gi|170711807|gb|EDT23989.1| S-adenosylmethionine synthetase [Clostridium perfringens B str. ATCC 3626] >gi|170714804|gb|EDT26986.1| S-adenosylmethionine synthetase [Clostridium perfringens CPE str. F4969] >gi|182382423|gb|EDT79902.1| S-adenosylmethionine synthetase [Clostridium perfringens NCTC 8239] (391 aa)
Score = 870, Expect = 2.1e-91, Identities = 182/375 (48%), Positives = 261/375 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDKICDQISDAVLD    +DPN++VACE      L+++ GEITT  YVD+ K+A   +  +GYD + +       ++++ ++ QS++I   V++            + +GAGDQG+++G+AT+E E FMP PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH    ++E I++     +I  V+    L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K EVQ+++AIG +KP++  VDTFGT K SDE+I  II   FD    + I   ++R PIY   + YGHFGRT+L+  WE L+KVEEI    KKY
  S:     1 MRRLFTSESVTEGHPDKICDQISDAVLDAIFAKDPNARVACETAVTTGLVMVMGEITTNCYVDIPKIARETIKNIGYDRAKYGFDCETCSVMTTIDEQSSDIAMGVDEALESRAGEKIDIDAVGAGDQGMMFGFATNETEEFMPAPIAMAHRLSRRLTEVRKNGTLPYLRPDGKTQVTVEYENDKPVRIDAIVISTQHGPEVSQEQIQADLMEHVIKAVIPAELLDENTKYYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGIADKLEVQVAYAIGVAKPVSIIVDTFGTGKISDEEIVNIINKVFDLRPGAIIRDLDLRRPIYRQTAAYGHFGRTDLDLPWENLNKVEEI----KKY 390
>gi|157960615|ref|YP_001500649.1| S-adenosylmethionine synthetase [Shewanella pealeana ATCC 700345] >gi|189081733|sp|A8H0M7|METK_SHEPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157845615|gb|ABV86114.1| Methionine adenosyltransferase [Shewanella pealeana ATCC 700345] (384 aa)
Score = 869, Expect = 2.2e-91, Identities = 170/367 (46%), Positives = 248/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDY-ADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E +  MP PI  +H LVK   +V  +  + +++ D KSQVT  Y +D     ID +++S QHS++ T+ + IE     II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT+K  +E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DKV+ +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVRDIGYTHSDMGFDADSCAILNVIGKQSPDINQGVDRADPKEQGAGDQGLMFGYANNETDVLMPAPITYSHKLVKRQSEVRKDKTLPWLRPDAKSQVTFAYNSDGSIAGIDAVVLSTQHSEDVTQADLIEGVMETIIKPVLPAKWLSKDTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTAKVGEELLIDLVRRHFDLRPYGLTEMLNLARPIYQATAAYGHFGRNEFP--WEATDKVDAL 378
>gi|158321551|ref|YP_001514058.1| methionine adenosyltransferase [Alkaliphilus oremlandii OhILAs] >gi|167011750|sp|A8MJT0|METK_ALKOO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158141750|gb|ABW20062.1| Methionine adenosyltransferase [Alkaliphilus oremlandii OhILAs] (395 aa)
Score = 869, Expect = 2.3e-91, Identities = 169/366 (46%), Positives = 244/366 (66%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
            +K+ TSESV +GHPDK+CDQISDA+LD  L++DP ++VACE   +  L+++ GEITT  YVD+ K+    +  +GY  + +        +++ +N QS +I   V++               IGAGDQG+++G+A +E    MPLPI++AH L K    V  +  I +++ D K+QVT++Y   +  ++D I++S QH       +IE      ++  +V    L+ + +  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA KCE++L++AIG S+PI+  V+TFGT K ++  I E+I   FD    + I    +R+P Y   + YGHFGR +L+  WE+ DK E
  S:     2 FKKLFTSESVTEGHPDKMCDQISDAILDAILEKDPAARVACETSVSTGLVLVAGEITTKCYVDIPKIVRKTIEEIGYTRAKYGFDSDTCAVLTAINEQSADIALGVDEALESKKGEHRDELEAIGAGDQGIMFGFACNETPELMPLPISLAHKLAKRLSDVRKDGTIGYLRPDGKTQVTVEYDGDKPVRVDTIVISTQHGPEVDAATIEKDMIEHVVQKIVPAELLDENTRYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGVSRPISILVETFGTGKIAEADIAELIGKHFDLRPAAIIRDLGLRNPGYRNVAAYGHFGRADLDLTWERTDKAE 387
>gi|110600892|ref|ZP_01389100.1| Methionine adenosyltransferase [Geobacter sp. FRC-32] >gi|110548379|gb|EAT61597.1| Methionine adenosyltransferase [Geobacter sp. FRC-32] (399 aa)
Score = 868, Expect = 3.0e-91, Identities = 167/367 (45%), Positives = 250/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDK+ DQISD+VLD  L+QDP ++VACE      L ++ GEITT    ++ K+  N +  +GYD  D+        ++ +V+ QS +I   V +              + +GAGDQG+V+G+ATDE   F+P  I +AH L +   +   +  I +++ D KSQVT++Y   +  ++D I++S QH+     E I +     +I+ V+    L+   K  +N +G+F +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRSGAY ARY+AKN+VAA LA++ EVQ+++AIG ++P++  VD+FGTS++++ ++ E+I   FD    + IE+ ++R PIY   + YGHFGRT+L+  WE+ DK E++
  S:     5 RYLFTSESVTEGHPDKLADQISDSVLDAILEQDPLARVACETSLNTGLALVTGEITTLARPEIAKIVRNTIREVGYDHPDYGFDGKTAAVLVSVDEQSPDIAQGVNRALEARRNGDHDGYLDSVGAGDQGMVFGFATDETPQFLPTSIALAHGLSRRLAEARKSGDISYLRPDGKSQVTVEYEGDRPVRVDTIVISAQHAPEVELEQIRKDIIAQVIEPVIPDGLLDDKTKIYVNPTGRFVVGGPHGDAGLTGRKIIVDTYGGFARHGGGAFSGKDPTKVDRSGAYAARYVAKNVVAAGLARRLEVQIAYAIGVARPVSIFVDSFGTSEFTNSELAELIAANFDLRPAAIIEQLDLRRPIYRQTAAYGHFGRTDLDLPWERTDKAEQL 392
>gi|163791567|ref|ZP_02185970.1| S-adenosylmethionine synthetase [Carnobacterium sp. AT7] >gi|159873172|gb|EDP67273.1| S-adenosylmethionine synthetase [Carnobacterium sp. AT7] (396 aa)
Score = 868, Expect = 3.4e-91, Identities = 168/370 (45%), Positives = 249/370 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           +K+ TSESV +GHPDKI DQ+SDA+LD  L +DP+++VACE      L+++ GEI+T  YVD+ K   + +  +GY  + +        +I +++ QS +I   V++            +QIGAGDQG+++G+A +E    MPLPI+++H L K    V     + +++ D K+QVT++Y ++  P ++D I++S QH  + T E ++      +I   +    L+ D K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA  A+KCEVQL++AIG + P++ A+DTFGT   ++ ++ E +   FD      I+  +++ PIY   + YGHFGRT++   WEQ DKV+ +  F
  S:     4 KKLFTSESVSEGHPDKIADQVSDAILDAILTKDPDARVACETIVTTGLVLVAGEISTTTYVDIQKTVRDTIREIGYTRAKYGFDADTCAVIVSIDEQSRDIAQGVDESIESKETNQDELDQIGAGDQGLMFGFAVNETPELMPLPISLSHRLTKRLSIVRKEKLVSYLRPDAKAQVTVEYDENNKPLRVDTIVISTQHHPDVTYELLKKDMIELVIKHEIPSELLDEDTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYIAKNIVAAGFAEKCEVQLAYAIGVAHPVSIAIDTFGTGTVAESRLIEAVRANFDLRPAGIIKMLDLQRPIYKQTAAYGHFGRTDIELTWEQTDKVDSLKIF 393
>gi|57234726|ref|YP_181256.1| S-adenosylmethionine synthetase [Dehalococcoides ethenogenes 195] >gi|109892630|sp|Q3Z943|METK_DEHE1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|57225174|gb|AAW40231.1| S-adenosylmethionine synthetase [Dehalococcoides ethenogenes 195] (406 aa)
Score = 867, Expect = 3.8e-91, Identities = 165/367 (44%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDNQ-----------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICDQISDAVLD  + +DPN+ VACE    N L+V+ GEITT+ YV++ ++   V+  +GY + ++        +++++N QS +I   V K  +            GAGDQG+++GYA  E   +MPLPI++AH L K   +V  N  + +++ D KSQVT++Y + +  +I  +++  QH  + T E I++     +I  ++    L+ + +  +N +G+F +GGP+ DTG TGRK++VDTYG  A+HGGGAFSGKD TKVDRS  Y ARYIAKN+VAA LA + E+Q+++ IG + P++ +++TF T++ S E I  II   FD   ++ I    +R PIY   + YGH GR EL+  WE+LDKV+ I
  S:    10 KYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPNAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLSEVRKNGTLAYLRPDGKSQVTVEYHNGEAKRISSVVIGAQHDPDVTTEKIQADIIREVIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMSHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAI 395
>gi|69249812|ref|ZP_00605052.1| S-adenosylmethionine synthetase [Enterococcus faecium DO] >gi|68194072|gb|EAN08618.1| S-adenosylmethionine synthetase [Enterococcus faecium DO] (397 aa)
Score = 867, Expect = 4.0e-91, Identities = 172/370 (46%), Positives = 247/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE----------KD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R + TSESV +GHPDKI DQISDA+LD  LKQDP ++VACE      L+++ GEI+T  YVD+ K+    +  +GY  + F        ++  ++ QS +I   V+          KD  ++IGAGDQG+++G+A DE    MPLPI ++H LV+    +  + ++ +++ D KSQVT++Y D   P ++D I++S QH      E+I       ++  V+    L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LA+K EVQL++AIG ++P++ +++TFGT    +E++   +   FD      IE  ++R PIY   + YGHFGRT+++  WE  DKV+ +
  S:     1 MVERHLFTSESVSEGHPDKIADQISDAILDAILKQDPTARVACETSVTTGLVLVFGEISTTAYVDIQKVVRETIKEIGYTRAKFGFDGDTAAVLVAIDEQSPDIAQGVDEALEIRDEDKKDVLDEIGAGDQGLMFGFAVDETPELMPLPIALSHRLVRRLADLRKSNELTYLRPDAKSQVTVEYDDQGQPERVDTIVISTQHDDAVDNETIRHDVIEKVVKEVIPAELLDDQTKYYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKAEVQLAYAIGVAQPVSISINTFGTGTVPEEELIAAVRENFDLRPAGIIEMLDLRRPIYKQTAAYGHFGRTDVDLPWEHTDKVDAL 391
>gi|75760621|ref|ZP_00740651.1| S-adenosylmethionine synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491892|gb|EAO55078.1| S-adenosylmethionine synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] (392 aa)
Score = 867, Expect = 4.4e-91, Identities = 168/365 (46%), Positives = 251/365 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R + TSESV +GHPDKICDQISD++LD  L +D N++VACE      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V++                IGAGDQG+++G+A +E +  MPLPI++AH L +   +V  +  + +++ D K+QVT++Y ++  P ++D I++S QH  + T E I+      +I  VV    ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA K EVQL++AIG ++P++ +VDTFGT K S++ + E++ N FD      I+  ++R PIY   + YGHFGRT+++  W    K++
  S:     5 RHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWNVQTKLQ 391
>gi|145298216|ref|YP_001141057.1| S-adenosylmethionine synthetase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850988|gb|ABO89309.1| S-adenosylmethionine synthetase [Aeromonas salmonicida subsp. salmonicida A449] (383 aa)
Score = 866, Expect = 5.1e-91, Identities = 168/366 (45%), Positives = 251/366 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + K+ TSESV +GHPDKI DQISDAVLD  LKQD  ++VACE      ++++ GE+TT+ +VD+ ++  + +  +GY  SD         +++ +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  +H LVK   +V  N  + +++ D KSQ+T  Y D+     +D +++S QHS++ + K+ +E+    II  V+    +N D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT+K +++ + +++   F+      IE  +++ PIY   + YGHFGR E    WEQ DK E
  S:     1 MAKLFTSESVSEGHPDKIADQISDAVLDAILKQDTKARVACETLVKTGMVMVAGEVTTSAWVDIEEIVRDTVRDIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRSDPLEQGAGDQGLMFGYATNETDVLMPAPITYSHLLVKRQAEVRKNGTLPWLRPDAKSQLTFAYDDAGKILGVDAVVLSTQHSESISHKDLVEAVREEIIKPVLPAEWVNKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQISYAIGVAEPTSISVETFGTAKVAEDLLVKLVREHFELRPYGLIEMLDLKRPIYQATAAYGHFGREEFP--WEQTDKAE 375
>gi|169832223|ref|YP_001718205.1| methionine adenosyltransferase [Candidatus Desulforudis audaxviator MP104C] >gi|169639067|gb|ACA60573.1| Methionine adenosyltransferase [Candidatus Desulforudis audaxviator MP104C] (395 aa)
Score = 866, Expect = 5.8e-91, Identities = 161/367 (43%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDK+ DQISDA+LD  L +DP ++VACE      L++I GEIT   YVD+  +    +  +GY  + +        ++++++ QS +I   V++            +++GAGDQG++ GYATDE    MP+PI +AH L +    V  N  + +++ D K+QVT+ Y + +  K+D +++S QH       +I +     +++ ++    + +  + +IN +G+F IGGP  DTGLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CEV +++AIG +KP+A  VDTFGT   ++E++ ++++  FD    + I   ++R PIY   + YGHFGR +LN  WE++DK EE+
  S:     3 KHLFTSESVTEGHPDKVADQISDAILDSILSKDPLARVACETLVTTGLVLISGEITCKCYVDIPNIVRETVRDIGYTRAKYGFDCDTCAVLTSIDEQSPDIAMGVDEALEAREGLDDLFSRVGAGDQGIMVGYATDETPTLMPMPIYLAHRLARRLASVRKNGTLPYLRPDGKTQVTVQYDNGRPVKVDTVVISAQHHPAVDLGTIRADLIEKVVEPIIPVGLITNSTRYLINPTGRFVIGGPQADTGLTGRKIVVDTYGGMARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLASRCEVHVAYAIGVAKPVALRVDTFGTGLINEERLEKLVLEHFDLRPAAIIHHLDLRRPIYRQVAAYGHFGRGDLNLPWERIDKAEEL 388
>gi|163750298|ref|ZP_02157539.1| S-adenosylmethionine synthetase [Shewanella benthica KT99] >gi|161329970|gb|EDQ00955.1| S-adenosylmethionine synthetase [Shewanella benthica KT99] (384 aa)
Score = 866, Expect = 6.0e-91, Identities = 173/372 (46%), Positives = 246/372 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYA-DSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y  D     ID +++S QH  +  +   IE     II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P + +++TFGTSK S+E++  ++   FD       E  ++  PIY   + YGHFGR E    WE+ DK E + E  K
  S:     3 QHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAILNVIGKQSPDINQGVDRGDPKEQGAGDQGLMFGYANNETDVLMPAPITYAHALVKRQSEVRKDKTLPWLRPDAKSQVTFAYNNDGSIAGIDAVVLSTQHCDSVNQSDLIEGVMETIIKPVLPAKWLSKDTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQLSYAIGVAEPTSISIETFGTSKISEERLIALVREHFDLRPYGLTEMLDLARPIYQATAAYGHFGRNEFP--WERTDKAEALKEDAK 383
>gi|157372208|ref|YP_001480197.1| S-adenosylmethionine synthetase [Serratia proteamaculans 568] >gi|167011758|sp|A8GIX9|METK_SERP5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157323972|gb|ABV43069.1| Methionine adenosyltransferase [Serratia proteamaculans 568] (384 aa)
Score = 866, Expect = 6.0e-91, Identities = 170/363 (46%), Positives = 243/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E E  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS++ + K+  E+    II  V+    L++  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE  DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRKTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRTDPLEQGAGDQGLMFGYATNETEVLMPAPVTYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDISLKDLQEAVMEEIIKPVLPTEWLSAGTKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIPTEQLTLLVREFFDLRPYGLIQMMDLLQPIYRETAAYGHFGREHFP--WEATDK 373
>gi|27468376|ref|NP_765013.1| S-adenosylmethionine synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57867271|ref|YP_188923.1| S-adenosylmethionine synthetase [Staphylococcus epidermidis RP62A] >gi|29611795|sp|Q8CNT5|METK_STAES S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71151914|sp|Q5HNB8|METK_STAEQ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|27315923|gb|AAO05057.1|AE016749_3 S-adenosylmethionine synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57637929|gb|AAW54717.1| S-adenosylmethionine synthetase [Staphylococcus epidermidis RP62A] (399 aa)
Score = 866, Expect = 6.1e-91, Identities = 175/364 (48%), Positives = 249/364 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK----DNQI--------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           +++ TSESV +GHPDKI DQ+SDA+LDE LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY       D     +++ ++ QS +I   V+K     N I        GAGDQG+++GYATDE + +MPLPI ++H L K    V  +  +D+++ D K QVT++Y +   P+ ID I++S QH+++     IE      +I   V K  L+ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LAK+CEVQL++AIG ++P++ +++TF T K S+ ++ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKV
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKDIGYTRAKYGYDSQTMAVLTAIDEQSPDIAQGVDKALEYRNDISEEEIEATGAGDQGLMFGYATDETDTYMPLPIFLSHQLAKRLADVRKDEILDYLRPDGKVQVTVEYGEDDKPRRIDTIVVSTQHAEDVELAQIEKDIKTHVIYPTVDKALLDDETKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLAKQCEVQLAYAIGVAEPVSISINTFDTGKVSEARLVEAVRKHFDLRPAGIIKMLDLKQPIYRQTAAYGHFGRTDVLLPWEKLDKV 389
>gi|188534946|ref|YP_001908743.1| S-adenosylmethionine synthetase (Methionine adenosyltransferase) [Erwinia tasmaniensis] >gi|188029988|emb|CAO97872.1| S-adenosylmethionine synthetase (Methionine adenosyltransferase) [Erwinia tasmaniensis] (384 aa)
Score = 866, Expect = 6.3e-91, Identities = 168/369 (45%), Positives = 247/369 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP P+  AH LV+   +V  +  + +++ D KSQ+T  Y D +   ID +++S QH+++ + KE  E+    II  V+    +N+  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S E +  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK  ++ E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRQTVRDIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRTDPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVQRQSEVRKSGALPWLRPDAKSQITFQYDDGKIVGIDAVVLSTQHAEDISQKELQEAVMEEIIKPVLPTEWINASTKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKISTETLTLLVREFFDLRPHGLIQMLDLLHPIYRETAAYGHFGREHFP--WEKTDKAAQLRE 379
>gi|148378172|ref|YP_001252713.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153932206|ref|YP_001382572.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153936792|ref|YP_001386125.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. Hall] >gi|166201388|sp|A7FQI8|METK_CLOB1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|166201389|sp|A5HY62|METK_CLOBH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|148287656|emb|CAL81721.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. ATCC 3502] >gi|152928250|gb|ABS33750.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932706|gb|ABS38205.1| S-adenosylmethionine synthetase [Clostridium botulinum A str. Hall] (391 aa)
Score = 865, Expect = 6.3e-91, Identities = 176/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGPEVYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKMTDEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|168182223|ref|ZP_02616887.1| S-adenosylmethionine synthetase [Clostridium botulinum Bf] >gi|182674523|gb|EDT86484.1| S-adenosylmethionine synthetase [Clostridium botulinum Bf] (391 aa)
Score = 865, Expect = 6.5e-91, Identities = 176/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGSEVYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKITDEEIVSIVNKVFDLRPGAIIRDLHLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|114561831|ref|YP_749344.1| S-adenosylmethionine synthetase [Shewanella frigidimarina NCIMB 400] >gi|122300764|sp|Q087Q9|METK_SHEFN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|114333124|gb|ABI70506.1| Methionine adenosyltransferase [Shewanella frigidimarina NCIMB 400] (383 aa)
Score = 865, Expect = 6.5e-91, Identities = 169/367 (46%), Positives = 249/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA++E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y D +   ID I++S QH ++ T+ + IE+    II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S+E + +++   F+          ++  PIY   + YGHFGR ++ P WE  DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTNSDMGFDADSCAVLNAIGKQSPDINQGVDRSDPAEQGAGDQGLMFGYASNETDVLMPAPITYAHKLVKRQSEVRKDGTLPWLRPDAKSQVTFAYDDGKIIGIDAIVLSTQHREDVTQADLIEAVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTGKVSEEVLIKLVRQHFELRPYGLTAMLDLARPIYQQTAAYGHFGR-DIFP-WEATDKAEAL 377
>gi|91792442|ref|YP_562093.1| S-adenosylmethionine synthetase [Shewanella denitrificans OS217] >gi|122968901|sp|Q12QA6|METK_SHEDO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|91714444|gb|ABE54370.1| Methionine adenosyltransferase [Shewanella denitrificans OS217] (383 aa)
Score = 865, Expect = 6.8e-91, Identities = 170/365 (46%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA +E +  MP PI  AH LVK   +V  +  + +++ D KSQVT  Y D +   ID I++S QH ++ T+ + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S+E + +++   F+          ++  PIY   + YGHFGR E  P WE  DK E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPAEQGAGDQGLMFGYANNETDVLMPAPITYAHALVKRQSEVRKDGTLPWLRPDAKSQVTFAYEDGKIVGIDAIVLSTQHREDVTQADLIEGVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTGKVSEEVLIKLVRQHFELRPYGLTAMLDLARPIYQQTAAYGHFGR-EGFP-WEATDKAE 375
>gi|37527547|ref|NP_930891.1| S-adenosylmethionine synthetase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|44888137|sp|Q7N119|METK_PHOLL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|36786982|emb|CAE16056.1| S-adenosylmethionine synthetase (methionine adenosyltransferase) (AdoMet synthetase) (MAT) [Photorhabdus luminescens subsp. laumondii TTO1] (390 aa)
Score = 865, Expect = 7.1e-91, Identities = 168/365 (46%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY       D +   ++S +  QS +I   V++++  Q GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y + +   +D +++S QH++N +++ + E+    II  V+    LN   K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S   +  ++   FD      I+  ++  PIY   + YGHFGR +    WE  DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRQTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDREDPLQQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGVLPWLRPDAKSQVTFQYNNDKIVGVDAVVLSTQHAENISQKDLQEAVMEEIIKPVLPAEWLNPTTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVSTATLTLLVREFFDLRPHGLIQMLDLLHPIYRDTAAYGHFGRPQFP--WEATDKAEAL 377
>gi|153938476|ref|YP_001389531.1| S-adenosylmethionine synthetase [Clostridium botulinum F str. Langeland] >gi|166201390|sp|A7G9S1|METK_CLOBL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|152934372|gb|ABS39870.1| S-adenosylmethionine synthetase [Clostridium botulinum F str. Langeland] (391 aa)
Score = 865, Expect = 7.4e-91, Identities = 175/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V++            + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDRLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGPEVYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKMTDEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|170759936|ref|YP_001785496.1| S-adenosylmethionine synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169406925|gb|ACA55336.1| S-adenosylmethionine synthetase [Clostridium botulinum A3 str. Loch Maree] (391 aa)
Score = 865, Expect = 7.5e-91, Identities = 176/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGPEVYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKITDEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|89099667|ref|ZP_01172541.1| S-adenosylmethionine synthetase [Bacillus sp. NRRL B-14911] >gi|89085610|gb|EAR64737.1| S-adenosylmethionine synthetase [Bacillus sp. NRRL B-14911] (399 aa)
Score = 865, Expect = 7.6e-91, Identities = 170/367 (46%), Positives = 253/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKICDQISDA+LD  L +D N++VA E      L+++ GEITT+ YVD+ K+    +  +GY  + +        ++++++ QS +I   V             E+   IGAGDQG+++G+A +E +  MPLPI++AH L +   +V     + +++ D K+QVT++Y ++  P +ID I++S QH    + E I+ +    +I+ VV K  ++ + K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA K EVQL++AIG ++P++ +VDTFGT   S++ + +++ + FD      I   N+R PIY   + YGHFGRT+++  WE+ DK + +
  S:     5 RRLFTSESVTEGHPDKICDQISDAILDAILAKDANARVAAETSVTTGLVLVAGEITTSTYVDIPKLVRETIKDIGYTRAKYGFDSETCAVLTSIDEQSADIAMGVDQALEAREGQMSDEEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLSRRLTEVRKEEILPYLRPDGKTQVTVEYDENDKPVRIDTIVISTQHHPEISLEQIQRNLKEHVINPVVPKELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKVEVQLAYAIGVAQPVSISVDTFGTGTVSEDTLVDLVRDNFDLRPAGIINMLNLRRPIYKQTAAYGHFGRTDVDLPWERTDKADTL 393
>gi|150015318|ref|YP_001307572.1| S-adenosylmethionine synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149901783|gb|ABR32616.1| Methionine adenosyltransferase [Clostridium beijerinckii NCIMB 8052] (391 aa)
Score = 865, Expect = 7.6e-91, Identities = 177/368 (48%), Positives = 260/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +R++ TSESV +GHPDK+CDQISDA+LD  L +DP ++VACE      ++++ GEITT  YVD+ K+    +  +GYD + F       +++++++ QS +I   V         EKD    +GAGDQG+++G+AT+E E+FMPLP+ +AH L +   +V  N  + +++ D K+QVT++Y D+   +ID I++S QH +  T E I E     +I+ VV    L+S+ +  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA  A K E+QL++AIG +KP++  V+TFGT K  +++I E++   FD    + I   ++R PIY   + YGHFGR +LN  WEQL+KV+EI
  S:     1 MRRLFTSESVTEGHPDKMCDQISDAILDAILSKDPMARVACETCTTTGMVMVMGEITTNCYVDIPKVVRETVREIGYDRAKFGFDCDTCSVLTSIDEQSADIAMGVDEAFESKKGEKDEVEAVGAGDQGMMFGFATNETEDFMPLPVYMAHKLSRRLTEVRKNGTLSYLRPDGKTQVTVEYEDNVPKRIDTIVISTQHDEKVTLEQIQEDLKKFVIEAVVPAELLDSETRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGAADKLEIQLAYAIGVAKPVSIEVETFGTGKVDEDKIVEVVEKVFDLRPGAIIRDLDLRRPIYKQTAAYGHFGRNDLNLPWEQLNKVDEI 387
>gi|152998315|ref|YP_001343150.1| methionine adenosyltransferase [Marinomonas sp. MWYL1] >gi|189081719|sp|A6W3D6|METK_MARMS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|150839239|gb|ABR73215.1| Methionine adenosyltransferase [Marinomonas sp. MWYL1] (387 aa)
Score = 864, Expect = 8.5e-91, Identities = 167/370 (45%), Positives = 249/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    + TSESV +GHPDKI DQ+SDA+LD  L +DP ++VACE      ++++ GE+ T  +VD+ ++A  V+  +GY+ SD         +++ +  QS +I   V++  +++ GAGDQG+++G+AT+E +  MP PI  AH LV+   +V  N  +DF++ D KSQVT  Y ++  P  ID +++S QHS +  +  + E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +++TFGT K SD  I +++   F+      I+  +++ PIY P + YGHFGR   N  WE+ DK + +
  S:     1 MSEYSLFTSESVSEGHPDKIADQVSDAILDAILAEDPEARVACETLVKTGMVLVAGEVRTNAWVDIEEIARGVIREIGYNSSDMGFDWESCAVMNAIGKQSADIAVGVDEAGEHEQGAGDQGLMFGFATNETDVLMPAPITYAHRLVQRQAEVRKNGTLDFLRPDAKSQVTFRYDENGKPCAIDAVVLSTQHSASVKQADLREAVMEEIIKPVLPAEWLSKETKYFINPTGQFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQISYAIGVAEPTSISINTFGTGKVSDAVISQLVREHFELRPAGLIKMLDLKRPIYLPTAAYGHFGREGENFTWEKTDKADAL 381
>gi|170754418|ref|YP_001779795.1| S-adenosylmethionine synthetase [Clostridium botulinum B1 str. Okra] >gi|169119630|gb|ACA43466.1| S-adenosylmethionine synthetase [Clostridium botulinum B1 str. Okra] (391 aa)
Score = 864, Expect = 9.2e-91, Identities = 176/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAIGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGPEVYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKMTDEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|168177500|ref|ZP_02612164.1| S-adenosylmethionine synthetase [Clostridium botulinum NCTC 2916] >gi|182671234|gb|EDT83208.1| S-adenosylmethionine synthetase [Clostridium botulinum NCTC 2916] (391 aa)
Score = 864, Expect = 9.6e-91, Identities = 176/368 (47%), Positives = 258/368 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L +DPN +VACE      ++++ GEI+T  YVD+ K+    +  +GYD + +       ++I++++ QS +I   V+           K + +GAGDQG+++G+AT+E + +MP+PI +AH L +   +V  N  + +++ D K+QVT++Y + +  +ID I++S QH      E IE      +I  +V    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K +DE+I  I+   FD    + I   ++R PIY   + YGHFGRT+++  WE+LDKVEEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILDKDPNGRVACETAVTTGMVMVMGEISTKCYVDIPKLVRETIRGIGYDRAKYGFDCETCSVITSIDEQSVDIAMGVDEALESKKGEMDKLDAVGAGDQGMMFGFATNETKEYMPMPIEMAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYENGKPVRIDAIVISTQHGPEIYLEQIEKDIKEHVIKVIVPSELLDENTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQLAYAIGVAKPVSISVDTFGTGKMTDEEIVSIVNKVFDLRPGAIIRDLDLRRPIYKQVAAYGHFGRTDIDVPWERLDKVEEI 387
>gi|156932618|ref|YP_001436534.1| S-adenosylmethionine synthetase [Enterobacter sakazakii ATCC BAA-894] >gi|166201391|sp|A7MJQ6|METK_ENTS8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|156530872|gb|ABU75698.1| hypothetical protein ESA_00400 [Enterobacter sakazakii ATCC BAA-894] (384 aa)
Score = 864, Expect = 9.9e-91, Identities = 167/365 (45%), Positives = 244/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y   +   ID +++S QH+++  +  + ++    II  V+    LN   K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K + EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRTDPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDGGKIVGIDAVVLSTQHAEDIEQNVLHDAVMEEIIKPVLPAEWLNESTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIATEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDKAQ 375
>gi|88812481|ref|ZP_01127730.1| S-adenosylmethionine synthetase [Nitrococcus mobilis Nb-231] >gi|88790267|gb|EAR21385.1| S-adenosylmethionine synthetase [Nitrococcus mobilis Nb-231] (386 aa)
Score = 864, Expect = 1.0e-90, Identities = 162/372 (43%), Positives = 248/372 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           M  + + TSESV  GHPDK+ DQISDAVLD  L QD  ++VACE      +++I GEITT+ +VD+ ++    +  +GYD  D         +++ +  QS +I   V++    + GAGDQG+++GYA++E +  MP PI  AH LV+    V  + ++ +++ D KSQ+T  YAD++   I+ +++S QH+    +  + E+    II  ++ +  ++   K +IN +GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA++CE+Q+S+AIG ++P + +++TFGT + S+ ++ E++   FD    + ++  ++  PIY   + YGHFGR E N  WE+ DK E + E
  S:     1 MSNQYLFTSESVSAGHPDKVADQISDAVLDAILTQDRQARVACETLVKTGMVIIAGEITTSAWVDLEELTRRTVKEIGYDHGDMGFDGDACAVLNAIGKQSPDIAQGVDRQLPEEQGAGDQGLMFGYASNETDVLMPAPITYAHRLVRRQADVRKSGRLPWLRPDAKSQITFRYADNRPAGIETVVLSTQHAPEIKEADVHEAVIEEIIKPILPREWIDQRTKYLINPTGKFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLAERCEIQVSYAIGVAEPTSISIETFGTGRLSEVRLVELVREFFDLRPYAVLKMLDLVRPIYQETAAYGHFGREEENFTWERTDKAEMLRE 382
>gi|163812176|ref|ZP_02203854.1| Methionine adenosyltransferase [Dehalococcoides sp. VS] >gi|157404212|gb|EDO70254.1| Methionine adenosyltransferase [Dehalococcoides sp. VS] (406 aa)
Score = 864, Expect = 1.0e-90, Identities = 165/367 (44%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDNQ-----------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICDQISDAVLD  + +DP + VACE    N L+V+ GEITT+ YV++ ++   V+  +GY + ++        +++++N QS +I   V K  +            GAGDQG+++GYA  E   +MPLPI++AH L K   +V  N  + +++ D KSQVT++Y + +  +I  +++  QH  + T E I+S     +I  ++    L+++ +  +N +G+F +GGP+ DTG TGRK++VDTYG  A+HGGGAFSGKD TKVDRS  Y ARYIAKN+VAA LA + E+Q+++ IG + P++ +++TF T++ S E I  II   FD   ++ I    +R PIY   + YGH GR EL+  WE+LDKV+ I
  S:    10 KYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGKVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLSEVRKNGTLAYLRPDGKSQVTVEYHNGEAKRISSVVIGAQHDPDITTEKIQSDIIREVIKPIIPADLLDTNTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMSHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAI 395
>gi|168185942|ref|ZP_02620577.1| methionine adenosyltransferase [Clostridium botulinum C str. Eklund] >gi|169295912|gb|EDS78045.1| methionine adenosyltransferase [Clostridium botulinum C str. Eklund] (391 aa)
Score = 863, Expect = 1.1e-90, Identities = 178/375 (47%), Positives = 260/375 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDK+CDQISDA+LD  LK DPN +VACE      ++++ GEI+T  YVD+ K+   V+  +GY  + +       +++++++ QS +I   V         +KD+   IGAGDQG+++G+AT+E E +MPLPIN+AH L +   +   N  + +++ D K+QVT++Y D++  +ID +++S QH    T+E I+      +I  VV    L+ + K  IN +G+F IGGP GDTGLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+ L++AIG ++P++  V+TFGT K  D +I +I+   FD    + I    ++ PIY   + YGHFGRT++   WEQL+KVEEI    KKY
  S:     1 MRRLFTSESVTEGHPDKMCDQISDAILDSILKNDPNGRVACETAVTTGMVMVMGEISTNCYVDIPKVVRGVISDIGYTRAKYGFDAETCSVLTSIDEQSQDIAMGVDEALESRQGQKDDVEAIGAGDQGIMFGFATNETEEYMPLPINMAHKLSRKLSEARKNGTLGYLRPDGKTQVTVEYEDNKPVRIDAVVVSTQHDPEVTQEQIQKDIMEHVIKAVVPNEWLDDETKYYINPTGRFVIGGPHGDTGLTGRKIIVDTYGGSGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKIEIGLAYAIGVARPVSLLVNTFGTEKIEDSKIVDIVNKVFDLRPGAIIRDLELKRPIYRQTAAYGHFGRTDVELPWEQLNKVEEI----KKY 390
>gi|85711778|ref|ZP_01042834.1| S-adenosylmethionine synthetase [Idiomarina baltica OS145] >gi|85694393|gb|EAQ32335.1| S-adenosylmethionine synthetase [Idiomarina baltica OS145] (381 aa)
Score = 863, Expect = 1.2e-90, Identities = 163/367 (44%), Positives = 251/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLD  L +D  ++VACE +    ++++GGEI+T+ +VD+  +    +  +GY  SD         +++ +  QS +I   V++++    GAGDQG+++GYA++E    MP PI  AH +V+   ++  N  +D+++ D KSQ+T  Y + +   ID +++S QH ++  + ++ E+    II  V+ +  ++ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++CE+Q+S+AIG ++P + ++DTFGTS++S+E++  ++   FD      I+  ++  PIY   STYGHFGR E    WE+ DK + +
  S:     3 RHLFTSESVSEGHPDKIADQISDAVLDAILAKDIRARVACETYVKTGMVLVGGEISTSAWVDIEDLTRQAIRDVGYTHSDMGFDANSCAVLNAIGKQSQDINQGVDRESPEAQGAGDQGLMFGYASNETSVLMPAPITYAHRIVQRQSEMRKNGTLDWLRPDAKSQLTFVYENGKPVAIDTVVLSTQHREDIDQATLREAVMEEIIKPVLPEQWVSRDTKFHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNLVAAGLAERCEIQVSYAIGVAEPTSISIDTFGTSQHSEEKLIALVRRHFDLRPYGLIQMLDLERPIYRATSTYGHFGREEFP--WEKTDKADAL 377
>gi|149115376|ref|ZP_01842120.1| Methionine adenosyltransferase [Shewanella baltica OS223] >gi|153002050|ref|YP_001367731.1| S-adenosylmethionine synthetase [Shewanella baltica OS185] >gi|160876766|ref|YP_001556082.1| S-adenosylmethionine synthetase [Shewanella baltica OS195] >gi|166201410|sp|A6WS79|METK_SHEB8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081731|sp|A9L1M6|METK_SHEB9 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|146864826|gb|EDK50206.1| Methionine adenosyltransferase [Shewanella baltica OS223] >gi|151366668|gb|ABS09668.1| Methionine adenosyltransferase [Shewanella baltica OS185] >gi|160862288|gb|ABX50822.1| Methionine adenosyltransferase [Shewanella baltica OS195] (383 aa)
Score = 863, Expect = 1.4e-90, Identities = 167/367 (45%), Positives = 243/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA +E +  MP PI  AH LVK   +V  N  + +++ D KSQVT  Y D +   ID +++S QH  + ++ + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S++ + +++   F+          ++  PIY   + YGHFGR E    WE  DK E +
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPAEQGAGDQGLMFGYANNETDVLMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYDDGKIVGIDAVVLSTQHRDDVSQADLIEGVMETIIKPVLPAQWLNKDTKFFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTGKVSEDLLIKLVRQHFELRPYGLTAMLDLARPIYQATAAYGHFGRNEFP--WEATDKAEAL 377
>gi|85059997|ref|YP_455699.1| S-adenosylmethionine synthetase [Sodalis glossinidius str. 'morsitans'] >gi|109892666|sp|Q2NRD1|METK_SODGM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|84780517|dbj|BAE75294.1| S-adenosylmethionine synthase [Sodalis glossinidius str. 'morsitans'] (385 aa)
Score = 862, Expect = 1.5e-90, Identities = 168/368 (45%), Positives = 244/368 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEIL 371
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGEITT+ +VD+ ++  + +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV    QV  N  + +++ D KSQVT  Y + +   ID +++S QH+++ A  +  E+    II  V+    L++  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA++CE+Q+S+AIG ++P +  ++TFGT K   + +  ++   FD      I   ++  PIY   + YGHFGR      WE+ DK E +L
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEITTSAWVDIEELTRSTIREIGYIHSDMGFDANSCAVLSAIGKQSPDINQGVDRTDPLEQGAGDQGMMFGYATNETDVLMPAPITYAHRLVARQSQVRKNGTLPWLRPDAKSQVTFAYDNGKVVGIDAVVLSTQHAEDIALPQLKEAVMEEIIKPVLPAEWLSAQTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAERCEIQVSYAIGVAEPTSITIETFGTEKIPADNLTALVREFFDLRPHGLITMLDLLQPIYRETAAYGHFGREHFP--WEKTDKAELLL 378
>gi|77976235|ref|ZP_00831745.1| COG0192: S-adenosylmethionine synthetase [Yersinia intermedia ATCC 29909] (384 aa)
Score = 862, Expect = 1.8e-90, Identities = 169/369 (45%), Positives = 246/369 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LVK   +V  N  + +++ D KSQ+T  Y D +   ID +++S QHS++ + K+  E+    II  V+    L +  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S++Q+  ++   F+      I+  ++  PIY   + YGHFGR E    WE+ DK   + E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRKTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRSDPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVKRQAEVRKNGTLPWLRPDAKSQITFQYDDGKIVGIDAVVLSTQHSEDISLKDLQEAVMEEIIKPVLPVEWLTAATKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKVSEDQLITLVREFFELRPYGLIQMLDLLHPIYQATAAYGHFGREEFP--WEKTDKAALLRE 379
>gi|146851|gb|AAB05197.1| S-adenosylmethionine synthetase II (383 aa)
Score = 861, Expect = 1.9e-90, Identities = 171/363 (47%), Positives = 243/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++  N +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  +  ++ D KSQVT  Y D +   ID +++S QHS+   ++S+ E+    II  ++    L S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLR-VRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFP--WEKTDK 372
>gi|157363649|ref|YP_001470416.1| S-adenosylmethionine synthetase [Thermotoga lettingae TMO] >gi|167011759|sp|A8F5B8|METK_THELT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157314253|gb|ABV33352.1| Methionine adenosyltransferase [Thermotoga lettingae TMO] (396 aa)
Score = 861, Expect = 1.9e-90, Identities = 167/368 (45%), Positives = 251/368 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQS-------NEIFNAVEKDN------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++++ TSESV +GHPDK+ DQISDA+LD  ++QDP+++VA E      L V+ GE+TT  YVD+  +    ++ +GY  + +        ++++++SQS       N+   A EK++      +IGAGDQG+++GYAT+E   FMPLPI +AH L     +V     + F++ D K+QVT++Y+D   P +ID I++S QH  N T  E  E     +I   + +   + + K ++N +G+F +GGP  DTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS  Y ARY+AKN+VAA LA +  +Q+++AIG ++P++  +DTF TSK  +E++ ++I+  FDF   + I K N++ PIY   + YGHFGR + +  WE LD VEE+
  S:     1 MKRLFTSESVTEGHPDKVADQISDAILDALIEQDPDARVAVETLVTTGLAVVAGEVTTEAYVDIQDIVRRTILDIGYTRAKYGFDGETCGVVTSIHSQSPDIALGVNKALEAKEKNDDGDEFDKIGAGDQGMMFGYATNETPEFMPLPIVLAHQLAMRLSKVRKEKIVPFLRPDGKTQVTVEYSDDGKPMRIDTILISAQHDPNVTINELKEVLLEHVIKPTIPEQYWSDNIKILVNPTGRFVLGGPSADTGLTGRKIIVDTYGGWVPHGGGAFSGKDPTKVDRSAHYMARYVAKNVVAAGLADRFMIQVAYAIGKARPVSLMIDTFSTSKVDEEKLKDVIIQLFDFRPLAIINKLNLQRPIYKKTAAYGHFGRNDPDFTWESLDAVEEL 390
>gi|126173071|ref|YP_001049220.1| methionine adenosyltransferase [Shewanella baltica OS155] >gi|166201409|sp|A3D0T8|METK_SHEB5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|125996276|gb|ABN60351.1| Methionine adenosyltransferase [Shewanella baltica OS155] (383 aa)
Score = 861, Expect = 2.0e-90, Identities = 167/365 (45%), Positives = 242/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V++ +  + GAGDQG+++GYA +E +  MP PI  AH LVK   +V  N  + +++ D KSQVT  Y D +   ID +++S QH  + ++ + IE     II  V+    LN D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K S++ + +++   F+          ++  PIY   + YGHFGR E    WE  DK E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPAEQGAGDQGLMFGYANNETDVLMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYDDGKIVGIDAVVLSTQHRDDVSQADLIEGVMETIIKPVLPAQWLNKDTKFFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTGKVSEDLLIKLVRQHFELRPYGLTAMLDLARPIYQATAAYGHFGRNEFP--WEATDKAE 375
>gi|183599930|ref|ZP_02961423.1| hypothetical protein PROSTU_03451 [Providencia stuartii ATCC 25827] >gi|188022205|gb|EDU60245.1| hypothetical protein PROSTU_03451 [Providencia stuartii ATCC 25827] (384 aa)
Score = 861, Expect = 2.2e-90, Identities = 167/367 (45%), Positives = 247/367 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH LV+   +V  N  + +++ D KSQVT  Y +++   ID +++S QH+++  ++ + E+    II  V+    L    K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K  + Q+  ++   FD      I+  ++  PIY   ++YGHFGR++    WE+ DK   + E
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRKTVREIGYTSSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGIMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDNNEIVGIDAVVLSTQHAEDIKQQDLHEAVMEEIIKPVLPAEWLVPTTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKVPEAQLVLLVREFFDLRPYGLIQMLDLLHPIYQQTASYGHFGRSQFP--WEKTDKAAILRE 379
>gi|54297949|ref|YP_124318.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Paris] >gi|148359594|ref|YP_001250801.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Corby] >gi|166201397|sp|A5IDK5|METK_LEGPC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|60389911|sp|Q5X3N0|METK_LEGPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|53751734|emb|CAH13156.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Paris] >gi|148281367|gb|ABQ55455.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Corby] (382 aa)
Score = 861, Expect = 2.3e-90, Identities = 170/365 (46%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDA+LD  L QDP ++VACEV     ++++GGEITT  +VDV ++  +V+  +GY+ S          ++S +  QS +I   V  DNQ    +GAGDQG+++GYA+ E + FMP PI  AH L++   +   + ++ +++ D K Q+T+ Y      ++D ++ S QHS +   K+ +E+    II  V+    LN   +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRS AY AR++AKNIVAA LA KCE+Q+S+AIG ++P +  VDTFGT +  + +I ++I   FD + +  I++ ++  PIY   +TYGH+GR   N  WE+LDKV E+
  S:     6 VFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEEITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGV--DNQQTKILGAGDQGLMFGYASRETDVFMPAPIAYAHRLMEKLAKARKSGQLPWLRPDAKCQLTLKYEQGMPVEVDTVVFSTQHSPDIEHKDLVEAIREEIIKSVLPAEWLNDKTRYFINPTGRFVIGGPLGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCELQISYAIGVAEPTSIFVDTFGTGRLKNSEIIDLIHTHFDLTPQGIIDQHDLLRPIYRQTATYGHYGRE--NFPWERLDKVAEL 378
>gi|70726140|ref|YP_253054.1| S-adenosylmethionine synthetase [Staphylococcus haemolyticus JCSC1435] >gi|109892669|sp|Q4L7C7|METK_STAHJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|68446864|dbj|BAE04448.1| S-adenosylmethionine synthetase [Staphylococcus haemolyticus JCSC1435] (398 aa)
Score = 860, Expect = 2.5e-90, Identities = 176/364 (48%), Positives = 252/364 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEK----DNQI--------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           +++ TSESV +GHPDKI DQ+SDA+LDE LK DPN++VACE      + +I GEI+T+ YVD+ K+    +  +GY       D     +++ ++ QS +I   V+K     N I        GAGDQG+++GYAT+E E +MPLPI ++H L K    V  +  +++++ D K QVT++Y +S  PK ID I++S QH+ +   E I+S     +I   V +  ++++ K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA LA +CEVQL++AIG ++P++ ++DTF T K S+ Q+ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKV
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTSTYVDIPKVVRETIKGIGYTRAKYGYDYQTMAVLTAIDEQSPDIAQGVDKALEYRNDISEEEIEATGAGDQGLMFGYATNETETYMPLPIFLSHQLAKRLSDVRKDGILNYLRPDGKVQVTVEYDESDKPKRIDTIVVSSQHADDIELEQIQSDIKEHVIYPTVPEGLIDNETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSISIDTFKTGKVSEAQLVEAVRANFDLRPAGIIKMLDLKHPIYKQTAAYGHFGRTDVLLPWEKLDKV 389
>gi|167622783|ref|YP_001673077.1| S-adenosylmethionine synthetase [Shewanella halifaxensis HAW-EB4] >gi|189081732|sp|B0TUB8|METK_SHEHH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|167352805|gb|ABZ75418.1| Methionine adenosyltransferase [Shewanella halifaxensis HAW-EB4] (384 aa)
Score = 860, Expect = 2.5e-90, Identities = 169/365 (46%), Positives = 244/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDY-ADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         I++ +  QS +I   V++ +  + GAGDQG+++GYA +E ++ MP PI  +H LVK   +V  +  + +++ D KSQVT  Y  D     ID +++S QH  + ++   IE     II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT+K  +E + +++   FD       E  N+  PIY   + YGHFGR E    WE  DKVE
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVRDIGYTHSDMGFDADSCAILNVIGKQSPDINQGVDRADPKEQGAGDQGLMFGYANNETDSLMPAPITYSHMLVKRQSEVRKDKTLPWLRPDAKSQVTFAYNPDGSIAGIDAVVLSTQHCDSVSQSDLIEGVMETIIKPVLPAKWLSKDTKYFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIETFGTAKVGEELLIDLVRRHFDLRPYGLTEMLNLARPIYQATAAYGHFGREEFP--WEATDKVE 376
>gi|167769924|ref|ZP_02441977.1| hypothetical protein ANACOL_01265 [Anaerotruncus colihominis DSM 17241] >gi|167667915|gb|EDS12045.1| hypothetical protein ANACOL_01265 [Anaerotruncus colihominis DSM 17241] (394 aa)
Score = 860, Expect = 2.5e-90, Identities = 174/368 (47%), Positives = 255/368 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYN----LNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEIL 371
           + + TSESV +GHPDKICDQISDAVLD  + +DP ++VACE      +++I GEI+T  YVD+  +A +V+  +GYD + F        ++++++ QS +I   V+K            +  GAGDQG+++GYA+DE    MP+PI++AH L K   QV  +  + +++ D K+QVT++Y D +  ++D +++S QH+   + E I +    +I+ V+K       +++D K  +N +G+F IGGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKNIVAAKLA +CEVQL++AIG ++P++  V+TFGT   SDE++ E +   FD      I   ++R PIY   + YGH GR EL   WE+ DKV+ IL
  S:     3 KYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPGARVACETAVTTGMVMIMGEISTTCYVDIPALARSVIKDIGYDRAKFGFDSQTCAVLTSIDEQSGDIAQGVDKALEQREGACDEADTTGAGDQGMMFGYASDETPELMPMPISLAHKLAKRLSQVRRDGTLAYLRPDGKTQVTVEYVDDKPVRVDAVVISNQHAPEVSLEQIRA---DVIEHVIKPTIPAGLMDADTKIYVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGFGRHGGGAFSGKDPTKVDRSAAYAARWVAKNIVAAKLAHRCEVQLAYAIGVARPVSVNVNTFGTGAVSDEKLAEAVNKVFDLRPAVIIRSLDLRRPIYRQLAAYGHMGREELGVNWEKTDKVDAIL 389
>gi|117621328|ref|YP_857624.1| S-adenosylmethionine synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117562735|gb|ABK39683.1| S-adenosylmethionine synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (383 aa)
Score = 860, Expect = 2.7e-90, Identities = 166/366 (45%), Positives = 251/366 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADS-QNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + K+ TSESV +GHPDKI DQISDAVLD  LKQD  ++VACE      ++++ GE+TT  +VD+ ++  + +  +GY  SD         +++ +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  +H LVK   +V  N  + +++ D KSQ+T  Y D+ +   +D +++S QH+++ + K+ +E+    II  V+    +N D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT+K +++ + +++   F+      I+  +++ PIY   + YGHFGR E    WEQ DK E
  S:     1 MAKLFTSESVSEGHPDKIADQISDAVLDAILKQDTKARVACETLVKTGMVMVAGEVTTTAWVDIEQIVRDTVRDIGYTHSDMGFDADSCAVLNAIGKQSPDINQGVDRSDPLEQGAGDQGLMFGYATNETDVLMPAPITYSHLLVKRQAEVRKNGTLPWLRPDAKSQLTFAYDDAGKIIGVDAVVLSTQHAESISHKDLVEAVREEIIKPVLPAEWVNKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQISYAIGVAEPTSISVETFGTAKVAEDLLVKLVREHFELRPYGLIQMLDLKRPIYQATAAYGHFGRNEFP--WEQTDKAE 375
>gi|52842239|ref|YP_096038.1| S-adenosylmethionine synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|60389917|sp|Q5ZTY6|METK_LEGPH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|52629350|gb|AAU28091.1| S-adenosylmethionine synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (382 aa)
Score = 860, Expect = 2.9e-90, Identities = 169/365 (46%), Positives = 247/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDA+LD  L QDP ++VACEV     ++++GGEITT  +VDV ++  +V+  +GY+ S          ++S +  QS +I   V  DNQ    +GAGDQG+++GYA+ E + FMP PI  AH L++   +   + ++ +++ D K Q+T+ Y      ++D ++ S QHS +   K+ +E+    II  V+    LN   +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRS AY AR++AKNIVAA LA KCE+Q+S+AIG ++P +  VDTFGT +  + +I ++I   FD + +  I++ ++  PIY   +TYGH+GR      WE+LDKV E+
  S:     6 VFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEEITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGV--DNQQTKILGAGDQGLMFGYASRETDVFMPAPIAYAHRLMEKLAKARKSGQLPWLRPDAKCQLTLKYEQGMPVEVDTVVFSTQHSPDIEHKDLVEAIREEIIKSVLPAEWLNDKTRYFINPTGRFVIGGPLGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCELQISYAIGVAEPTSIFVDTFGTGRLKNSEIIDLIHTHFDLTPQGIIDQHDLLRPIYRQTATYGHYGRESFP--WERLDKVAEL 378
>gi|38233911|ref|NP_939678.1| S-adenosylmethionine synthetase [Corynebacterium diphtheriae NCTC 13129] >gi|48428320|sp|P61945|METK_CORDI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|38200172|emb|CAE49853.1| S-adenosylmethionine synthetase [Corynebacterium diphtheriae] (410 aa)
Score = 860, Expect = 2.9e-90, Identities = 166/366 (45%), Positives = 254/366 (69%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEK------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSD-----FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKY--SDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++ TSESV +GHPDKICD ISD +LD  L  DP+++VA E      L+ + GE+ T+GYV++ K+  + LI +G++ S+         +  ++  QS EI   V++            D+Q GAGDQG+++GYAT+E    MPLPI++AH L +   QV   + +  ++ D K+QVT+ Y +S  P ++D +++S QH  + T+E +       ++D+V++   L S      +  ++N SG F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRSGAY  R++AKNIVAA LA + EVQ+++AIG +KP+   V+TFGT+K+  +DEQI + +++ FD    + I + ++  PIY+  + YGHFGR +L   WE  D+ E++
  S:    10 RLFTSESVTEGHPDKICDAISDTILDALLSVDPHARVAVETVTTTGLVHVVGEVRTSGYVEIPKLVRDKLIEIGFNSSEVGFDGRTCGVSVSIGEQSQEIGAGVDQSHEVRSGENTDADDQAGAGDQGLMFGYATNETATLMPLPIDLAHRLARRLTQVRKTSVVSHLRPDGKTQVTLAYDESGRPVRLDTVVVSTQHDPDVTQEWLFAQIKEHVVDWVLRDSGLESTLDISGYSLLVNPSGSFVVGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSGAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFGTAKFGLTDEQIQDAVLHVFDLRPAAIIRELDLLRPIYAGTAAYGHFGRDDLKLPWENTDRAEQL 403
>gi|83644381|ref|YP_432816.1| S-adenosylmethionine synthetase [Hahella chejuensis KCTC 2396] >gi|109892635|sp|Q2SLT3|METK_HAHCH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|83632424|gb|ABC28391.1| S-adenosylmethionine synthetase [Hahella chejuensis KCTC 2396] (386 aa)
Score = 859, Expect = 3.2e-90, Identities = 166/370 (44%), Positives = 252/370 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    I TSESV +GHPDK+ DQISDA+LD  +K DPN++VA E      + VI GE+ T  YVD+  +  +V++ +GY+ SD         +++ +  QS +I   V++  +  +GAGDQG+++GYAT+E +  MP PI  +H LV+    +  N+ + +++ D KSQVT+ Y + +   ++ +++S QH+ +  +  I E+    II  V+ +  L+S+ +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVA+ LA KCE+Q+S+AIG S+P + +V+TFGT K SD++I  ++   FD   +  I+  +++ PIY P ++YGHFGRT  +  WE+ DK + +
  S:     1 MSEYSIFTSESVSEGHPDKMADQISDAILDAIIKDDPNARVAVETLVKTGMAVIAGEVRTNTYVDLEDIVRSVILDIGYNSSDVGFDGASCAVLNAIGKQSGDIAMGVDEASEKDLGAGDQGLMFGYATNETDVLMPAPIYYSHRLVERQAYLRKNSILPWLRPDAKSQVTLRYENGKPVAVEAVVLSTQHTPDVKQSDIREAVMEEIIKHVLPEEWLHSNTQYHINPTGQFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVASGLAAKCEIQVSYAIGVSEPTSISVNTFGTGKISDDKIATLVREHFDLRPRGLIDMLDLKRPIYRPTASYGHFGRTGDSFSWERTDKADAL 380
>gi|24379957|ref|NP_721912.1| S-adenosylmethionine synthetase [Streptococcus mutans UA159] >gi|29611808|sp|Q8DT23|METK_STRMU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|24377940|gb|AAN59218.1|AE014988_7 putative S-adenosylmethionine synthetase [Streptococcus mutans UA159] (397 aa)
Score = 859, Expect = 3.6e-90, Identities = 173/370 (46%), Positives = 254/370 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAV----------EKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L QDP++ VA E       + + GEI+T  YVD+ ++  + +  +GY ++ +   +       ++  QS +I   V          E+D+   IGAGDQG+++G+A DE    MPLPI++AH LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I       +I  V+    L++  K +IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT+  ++ ++ + +   FD      I+  +++ PIY   + YGH GRT+++  WE+LDKVEE+
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAVLVQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTDTAYGFSAETVGVHPSLVEQSPDIAQGVNEALEVRGHHEQDDLDLIGAGDQGLMFGFAVDETPELMPLPISLAHRLVRKLAELRKSGEIAYLRPDAKSQVTVEYDENDKPVRVDTVVISTQHDPEATNEQIHRDVIEKVIKAVIPAEYLDAKTKYLINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRVDTFGTALVAESKLEQAVRQIFDLRPAGIIKMLDLKRPIYRQTAAYGHVGRTDIDLPWEKLDKVEEL 391
>gi|77408852|ref|ZP_00785579.1| S-adenosylmethionine synthetase [Streptococcus agalactiae COH1] >gi|77172538|gb|EAO75680.1| S-adenosylmethionine synthetase [Streptococcus agalactiae COH1] (398 aa)
Score = 858, Expect = 4.3e-90, Identities = 171/373 (45%), Positives = 255/373 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  N +  +GYD++++                   I   VN ++ E+  ++E+D  + IGAGDQG+++G+A DE    MPLPI++AH LVK    +  + ++ +++ D KSQVT++Y D+  P ++D +++S QH  N T + + +     +I+ V+  + L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT   ++  +   +   FD      I   +++ PIY   + YGH GRT+++  WE++DKV+ + +F
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVN-EALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDDNDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDF 394
>gi|87121182|ref|ZP_01077073.1| S-adenosylmethionine synthetase [Marinomonas sp. MED121] >gi|86163674|gb|EAQ64948.1| S-adenosylmethionine synthetase [Marinomonas sp. MED121] (387 aa)
Score = 858, Expect = 4.4e-90, Identities = 165/366 (45%), Positives = 246/366 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           M    + TSESV +GHPDK+ DQ+SDA+LD  L +DP ++VACE      ++++ GE+ T  +VD+ ++  NV+  +GY+ S+         +++ +  QS +I   V++ +  + GAGDQG+++G+AT+E +  MP PI  AH LV+   +V  N  +DF++ D KSQVT  Y +   P  ID +++S QH    T+  + E+    II  V+ +  L++D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +++TFGT K SD  I +++   F+      ++  +++ PIY P + YGHFGR   N  WE+ DK
  S:     1 MSEYSLFTSESVSEGHPDKVADQVSDAILDAILTEDPEARVACETLVKTGMVLVAGEVRTNSWVDIEEITRNVVRDIGYNSSEMGFDWESCAVMNAIGKQSADIAVGVDEADGHEQGAGDQGLMFGFATNETDVLMPAPITYAHRLVERQAEVRKNGTLDFLRPDAKSQVTFRYDEQGKPCAIDAVVLSTQHDAKVTQSDLREAVLEEIIKPVLPEEWLSNDTKYFINPTGQFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSISINTFGTGKVSDAVISQLVREHFELRPAGLVKMLDLKRPIYLPTAAYGHFGREGENFTWEKTDK 377
>gi|12044897|ref|NP_072707.1| S-adenosylmethionine synthetase [Mycoplasma genitalium G37] >gi|1346527|sp|P47293|METK_MYCGE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|3844656|gb|AAC71263.1| S-adenosylmethionine synthetase [Mycoplasma genitalium G37] >gi|166078820|gb|ABY79438.1| S-adenosylmethionine synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (383 aa)
Score = 858, Expect = 4.7e-90, Identities = 175/364 (48%), Positives = 255/364 (70%)
  Q:     9 SESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFC-NAIIDFVVKKYNLNSDFKR-IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTS-KYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPI-YSPFSTYGHFGRTELNPGWEQ---LDKVEEILE 372
           SESVG GHPDKICDQI+D++LD+CL Q   S VACEVFA+  LI+IGGEI+T+GYVDVV+ AW +L  LGY+E+DF+ +S +N+QS EI  AV K+N+I AGDQG+  GYA +E +  MPL + +AH  +K AE++    + DF+K+DMKSQV ++Y+ +Q  + +++++S+QH+   +   +     N +I  V+ +Y         ++N  G F +GGP+ DTGLTGRK++VDTYG  A HGGG+FSGKD +KVDR+GAYFAR+IAK+IV+   A +CEV +S+      P +  V  F T+ +Y +  I  ++ N F++SI   I+K  +   + YS ++ YGHFG  +L+P WEQ   LDK+E +++
  S:    15 SESVGLGHPDKICDQIADSILDQCLLQSKTSHVACEVFASKNLILIGGEISTSGYVDVVQTAWRILRNLGYNETDFSFLSCINNQSLEINQAVLKNNEINAGDQGITVGYAVNETKQLMPLGVLLAHSFLKQAEKL--TKQFDFLKNDMKSQVVLNYSLNQ-VECEEVLLSIQHTNAISLTELRKVIENNVILPVLNQYGFQDKKPTCLVNPGGSFVLGGPMADTGLTGRKIIVDTYGPYAHHGGGSFSGKDPSKVDRTGAYFARFIAKHIVSLGWASECEVSISWVFSKPNPQSITVKCFNTNIQYDEVLINRVVNNYFNWSITKIIDKLKLLDFVKYSDYAVYGHFG-NDLSP-WEQPTELDKLECLIK 380
>gi|187935465|ref|YP_001884721.1| methionine adenosyltransferase [Clostridium botulinum B str. Eklund 17B] >gi|187723618|gb|ACD24839.1| methionine adenosyltransferase [Clostridium botulinum B str. Eklund 17B] (391 aa)
Score = 858, Expect = 5.2e-90, Identities = 175/375 (46%), Positives = 267/375 (71%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDK+CDQISDA+LD  L +DPN++VACE      L+++ GEI+T  YVD+ K+    +  +GYD + +       ++++ ++ QS +I   V         +KD    +GAGDQG+++G+AT+E + +MPLPI +AH L +   +V  +  +D+++ D K+QVT++Y +++  +ID I++S QH +  + E IE      +I+ VV    L+S+ +  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++  ++TFGT K  +++I EI+ N FD    + I   ++R PI+   + YGHFGRT+L+  WE+L+K+EEI    KKY
  S:     1 MRRLFTSESVTEGHPDKMCDQISDAILDAILTKDPNARVACETCTTTGLVMVMGEISTNCYVDIPKVVRETVREIGYDRAKYGFDCDTCSVMTTIDEQSADIAMGVDEALESKKGQKDEVEAVGAGDQGMMFGFATNETDAYMPLPIYMAHKLSRRLTEVRKDGTLDYLRPDGKTQVTVEYENNKPKRIDTIVISTQHGEEVSLEKIEKDIKEYVINAVVPTELLDSETRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDSTKVDRSAAYAARWVAKNLVAAGIADKLEIQLAYAIGVAKPVSIEIETFGTGKMPEDKIVEIVENVFDLRPGAIIRDLDLRKPIFKQTAAYGHFGRTDLDLPWERLNKIEEI----KKY 390
>gi|54294920|ref|YP_127335.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Lens] >gi|60389910|sp|Q5WV18|METK_LEGPL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|53754752|emb|CAH16239.1| S-adenosylmethionine synthetase [Legionella pneumophila str. Lens] (382 aa)
Score = 857, Expect = 5.7e-90, Identities = 169/365 (46%), Positives = 246/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDA+LD  L QDP ++VACEV     ++++GGEITT  +VDV  +  +V+  +GY+ S          ++S +  QS +I   V  DNQ    +GAGDQG+++GYA+ E + FMP PI  AH L++   +   + ++ +++ D K Q+T+ Y      ++D ++ S QHS +   K+ +E+    II  V+    LN   +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRS AY AR++AKNIVAA LA KCE+Q+S+AIG ++P +  VDTFGT +  + +I ++I   FD + +  I++ ++  PIY   +TYGH+GR      WE+LDKV E+
  S:     6 VFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEDITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGV--DNQQTKILGAGDQGLMFGYASRETDVFMPAPIAYAHRLMEKLAKARKSGQLPWLRPDAKCQLTLKYEQGMPVEVDTVVFSTQHSPDIEHKDLVEAIREEIIKSVLPAEWLNDKTRYFINPTGRFVIGGPLGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCELQISYAIGVAEPTSIFVDTFGTGRLKNSEIIDLIHTHFDLTPQGIIDQHDLLRPIYRQTATYGHYGRESFP--WERLDKVAEL 378
>gi|28210081|ref|NP_781025.1| S-adenosylmethionine synthetase [Clostridium tetani E88] >gi|33301279|sp|Q898W7|METK_CLOTE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|28202517|gb|AAO34962.1| S-adenosylmethionine synthetase [Clostridium tetani E88] (391 aa)
Score = 857, Expect = 5.8e-90, Identities = 179/368 (48%), Positives = 257/368 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK+ TSESV +GHPDKICDQISDAVLD  L++DPN +VACE      ++++ GEITT  YVD+ K+  N +  +GY  + +        ++++++ QS +I   V+           K++ IGAGDQG+++GYA +E   +MP+ I+IAH L +   +V  N  + +++ D K+QVT++Y D++  +ID I++S QH    T+E IE      +I  VV    L+ +    IN +G+F +GGP GD GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K EVQL++AIG +KP++ +V+TFGT K  D +I EII   FD    + I++ N+R PIY   + YGHFGRT++   WE L+K+EEI
  S:     1 MRKLFTSESVTEGHPDKICDQISDAVLDAILERDPNGRVACETSVTTGMVLVTGEITTNCYVDIPKIVRNTIEAIGYTRAKYGFDSDTCAVLTSISEQSPDIAMGVDESLESKQGGMDKEDVIGAGDQGMMFGYANNETSEYMPMAISIAHKLSRRLSEVRKNGTLPYLRPDGKTQVTVEYEDNKAIRIDTIVVSTQHGPEVTREQIEKDIFEHVISKVVPVEFLDENTNYYINPTGRFVVGGPQGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEVQLAYAIGIAKPVSISVETFGTGKIDDRKIVEIINKVFDLRPSAIIKELNLRRPIYKQTAAYGHFGRTDVELPWESLNKLEEI 387
>gi|16121235|ref|NP_404548.1| S-adenosylmethionine synthetase [Yersinia pestis CO92] >gi|22127190|ref|NP_670613.1| S-adenosylmethionine synthetase [Yersinia pestis KIM] >gi|45443250|ref|NP_994789.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Microtus str. 91001] >gi|51597513|ref|YP_071704.1| S-adenosylmethionine synthetase [Yersinia pseudotuberculosis IP 32953] >gi|108806332|ref|YP_650248.1| S-adenosylmethionine synthetase [Yersinia pestis Antiqua] >gi|108813287|ref|YP_649054.1| S-adenosylmethionine synthetase [Yersinia pestis Nepal516] >gi|145597892|ref|YP_001161968.1| S-adenosylmethionine synthetase [Yersinia pestis Pestoides F] >gi|149367060|ref|ZP_01889093.1| S-adenosylmethionine synthetase [Yersinia pestis CA88-4125] >gi|153948346|ref|YP_001399825.1| S-adenosylmethionine synthetase [Yersinia pseudotuberculosis IP 31758] >gi|162419716|ref|YP_001607690.1| S-adenosylmethionine synthetase [Yersinia pestis Angola] >gi|165924973|ref|ZP_02220805.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937296|ref|ZP_02225860.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. IP275] >gi|166010348|ref|ZP_02231246.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212680|ref|ZP_02238715.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399744|ref|ZP_02305262.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421931|ref|ZP_02313684.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426700|ref|ZP_02318453.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170023092|ref|YP_001719597.1| methionine adenosyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186896635|ref|YP_001873747.1| S-adenosylmethionine synthetase [Yersinia pseudotuberculosis PB1/+] >gi|122979982|sp|Q1CEX6|METK_YERPN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123072985|sp|Q1CB69|METK_YERPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158514071|sp|A4TI83|METK_YERPP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|167011760|sp|A7FEZ7|METK_YERP3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|22095892|sp|Q8ZHG7|METK_YERPE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|60389943|sp|Q666P5|METK_YERPS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21960256|gb|AAM86864.1|AE013933_1 methionine adenosyltransferase 1 [Yersinia pestis KIM] >gi|45438118|gb|AAS63666.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Microtus str. 91001] >gi|51590795|emb|CAH22441.1| Putative S-adenosylmethionine synthetase. [Yersinia pseudotuberculosis IP 32953] >gi|108776935|gb|ABG19454.1| methionine adenosyltransferase [Yersinia pestis Nepal516] >gi|108778245|gb|ABG12303.1| methionine adenosyltransferase [Yersinia pestis Antiqua] >gi|115346714|emb|CAL19597.1| S-adenosylmethionine synthetase [Yersinia pestis CO92] >gi|145209588|gb|ABP38995.1| methionine adenosyltransferase [Yersinia pestis Pestoides F] >gi|149290674|gb|EDM40750.1| S-adenosylmethionine synthetase [Yersinia pestis CA88-4125] >gi|152959841|gb|ABS47302.1| S-adenosylmethionine synthetase [Yersinia pseudotuberculosis IP 31758] >gi|162352531|gb|ABX86479.1| S-adenosylmethionine synthetase [Yersinia pestis Angola] >gi|165914770|gb|EDR33383.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. IP275] >gi|165923173|gb|EDR40324.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990834|gb|EDR43135.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205972|gb|EDR50452.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960068|gb|EDR56089.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050452|gb|EDR61860.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054303|gb|EDR64122.1| S-adenosylmethionine synthetase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749626|gb|ACA67144.1| Methionine adenosyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186699661|gb|ACC90290.1| S-adenosylmethionine synthetase [Yersinia pseudotuberculosis PB1/+] (384 aa)
Score = 857, Expect = 5.9e-90, Identities = 166/363 (45%), Positives = 241/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY  SD         ++S +  QS +I   V+++N +  GAGDQG+++GYAT+E    MP PI  AH LV+   +V  N  + +++ D KSQVT  Y D +   ID +++S QHS++  ++ + E+    II  V+    + +  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+ FGT K   +Q+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRRTIREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRENPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAEVRKNGALPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDINQKDLHEAVMEEIIKPVLPAEWITAHTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVEAFGTEKIPADQLTLLVREFFDLRPYGLIKMLDLLHPIYRETAAYGHFGREHFP--WEKTDK 373
>gi|118444997|ref|YP_878986.1| S-adenosylmethionine synthetase [Clostridium novyi NT] >gi|158512413|sp|A0Q2Y4|METK_CLONN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|118135453|gb|ABK62497.1| S-adenosylmethionine synthetase [Clostridium novyi NT] (391 aa)
Score = 857, Expect = 6.1e-90, Identities = 177/375 (47%), Positives = 261/375 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +R++ TSESV +GHPDK+CDQISDA+LD  LK DPN +VACE      ++++ GEI+T  YVD+ K+   V+  +GY  + +       +++++++ QS +I   V         +KD+   IGAGDQG+++G+AT+E + +MPLPIN+AH L +   +V  N  + +++ D K+QVT++Y D++  +ID +++S QH    T+E I+      +I  VV    L+ + K  IN +G+F IGGP GDTGLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+ L++AIG ++P++  V+TFGT K  D +I +I+   FD    + I    ++ PIY   + YGHFGRT++   WEQL+KV+EI    KKY
  S:     1 MRRLFTSESVTEGHPDKMCDQISDAILDAILKNDPNGRVACETAVTTGMVMVMGEISTNCYVDIPKVVREVISDIGYTRAKYGFDAETCSVLTSIDEQSQDIAMGVDEALESRQGQKDDVEAIGAGDQGIMFGFATNETKEYMPLPINMAHKLSRKLAEVRKNGTLAYLRPDGKTQVTVEYEDNKPVRIDAVVVSTQHDPEVTQEQIQKDIMEHVIKTVVPNEWLDDETKYYINPTGRFVIGGPHGDTGLTGRKIIVDTYGGSGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKIEIGLAYAIGVARPVSLLVNTFGTEKIEDSKIVDIVNKVFDLRPGAIIRDLELKRPIYRQTAAYGHFGRTDVELPWEQLNKVDEI----KKY 390
>gi|73662285|ref|YP_301066.1| S-adenosylmethionine synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|109892670|sp|Q49YL6|METK_STAS1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|72494800|dbj|BAE18121.1| S-adenosylmethionine synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (398 aa)
Score = 857, Expect = 6.1e-90, Identities = 170/364 (46%), Positives = 249/364 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE------------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           +++ TSESV +GHPDKI DQ+SDA+LDE LK DPN++VACE      + +I GEI+T  YVD+ K+    +  +GY  + F        +++ ++ QS +I   V+            +    GAGDQG+++GYAT+E + +MPLPI ++H L K    V  +  + +++ D K QVT++Y +   P +ID I++S QH+++   + I +     +I   V +  L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGG FSGKD TKVDRS AY ARY+AKNIVAA+LA+KCEVQL++AIG ++P++ ++DTFGT K S+ ++ E +   FD      I+  +++ PIY   + YGHFGRT++   WE+LDKV
  S:     5 KRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKEIGYTRAKFGYDSQTMAVLTAIDEQSPDIAQGVDTALEYRDEASEAEIEATGAGDQGLMFGYATNETDTYMPLPIFLSHQLAKRLSDVRKDEILKYLRPDGKVQVTVEYDEQDKPVRIDTIVLSTQHAEDIELDQIKDDIKTHVIYPTVPESLLDEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAQLAEKCEVQLAYAIGVAEPVSISIDTFGTGKVSEYELVEAVRKHFDLRPAGIIKMLDLKHPIYKQTAAYGHFGRTDVLLPWEKLDKV 389
>gi|77961486|ref|ZP_00825322.1| COG0192: S-adenosylmethionine synthetase [Yersinia mollaretii ATCC 43969] (384 aa)
Score = 857, Expect = 6.1e-90, Identities = 168/363 (46%), Positives = 243/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E    MP PI  AH LV+    V  N  + +++ D KSQVT  Y D +   ID +++S QHS++ + K+  E+    II  V+    L +  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S++Q+  ++   F+      I+  ++  PIY   + YGHFGR E    WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRRTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAAVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDISLKDLQEAVMEEIIKPVLPAEWLTASTKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKVSEDQLITLVREFFELRPYGLIQMLDLLHPIYQATAAYGHFGREEFP--WEKTDK 373
>gi|60389965|sp|Q6AQ43|METK_DESPS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|50875690|emb|CAG35530.1| probable S-adenosylmethionine synthetase [Desulfotalea psychrophila LSv54] (398 aa)
Score = 857, Expect = 6.9e-90, Identities = 159/365 (43%), Positives = 253/365 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD  L+QDP ++VACE      + +I GEITT+ +VD+ ++  N +  +GY+ S+         +++ ++ QS +I   V +   I    GAGDQG+++GYA++E +  MP+PI +AH L +   QV  ++ + +++ D KSQVTI+Y +    +ID +++S QH ++ +   + E+    II   +    ++++ K  IN +G+F IGGP+GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY+ RY+AKN+VAA +A + ++Q+++AIG ++P++  V++FGT + SD  I E+I+  FD   K+ +++ ++  PIY   + YGHFGR+++   WE+ DK+EE+
  S:    16 LFTSESVSEGHPDKVADQISDAILDAILEQDPQARVACETLVTTGMALIAGEITTSAWVDMPEVVRNTIKEIGYNSSEMGFDWQSCAVMTTIDKQSPDIAQGVNEGAGIDLDQGAGDQGLMFGYASNETDVLMPMPITLAHRLTRRQAQVRKSSILPWLRPDAKSQVTIEYENKIPKRIDAVVLSTQHDESISYNDLKEAVMEEIIKPTLPADMIDANTKFFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGKALHGGGAFSGKDPSKVDRSSAYYGRYVAKNLVAAGIASELQIQVAYAIGIAQPVSINVNSFGTGRISDAAIKELILGNFDLRPKAIVQQLDLLRPIYRQTAAYGHFGRSDVEFPWERTDKIEEL 392
>gi|104774392|ref|YP_619372.1| S-adenosylmethionine synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514490|ref|YP_813396.1| S-adenosylmethionine synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423473|emb|CAI98374.1| S-adenosylmethionine synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093805|gb|ABJ58958.1| methionine adenosyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (398 aa)
Score = 856, Expect = 7.0e-90, Identities = 170/370 (45%), Positives = 247/370 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDK+ DQISDA+LD  L QDP + VACE      L+++ GEI+T   VD  ++A   +  +GY++ D         ++  ++ QS +I   V++             +QIGAGDQG+++G+A +E    MPLPI++AH L++   Q+       +++ D K+QVT++Y D+  PK +D +++S Q S + T E I  +  N +I  V+    L+ + K +IN SG+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA +CEVQL++AIG + P++  +DT  T K SD+ + E +   FD      I+  ++R PIY   + YGHFGRT+++  WE+ DK E +  F
  S:     3 KHLFTSESVSEGHPDKVADQISDAILDAVLAQDPQAHVACETSVTTGLVLLFGEISTTANVDYQQVARKTIREIGYNDPDLGFDADNCAVLVALDKQSPDIAGGVDEALEVRGEDDSDELDQIGAGDQGLMFGFAINETPELMPLPISLAHRLMRKVAQLRKEGTFPWLRPDAKAQVTVEYDDAGKPKRVDTVVISTQTSPDVTNEEIRVAMVNDVIKEVIPDKFLDDETKYLINPSGRFVIGGPKGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLADRCEVQLAYAIGVAHPVSIMIDTAETGKVSDQLLTEAVRANFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWEKTDKAEALQAF 393
>gi|15617010|ref|NP_240223.1| S-adenosylmethionine synthetase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11386917|sp|P57486|METK_BUCAI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|25287045|pir||E84977 methionine adenosyltransferase (EC 2.5.1.6) [imported] - Buchnera sp. (strain APS) >gi|10039075|dbj|BAB13109.1| S-adenosylmethionine synthetase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (378 aa)
Score = 856, Expect = 7.1e-90, Identities = 171/365 (46%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDA+LDE LKQD  ++VACE +    +++IGGEITT  +VDV ++    +  +GY  SD         ++S +  QS +I   + + + +  GAGDQG+++GYAT+E E FMP PI  AH L++   ++     + +++ D KSQVT  Y +     ID +++S QH +N T++ + E+  + II  V+    L  + K  IN +G+F IGGP+GD G+TGRK++VDTYG +++HGGGAFSGKD +KVDRS AY ARY+AKNIVA+ LA +CE+QLS+AIG ++PI+  +DTF T K S+  +  ++ + FD      I+  N+  PIY   + YGHFGR E    WE LDKV E+
  S:     5 LFTSESVSEGHPDKIADQISDALLDEILKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRKTINDIGYVNSDAGFDANSCAVLSAIGKQSPDINQGINRFDPLKQGAGDQGIIFGYATNETEFFMPAPITYAHLLMQKQSELRKKNILPWLRPDAKSQVTFKYNNGNIIAIDTVVLSTQHQENITQKYLKEAVMDEIIKPVLPDKWLTKNTKFFINPTGRFVIGGPMGDCGVTGRKIIVDTYGGMSRHGGGAFSGKDPSKVDRSAAYAARYVAKNIVASGLAARCEIQLSYAIGIAEPISIMIDTFNTGKISNSALISLVRSIFDLRPYGLIKMLNLLQPIYLKTAVYGHFGRKEFP--WENLDKVNEL 377
>gi|153956270|ref|YP_001397035.1| S-adenosylmethionine synthetase [Clostridium kluyveri DSM 555] >gi|146349128|gb|EDK35664.1| MetK3 [Clostridium kluyveri DSM 555] (391 aa)
Score = 856, Expect = 9.0e-90, Identities = 176/371 (47%), Positives = 262/371 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQS-------NEIFNA----VEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           +RK+ TSESV +GHPDK+CDQISDA+LD  L+QDP  +VACE      ++++ GEI+T  Y+D+ K+    +  +GY  + +        ++S+++ QS       NE   A    +EK + IGAGDQG+++G+AT+E   +MP+PIN+AH L K   QV     +D+++ D K+QVTI+Y +++  ++D I++S QH +  TKE IE      +I+ VV    L+S+ K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+Q+++AIG ++P++  VDTFGT K S+++I +I+   FD      I +  +R PIY   + YGHFGRT+++  WE+L+KV +I  +
  S:     1 MRKLFTSESVTEGHPDKMCDQISDAILDAILEQDPQGRVACETATTTGMVLVMGEISTNCYIDIPKIVRKTIREIGYTRAKYGFDCDTCAVLSSIDEQSLDIAMGVNESLEAKVGKMEKVDAIGAGDQGMMFGFATNETPEYMPMPINLAHKLSKRLSQVRKEGTLDYLRPDGKTQVTIEYEENKPVRVDTIVVSTQHDEFVTKEQIERDIIKNVIEPVVPPEFLDSNTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGVADKLEIQIAYAIGVAEPVSINVDTFGTEKISEKKIVDIVNKVFDLRPAVIIRELELRRPIYRQAAAYGHFGRTDIDLPWEKLNKVNDIKNY 390
>gi|25010904|ref|NP_735299.1| S-adenosylmethionine synthetase [Streptococcus agalactiae NEM316] >gi|77413107|ref|ZP_00789307.1| S-adenosylmethionine synthetase [Streptococcus agalactiae 515] >gi|29611810|sp|Q8E5Y0|METK_STRA3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|23095283|emb|CAD46493.1| S-adenosylmethionine synthetase [Streptococcus agalactiae NEM316] >gi|77160808|gb|EAO71919.1| S-adenosylmethionine synthetase [Streptococcus agalactiae 515] (398 aa)
Score = 855, Expect = 1.1e-89, Identities = 170/373 (45%), Positives = 255/373 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  N +  +GYD++++                   I   VN ++ E+  ++E+D  + IGAGDQG+++G+A DE    MPLPI++AH LVK    +  + ++ +++ D KSQVT++Y ++  P ++D +++S QH  N T + + +     +I+ V+  + L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT   ++  +   +   FD      I   +++ PIY   + YGH GRT+++  WE++DKV+ + +F
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVN-EALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENNQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDF 394
>gi|73748353|ref|YP_307592.1| S-adenosylmethionine synthetase [Dehalococcoides sp. CBDB1] >gi|109892631|sp|Q3ZZN7|METK_DEHSC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|73660069|emb|CAI82676.1| S-adenosylmethionine synthetase [Dehalococcoides sp. CBDB1] (406 aa)
Score = 854, Expect = 1.2e-89, Identities = 164/367 (44%), Positives = 244/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQ-----------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICDQISDAVLD  + +DP + VACE    N L+V+ GEITT+ YV++ ++   V+  +GY       D+    +++++N QS +I   V K  +            GAGDQG+++GYA  E   +MPLPI++AH L K   +V  N  + +++ D KSQVT++Y + +  +I  +++  QH  + T E I++     +I  ++    L+   +  +N +G+F +GGP+ DTG TGRK++VDTYG  A+HGGGAFSGKD TKVDRS  Y ARYIAKN+VAA LA + E+Q+++ IG + P++ +++TF T++ + E I  II   FD   ++ I    +R PIY   + YGH GR EL+  WE+LDKV+ I
  S:    10 KYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQADIIREVIKPIIPTNLLDEKTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMNHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAI 395
>gi|147669133|ref|YP_001213951.1| S-adenosylmethionine synthetase [Dehalococcoides sp. BAV1] >gi|189081711|sp|A5FRV2|METK_DEHSB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|146270081|gb|ABQ17073.1| methionine adenosyltransferase [Dehalococcoides sp. BAV1] (406 aa)
Score = 854, Expect = 1.3e-89, Identities = 164/367 (44%), Positives = 245/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQ-----------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICDQISDAVLD  + +DP + VACE    N L+V+ GEITT+ YV++ ++   V+  +GY       D+    +++++N QS +I   V K  +            GAGDQG+++GYA  E   +MPLPI++AH L K   +V  N  + +++ D KSQVT++Y + +  +I  +++  QH  + T E I++     +I  ++    L+ + +  +N +G+F +GGP+ DTG TGRK++VDTYG  A+HGGGAFSGKD TKVDRS  Y ARYIAKN+VAA LA + E+Q+++ IG + P++ +++TF T++ + E I  II   FD   ++ I    +R PIY   + YGH GR EL+  WE+LDKV+ I
  S:    10 KYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQADIIRNVIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMNHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAI 395
>gi|114771382|ref|ZP_01448797.1| methionine adenosyltransferase 1 (AdoMet synthetase) [alpha proteobacterium HTCC2255] (381 aa)
Score = 854, Expect = 1.3e-89, Identities = 169/365 (46%), Positives = 244/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + + TSESV +GHPDKI DQISDAVLD  L +DP ++VACE F    ++++GGEI T  +VD+ K+  + +  +GY  SD         +++ +  QS++I   V++ +  + GAGDQG+++GYA +E +  MP PI  +H LV+   +V  + K+D+++ D KSQVT  Y + Q   ID +++S QHS N    S+ E+    II  V+ +  +    +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG  +P + +++TFGT K SD+ I  ++   FD      I+  ++  PIY P + YGHFG  E  P WE+ D+ E
  S:     3 QHLFTSESVSEGHPDKIADQISDAVLDAILTEDPMARVACETFVKTGMVLVGGEINTHAWVDIEKITRDTVRDIGYVSSDMGFDADSCAVLNAIGKQSDDINQGVDRGSREEQGAGDQGLMFGYACNETQELMPAPIMFSHKLVQKQAEVRKSGKLDWLRPDAKSQVTFVYENGQPIGIDAVVLSTQHSDNIDTPSLREAVMEEIIKPVLPEQWITPATQFHINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVVEPTSISINTFGTGKVSDDVITRLVREHFDLRPYGLIQMLDLERPIYLPTAAYGHFGH-EAYP-WEKTDRAE 375
>gi|74318539|ref|YP_316279.1| S-adenosylmethionine synthetase [Thiobacillus denitrificans ATCC 25259] >gi|109892682|sp|Q3SFY2|METK_THIDA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|74058034|gb|AAZ98474.1| S-adenosylmethionine synthetase [Thiobacillus denitrificans ATCC 25259] (388 aa)
Score = 854, Expect = 1.4e-89, Identities = 170/370 (45%), Positives = 243/370 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M+   I TSESV +GHPDK+ DQ+SDAVLD  L QD +++VACE      L VI GEITT   +D  ++A   +  +GYD SD        +++  V  QS +I   V++  D+ +  GAGDQG+++GYA +E    MP+PI++AH L +   ++  + ++ +++ D KSQV+I Y D +   ID +++S QH    +   + E+    II  V+ K  L++D + ++N +G+F +GGP+GD GLTGRK++VDTYG  + HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KC VQ+S+AIG +KP +  VDTFGT K  + +I E+I   FD   K  +   ++  PIY+  ++YGHFGR E    WE  DK  E+
  S:     1 MQKDFIFTSESVSEGHPDKMADQVSDAVLDAILTQDKHARVACETLLTTGLCVIAGEITTTAVIDYNQIARQTIKRIGYDSSDIGFDYNTCSVLVTVGKQSPDIAQGVDRAHDDYLDQGAGDQGLMFGYACNETPVLMPMPIHLAHRLTERQSELRKDGRLPWLRPDAKSQVSIRYVDGKPHSIDTVVLSTQHDPEVSHAQLSEAVIEEIIKPVLPKDMLSADTRYLVNPTGRFVVGGPMGDAGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCMVQVSYAIGVAKPTSLMVDTFGTGKIPEAKIVELIQAHFDLRPKGIVNMLDLLRPIYTRTASYGHFGRDEPEFTWEVTDKAAEL 382
>gi|22536995|ref|NP_687846.1| S-adenosylmethionine synthetase [Streptococcus agalactiae 2603V/R] >gi|76786895|ref|YP_329576.1| S-adenosylmethionine synthetase [Streptococcus agalactiae A909] >gi|76798945|ref|ZP_00781148.1| S-adenosylmethionine synthetase [Streptococcus agalactiae 18RS21] >gi|29611809|sp|Q8E0A3|METK_STRA5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892671|sp|Q3K1M7|METK_STRA1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|22533850|gb|AAM99718.1|AE014229_19 S-adenosylmethionine synthetase [Streptococcus agalactiae 2603V/R] >gi|76561952|gb|ABA44536.1| S-adenosylmethionine synthetase [Streptococcus agalactiae A909] >gi|76585712|gb|EAO62267.1| S-adenosylmethionine synthetase [Streptococcus agalactiae 18RS21] (398 aa)
Score = 854, Expect = 1.4e-89, Identities = 170/373 (45%), Positives = 255/373 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  N +  +GYD++++                   I   VN ++ E+  ++E+D  + IGAGDQG+++G+A DE    MPLPI++AH LVK    +  + ++ +++ D KSQVT++Y ++  P ++D +++S QH  N T + + +     +I+ V+  + L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT   ++  +   +   FD      I   +++ PIY   + YGH GRT+++  WE++DKV+ + +F
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVN-EALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDF 394
>gi|114321411|ref|YP_743094.1| S-adenosylmethionine synthetase [Alkalilimnicola ehrlichei MLHE-1] >gi|122311072|sp|Q0A6D3|METK_ALHEH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|114227805|gb|ABI57604.1| methionine adenosyltransferase [Alkalilimnicola ehrlichei MLHE-1] (385 aa)
Score = 854, Expect = 1.4e-89, Identities = 159/365 (43%), Positives = 246/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDAVLD  L +DP  ++ACE      +I++GGE+TT+  +D   +A   +  +GY       D     +I+ +  QS +I   V++D+  + GAGDQG+++GYA++E +  MP PI  AH LV+   +V  N ++ +++ D KSQVT+ Y D +   +D +++S QH+ + T+  + E+    II  V+ +  +  + + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRS AY  RY+AKNIVAA LA++CE+Q+S+AIG ++P + +V+TFGT +   E++  I+   FD      ++  ++  PIY+  + YGHFGR +    WE++D+ EEI
  S:     5 LFTSESVSEGHPDKMADQISDAVLDAILAEDPRGRIACETMIKTGIIILGGEVTTSANIDYEAVARETVKRIGYKHHEMGFDGETCGVINILGKQSVDIAQGVDRDHPEEQGAGDQGLMFGYASNETDVLMPAPITYAHRLVQRQAEVRCNGQLPWLRPDAKSQVTLRYVDGRPVAVDTVVLSTQHAPDLTQAQVHEAVIEEIIKPVLPEQWITGETRYLVNPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSAAYACRYVAKNIVAAGLAERCEIQVSYAIGVAEPTSISVETFGTGRVDSEKLTRIVREHFDLRPYGILKMLDLIRPIYTATAAYGHFGREDEGFPWERIDRAEEI 379
>gi|161485628|ref|YP_064537.2| S-adenosylmethionine synthetase [Desulfotalea psychrophila LSv54] (387 aa)
Score = 854, Expect = 1.4e-89, Identities = 159/365 (43%), Positives = 253/365 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD  L+QDP ++VACE      + +I GEITT+ +VD+ ++  N +  +GY+ S+         +++ ++ QS +I   V +   I    GAGDQG+++GYA++E +  MP+PI +AH L +   QV  ++ + +++ D KSQVTI+Y +    +ID +++S QH ++ +   + E+    II   +    ++++ K  IN +G+F IGGP+GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY+ RY+AKN+VAA +A + ++Q+++AIG ++P++  V++FGT + SD  I E+I+  FD   K+ +++ ++  PIY   + YGHFGR+++   WE+ DK+EE+
  S:     5 LFTSESVSEGHPDKVADQISDAILDAILEQDPQARVACETLVTTGMALIAGEITTSAWVDMPEVVRNTIKEIGYNSSEMGFDWQSCAVMTTIDKQSPDIAQGVNEGAGIDLDQGAGDQGLMFGYASNETDVLMPMPITLAHRLTRRQAQVRKSSILPWLRPDAKSQVTIEYENKIPKRIDAVVLSTQHDESISYNDLKEAVMEEIIKPTLPADMIDANTKFFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGKALHGGGAFSGKDPSKVDRSSAYYGRYVAKNLVAAGIASELQIQVAYAIGIAQPVSINVNSFGTGRISDAAIKELILGNFDLRPKAIVQQLDLLRPIYRQTAAYGHFGRSDVEFPWERTDKIEEL 381
>gi|77956703|ref|ZP_00820786.1| COG0192: S-adenosylmethionine synthetase [Yersinia bercovieri ATCC 43970] (384 aa)
Score = 853, Expect = 1.8e-89, Identities = 167/363 (46%), Positives = 241/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E    MP PI  AH LV+    V  N  + +++ D KSQVT  Y D +   ID +++S QHS++     + E+    II  V+    L +  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K S+E++  ++   F+      I+  ++  PIY   + YGHFGR E    WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRRTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAAVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDIRLTDLQEAVMEEIIKPVLPAEWLTASTKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKVSEERLITLVREFFELRPYGLIQMLDLLHPIYQATAAYGHFGREEFP--WEKTDK 373
>gi|22298521|ref|NP_681768.1| S-adenosylmethionine synthetase [Thermosynechococcus elongatus BP-1] >gi|29611806|sp|Q8DK88|METK_SYNEL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|22294701|dbj|BAC08530.1| S-adenosylmethionine synthetase [Thermosynechococcus elongatus BP-1] (416 aa)
Score = 853, Expect = 1.9e-89, Identities = 178/368 (48%), Positives = 248/368 (67%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES---------FCNAIIDFVVKKYNLNSD--FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMR-------SPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +R + +SESV +GHPDKICDQI+DA+LD  L QDP S+VA EV     L++I GEITT   V+ V +A   +  +GY +++    +N       ++ QS +I   V+              ++IGAGDQG+++GYA +E   +MPLPI++AH + +    V    ++ +++ D K+QVT+ Y D +   ID I++S QH+      S ES            A++  V     L  D   + ++N +GKF IGGP GD+GLTGRKL+VDTYG  A+HGGGAFSGKD TKVDRS AY ARYIAKNIVAA LA KCE+Q+S+AIG ++P++  VDTFGT K S EQ+ E+I   FD    + I+  N+R          Y   + YGHFGR +L+  WE+LDKV ++
  S:     1 MRYLFSSESVTEGHPDKICDQIADAILDALLTQDPQSRVAAEVVVNTGLVLITGEITTKAQVNYVNLARQKIHEIGYTDANNGFAANSCAVLVALDEQSPDIARGVDTAQEAREQLSDAELDRIGAGDQGIMFGYACNETPEYMPLPISLAHRMARRLAAVRKTGQLPYLRPDGKTQVTVIYEDGKPVGIDTILISTQHTATIDDISEESAVQAKIKADLWEAVVKPVFADLTLQPDGNTRFLVNPTGKFVIGGPQGDSGLTGRKLVVDTYGGYARHGGGAFSGKDPTKVDRSAAYMARYIAKNIVAAGLADKCELQISYAIGVARPMSLFVDTFGTGKLSPEQLLELIKTHFDLRPAAIIQTLNLRHLPQERGGRFYQDVAAYGHFGRHDLDLPWEKLDKVADL 405
>gi|153853516|ref|ZP_01994896.1| hypothetical protein DORLON_00885 [Dorea longicatena DSM 13814] >gi|149753671|gb|EDM63602.1| hypothetical protein DORLON_00885 [Dorea longicatena DSM 13814] (377 aa)
Score = 852, Expect = 2.1e-89, Identities = 168/358 (46%), Positives = 245/358 (68%)
  Q:    20 ICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +CDQISDA+LD  ++QDP S+VACE      ++++ GEITT  Y+D+ K+  + +  +GY       D     +I+ ++ QS +I   V+K              + IGAGDQG+++GYA+DE   +MP PI +AH L +   +V  N  + +++ D K+QVT++Y ++  P ++D +++S QH    T++ I +     + D  + +  ++   K  IN +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKDCTKVDRS AY ARY+AKNIVAA LAKKCE+QLS+AIG + P +  VDTFGT    D+++ EII   FD      I+  ++R PIY   + YGHFGRT+++  WE+LDKVE++    KKY
  S:     1 MCDQISDAILDALMEQDPMSRVACETATTTGMVLVMGEITTNAYIDIQKIVRDTIKEIGYTRGKYGFDAETCGVITAIDEQSTDIAMGVDKALEAKEHTMSEEEIDAIGAGDQGMMFGYASDETPEYMPYPIALAHKLSRKLTEVRKNGTLPYLRPDGKTQVTVEYDENGVPARLDAVVLSTQHDPEVTQDQIHKDIKKYVFDTTIPEGMVDDKTKFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLAKKCEIQLSYAIGVAHPTSIMVDTFGTGVLEDDKLVEIIRENFDLRPAGIIQMLDLRRPIYKQTAAYGHFGRTDIDLPWEKLDKVEDL----KKY 376
>gi|15896110|ref|NP_349459.1| S-adenosylmethionine synthetase [Clostridium acetobutylicum ATCC 824] >gi|22095849|sp|Q97F85|METK_CLOAB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|15025901|gb|AAK80799.1|AE007783_6 S-adenosylmethionine synthetase [Clostridium acetobutylicum ATCC 824] (391 aa)
Score = 852, Expect = 2.2e-89, Identities = 175/375 (46%), Positives = 257/375 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE-----------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           +RK+ TSESV +GHPDKICDQISDA+LD  L++DPN +VACE      ++ + GEI+T  YVD+ K+    +  +GY  + +        ++++++ QS +I   V+           K + +GAGDQG+++GYAT+E + FMP+PI +AH L +   +V  +  +D+++ D K+QVTI+Y D +  ++D I++S QH      E IE      ++ +V+    L+ + K  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++ +VDTFGT K  + +I EI+   FD    + I   N++ PIY   + YGHFGR ++   WEQLD+VE I    KKY
  S:     1 MRKLFTSESVTEGHPDKICDQISDAILDAILEKDPNGRVACETTVTTGIVNVMGEISTNCYVDIPKIVRKTVREIGYTRAKYGFDCDTCAVVTSIDEQSADIAMGVDEALESKKGEMDKIDAVGAGDQGMMFGYATNETKEFMPMPIALAHRLSRRLAEVRKDGTLDYLRPDGKTQVTIEYEDDKPVRVDAIVISTQHGPEIGHEQIEKDLIEKVVKYVISPELLDENTKYYINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDRSAAYAARWVAKNLVAAGIADKLEIQLAYAIGVAKPVSISVDTFGTGKIEESKIVEIVEKVFDLRPGAIIRDLNLKRPIYRQVAAYGHFGRLDVELPWEQLDRVEAI----KKY 390
>gi|160871850|ref|ZP_02061982.1| methionine adenosyltransferase [Rickettsiella grylli] >gi|160872927|ref|ZP_02063058.1| methionine adenosyltransferase [Rickettsiella grylli] >gi|159120314|gb|EDP45653.1| methionine adenosyltransferase [Rickettsiella grylli] >gi|159120649|gb|EDP45987.1| methionine adenosyltransferase [Rickettsiella grylli] (394 aa)
Score = 852, Expect = 2.6e-89, Identities = 167/368 (45%), Positives = 244/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M+     TSESV +GHPDK+ DQISDAVLD  L+QD N++VACE      ++++ GEITT  +VDV ++    +  +GY+ S          +++ +  QS +I   V+K +++  GAGDQG+++GYA++E E FMP  I  AH L++   ++  N  +++++ D KSQVT+ Y + +  +++ I++S QH  +   + + E+    II  +     L    K  IN +G+F IGGP+ DTGLTGRK++VDTYG +A+HGGG FSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P A  ++TFGT+K SD +I E+I   FD      IE  N+  PIY   + YGHFGR   +  WE++DK E
  S:     1 MDNYTTFTSESVSEGHPDKVADQISDAVLDAILRQDMNARVACEAIVKTGMVLVAGEITTTAWVDVEQIVRETVKEIGYNSSSMGFDWESCAVMTAIGKQSPDIAQGVDKLDKLDQGAGDQGLMFGYASNETEVFMPAAITYAHRLMERQAKLRKNNSLNWLRPDAKSQVTLRYQNGKPTEVEAIVLSTQHDPDIAYDDLKEAVMEEIIKPIFPPAWLTQTTKYYINPTGRFVIGGPLSDTGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQISYAIGVAEPTAININTFGTAKLSDRRIIELIQQHFDLRPFGLIEMLNLLKPIYKRTAAYGHFGRENEDFPWEKIDKKE 378
>gi|160902829|ref|YP_001568410.1| methionine adenosyltransferase [Petrotoga mobilis SJ95] >gi|160360473|gb|ABX32087.1| Methionine adenosyltransferase [Petrotoga mobilis SJ95] (401 aa)
Score = 852, Expect = 2.6e-89, Identities = 165/367 (44%), Positives = 255/367 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDP-----NSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICDQISD +LD  L+++P     N++ A E      L+V+ GE+ T+ Y+DV  +  N ++ +GY+ + F        +I+++  QS +I   V++              +IGAGDQG+++GYAT+E + +MPLPI +AH L K    V  +  +DF++ D K+QVT++Y ++ NP  ++ +++S QHS + +++ +E +    +I  V+ +  +  D K ++N +G+F IGGP  DTGLTGRK++VDTYG  A HGGGAFSGKD TKVDRS  Y ARY+AKN+VA+  A +  +QLS+AIG ++P++  +DT GT+K  +E+IY+++   FDF   + I   N+  PIY   + YGHFGR ++   WE+LDKV+E+
  S:     3 KMLFTSESVTEGHPDKICDQISDTILDAILEKEPEENKMNARCAVETLVTRGLVVVTGEVRTSAYIDVPTLVRNTILDIGYNRAKFGFDGETCAVITSIEEQSPDIALGVDRSFEVKSKEKEDPFEKIGAGDQGIMFGYATNETDAYMPLPILLAHRLAKRLADVRKSNTLDFLRPDGKTQVTVEYDENNNPVGVETVLISAQHSPDISRQELEEAIKEHVITPVIPENLVTKDTKILVNPTGRFVIGGPQADTGLTGRKIIVDTYGGWAPHGGGAFSGKDPTKVDRSATYMARYVAKNLVASGAADEVLIQLSYAIGVAQPVSINIDTKGTAKVDEEKIYKVVKEIFDFRPAAIISNLNLLQPIYQKTAAYGHFGRKDVEFPWERLDKVKEL 395
>gi|88706353|ref|ZP_01104058.1| S-adenosylmethionine synthetase [gamma proteobacterium KT 71] >gi|88699289|gb|EAQ96403.1| S-adenosylmethionine synthetase [Congregibacter litoralis KT71] (384 aa)
Score = 851, Expect = 3.0e-89, Identities = 163/365 (44%), Positives = 250/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           I TSESV +GHPDK+ DQISDAVLD  L  D +++VA E      ++V+ GE+TT+ YVD+ ++  +V++ +GY+ SD         +++ +  QS++I   V++  + + GAGDQG+++GYA++E +  MP PI  +H LV+   Q+  +  + +++ D KSQVT+ Y + +   +D +++S QH    ++  I E+    I+  V+    L++D +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA++CE+Q+S+AIG ++P + +V++FGT K  D +I E++   FD   K  I+  +++ PIY   + YGHFGR E N  WE+ DK E +
  S:     6 IFTSESVSEGHPDKMADQISDAVLDHILTDDKDARVAVETMVKTGMVVVAGEVTTSTYVDLEEIVRDVVLDIGYNSSDVGFDGASCAVLNAIGKQSHDIAMGVDEGEEKEQGAGDQGLMFGYASNETDVLMPAPIYYSHRLVERQAQLRKDGSLSWLRPDAKSQVTLRYDNGKPVAVDAVVLSTQHDAEVSQADIREAVMEMIVKDVLPAEWLHADTQYHINPTGQFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAERCEIQVSYAIGVAEPTSISVNSFGTGKIDDLRIVELVREHFDLRPKGLIDMLDLKRPIYRATAAYGHFGREEPNFSWERTDKAEAL 380
>gi|188586938|ref|YP_001918483.1| methionine adenosyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351625|gb|ACB85895.1| methionine adenosyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] (396 aa)
Score = 851, Expect = 3.1e-89, Identities = 167/365 (45%), Positives = 255/365 (69%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           +K++TSESV +GHPDKI DQISDA+LD  L++DP+++VA E      L+++ GEITT  YVD+ K+    +  +GY  + +        ++++++ QS +I   V++              N IGAGDQG+++GYAT+E E ++PLPI +AH + +    V  +  + +++ D KSQVT++Y +++  +++++++S QHS   T + +E     IID VVK+      L+   + +IN +G+F +GGP GD G TGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY ARYIAKN+VAA LA KCE+Q+++AIG + P++  V+T+GT+K  ++QI E++   FD    + I   N+  PIY   + YGH GRT++   WE+ DK E
  S:     3 KKLVTSESVTEGHPDKIADQISDAILDAMLEKDPSARVAAETTVTTGLVLVTGEITTKCYVDIPKLVRETVQNIGYTRAKYGFDGETCAVLTSIDEQSPDIAQGVDQALEKRQEEITDDEINAIGAGDQGMMFGYATNETEEYLPLPIALAHKITRRLAAVRKDGTLPYLRPDGKSQVTVEYRNNEPYRVNKVVVSSQHSPKVTVDQLE---QEIIDNVVKEIIPSKFLDETTEYLINPTGRFVVGGPQGDAGATGRKVIVDTYGGVARHGGGAFSGKDPTKVDRSAAYAARYIAKNVVAAGLADKCELQVAYAIGVANPVSVMVETYGTAKIPEDQIEELVNKHFDLRPGAIIRDLNLLKPIYRQVACYGHMGRTDIELPWERTDKAE 388
>gi|125718306|ref|YP_001035439.1| S-adenosylmethionine synthetase [Streptococcus sanguinis SK36] >gi|158513227|sp|A3CNY4|METK_STRSV S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|125498223|gb|ABN44889.1| S-adenosylmethionine synthetase, putative [Streptococcus sanguinis SK36] (396 aa)
Score = 850, Expect = 3.5e-89, Identities = 170/370 (45%), Positives = 250/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L QDP++ VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH  +AT E I       +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ ++ E +   FD      I+  +++ PIY   + YGH GRT+++  WE+LDKVE +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAVLSQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLSHKLVRRLAELRKSGEIAYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPDATNEEIHRDVIEKVIKAVIPAQYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESKLQEAVRQIFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDIDLPWEKLDKVEAL 391
>gi|77410737|ref|ZP_00787096.1| S-adenosylmethionine synthetase [Streptococcus agalactiae CJB111] >gi|77163273|gb|EAO74225.1| S-adenosylmethionine synthetase [Streptococcus agalactiae CJB111] (398 aa)
Score = 850, Expect = 3.5e-89, Identities = 169/373 (45%), Positives = 255/373 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  N +  +GYD++++                   I   VN ++ E+  ++E+D  + IGAGDQG+++G+A DE    MPLPI++AH LVK    +  + ++ +++ D KSQVT++Y ++  P ++D +++S QH  N T + + +     +I+ V+  + L+   K  IN +G+F IGGP GD+GLTGRK++VD+YG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT   ++  +   +   FD      I   +++ PIY   + YGH GRT+++  WE++DKV+ + +F
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVN-EALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDSYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDF 394
>gi|192358797|ref|YP_001980731.1| S-adenosylmethionine synthetase [Cellvibrio japonicus Ueda107] >gi|190684962|gb|ACE82640.1| S-adenosylmethionine synthetase [Cellvibrio japonicus Ueda107] (384 aa)
Score = 850, Expect = 4.4e-89, Identities = 165/370 (44%), Positives = 246/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    + TSESV +GHPDK+ DQISDAVLD  L  DPN++VA E      + ++ GE+ T+ YVD+  +   V++ +GY+ SD         +++ +  QS +I   V++ +Q  +GAGDQG+++GYAT+E    MP PI  AH LV+   Q+  + ++ +++ D KSQVT+ Y + +   +D +++S QHS +  +  I E+    II  V+    L+ D +  IN +G+F IGGP+GD GLTGRK++VD+YG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +++TFGT K  D +I +++   FD   +  IE  N++ PIY   + YGHFGR   +  WE+ DK + +
  S:     1 MSEYSVFTSESVSEGHPDKMADQISDAVLDAILTDDPNARVAVETLVKTGMAIVAGEVRTSTYVDLEDLIRQVILDIGYNSSDVGFDGASCAVLNAIGKQSADIAMGVDEGDQKDLGAGDQGLMFGYATNETAVLMPAPIFYAHRLVEKQAQLRKSGELPWLRPDAKSQVTLRYENGKPVAVDAVVLSTQHSPSVQQAEIHEAVRELIIKNVLPAEWLHKDTQYHINPTGQFIIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSISINTFGTGKLPDAEIIKLVREHFDLRPRGLIEMLNLKRPIYRQTAAYGHFGRELPDFTWEKTDKADAL 380
>gi|77405535|ref|ZP_00782626.1| S-adenosylmethionine synthetase [Streptococcus agalactiae H36B] >gi|77175842|gb|EAO78620.1| S-adenosylmethionine synthetase [Streptococcus agalactiae H36B] (398 aa)
Score = 849, Expect = 4.8e-89, Identities = 169/373 (45%), Positives = 254/373 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  N +  +GYD++++                   I   VN ++ E+  ++E+D  + IGAGDQG+++G+A DE    MPLPI++AH LVK    +  + ++ +++ D KSQVT++Y ++  P ++D +++S QH  N T + + +     +I+ V+  + L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  VDTFGT   ++  +   +   FD      I   +++ PIY   + YGH GR +++  WE++DKV+ + +F
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVN-EALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRXDIDLPWERVDKVQALKDF 394
>gi|116670803|ref|YP_831736.1| S-adenosylmethionine synthetase [Arthrobacter sp. FB24] >gi|116610912|gb|ABK03636.1| methionine adenosyltransferase [Arthrobacter sp. FB24] (411 aa)
Score = 849, Expect = 5.3e-89, Identities = 167/369 (45%), Positives = 255/369 (69%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEI----FNAVEK---------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           ++ TSESV +GHPDKICDQISDA+LD  L +DP S+VA E  A   L+ + GE+TT  YV++ ++    ++ +GYD S          +  ++  QSN+I    FN++E          D Q GAGDQG+++GYA+DE  ++MP+PI IAH L +   +V  N ++ +++ D K+Q TI Y   +   ++ I++S QH++ A+ E + +     +I+ V+   NL+ S  + I+N +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LAK+ E+Q+++AIG ++P+   V+TFGT     E+I   I   FD   ++ I+  +++ PIY+  + +GHFGR + +  WE+LD+V+E+  F
  S:    19 RLFTSESVTEGHPDKICDQISDAILDALLAKDPESRVAVETLATTGLVHVAGEVTTDAYVEIPQIVRETILGIGYDSSANGFDGARCGVSVSIGQQSNDIAGGVFNSLEAREGRQEDDYDLQ-GAGDQGLMFGYASDETPSYMPIPIWIAHRLSERLTEVRKNGELPYLRPDGKTQATIGYDRDRPVSVETIVISSQHAEGASLEQLRADLATHVINPVLAATNLDISRARNILNPAGAFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAKRAEIQIAYAIGQARPVGTYVETFGTETVDPERISAAISEIFDLRPRAIIDALDLKRPIYAKTAAHGHFGRDDPDFTWERLDRVDELKAF 408
>gi|152978511|ref|YP_001344140.1| S-adenosylmethionine synthetase [Actinobacillus succinogenes 130Z] >gi|171704270|sp|A6VMK8|METK_ACTSZ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|150840234|gb|ABR74205.1| Methionine adenosyltransferase [Actinobacillus succinogenes 130Z] (383 aa)
Score = 848, Expect = 6.0e-89, Identities = 173/365 (47%), Positives = 251/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E E FMP PI  AH L++   +V  +  +D+++ D KSQ+T  Y D++   ID +++S QH+++ + KE  E     II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  ++TFGT K ++E + +++   FD      I+  ++  PIY   + YGHFGR +    WE++D+  E+
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYKHSDMGFDGHSCAVLNAIGKQSQDINQGVDRENPLDQGAGDQGIMFGYATNETEVFMPAPITYAHRLMERQAKVRKDGTLDWLRPDAKSQLTFKYEDNKIVGIDAVVLSTQHAESVSQKEVHEGVMEEIIKPVLPAKWLDKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVAEPTSIMLETFGTGKVANELLVKLVREFFDLRPYGLIQMLDLIRPIYRETAAYGHFGREQFP--WEKIDRAAEL 377
>gi|150021626|ref|YP_001306980.1| S-adenosylmethionine synthetase [Thermosipho melanesiensis BI429] >gi|166201416|sp|A6LNU4|METK_THEM4 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|149794147|gb|ABR31595.1| Methionine adenosyltransferase [Thermosipho melanesiensis BI429] (395 aa)
Score = 848, Expect = 6.5e-89, Identities = 161/368 (43%), Positives = 250/368 (67%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEI--------------FNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +R++ TSESV +GHPDK+ DQISDA+LD  L+QDP S+VA E      + ++ GE+TT  YVD+  +    ++ +GY  + +        ++S+++SQS +I               NA +    +GAGDQG+++GYAT+E +  MPLPI +AH L     ++  +  + F++ D K+QVT++Y ++  P ++D +++S QH  N T   I E+    +ID ++ +   + +   ++N +G+F +GGP  DTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS  YFARY+AKN+VAA LA K  +Q+++AIG +KP++  ++T+GT+K  +++I + ++  FDF   + I+K N+  PIY   + YGHFGR      WE+LD V+E+
  S:     1 MRRLFTSESVTEGHPDKVADQISDAILDAMLEQDPRSRVAVETLVTTGIAIVSGEVTTRAYVDIQDIVRKTIMEIGYTRAKYGFDGETCAVLSSIHSQSPDIAMGVDKALEAKEGELNAQDDLELVGAGDQGMMFGYATNETKELMPLPIMLAHKLALKLSEIRKSGTVPFLRPDGKTQVTVEYDENDRPVRVDTVLISTQHEPNVTIAEIKEALVKYVIDPIIPEELRDDNLNILVNPTGRFVLGGPSADTGLTGRKIIVDTYGGAIPHGGGAFSGKDPTKVDRSAHYFARYVAKNVVAAGLADKFMIQVAYAIGKAKPVSVMINTYGTAKIDEDKILKAVLELFDFRPGAIIKKLNLLRPIYKKTAAYGHFGRELEEFTWEKLDMVDEL 391
>gi|168486745|ref|ZP_02711253.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|168490849|ref|ZP_02714992.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|168492911|ref|ZP_02717054.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC3059-06] >gi|183570295|gb|EDT90823.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|183574779|gb|EDT95307.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|183576917|gb|EDT97445.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC3059-06] (396 aa)
Score = 847, Expect = 8.8e-89, Identities = 172/375 (45%), Positives = 251/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE E  MPLPI ++H LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I +   N +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ Q+ +     FD      I+  +++ PIY   S YGH GRT+++  WE+LDKV+ + E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVINKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK 396
>gi|121593129|ref|YP_985025.1| S-adenosylmethionine synthetase [Acidovorax sp. JS42] >gi|158513896|sp|A1W3X4|METK_ACISJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|120605209|gb|ABM40949.1| methionine adenosyltransferase [Acidovorax sp. JS42] (393 aa)
Score = 846, Expect = 1.0e-88, Identities = 169/361 (46%), Positives = 242/361 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE---SFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD    QDP S+VA E      L+V+ GEITT  +VD +++A + +  +GYD +++        ++   + QSN+I   V+   D+ +  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QHS + ++ + +   SF  AII+ ++K         D K +IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++C++Q+++AIG ++P+   V T GT    D+QI +++   FD   K  I+  ++  PIY+  + YGHFGR E    WE+ DK
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFTQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIQRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGKPHSIDTVVLSTQHSPDQSETATKMKASFTEAIIEEIIKPVLPKEWLQDTKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNITVYTEGTGVIPDDQIAQLVQEHFDLRPKGIIQMLDLLRPIYAKTAAYGHFGREEPEFTWERTDK 383
>gi|123443614|ref|YP_001007586.1| S-adenosylmethionine synthetase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|158512888|sp|A1JPS4|METK_YERE8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|122090575|emb|CAL13444.1| S-adenosylmethionine synthetase [Yersinia enterocolitica subsp. enterocolitica 8081] (384 aa)
Score = 846, Expect = 1.2e-88, Identities = 163/363 (44%), Positives = 243/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDK+ DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E    MP PI  AH LV+   +V  N  + +++ D KSQ+T  Y D +   ID +++S QHS + +   + E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K +++++  ++   F+      I+  ++  PIY   + YGHFGR E    WE+ DK
  S:     3 KHLFTSESVSEGHPDKVADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRRTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAEVRKNGTLPWLRPDAKSQITFQYDDGKIVGIDAVVLSTQHSDDISLTDLQEAVMEEIIKPVLPAEWLSKETKYHINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTGKIAEDRLVALVREFFELRPYGLIQMLDLLHPIYRKTAAYGHFGREEFP--WEKTDK 373
>gi|34763439|ref|ZP_00144386.1| S-adenosylmethionine synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886880|gb|EAA24005.1| S-adenosylmethionine synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (383 aa)
Score = 846, Expect = 1.2e-88, Identities = 173/363 (47%), Positives = 251/363 (69%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYD-----ESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADS-QNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSP--IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           TSE V  GHPDK+ DQISDAVLD CLK DPNS+VACEVF    L+V+GGEITT+ Y+DV  +    +  +GY      +S+   +S +++QS +I   V+     GAGDQG+++G A  E E  MPL + ++ +++     ++ N +I + + D KSQVT+ Y ++ +   +D I++SVQH ++ T + IE +    ++  +++KYNLNSD  K  IN +G+F IGGP GDTG+TGRK++VDTYG   +HGGGAFSGKD +KVDRS AY AR++AKNIVAA+LA KCE+QLS+AIG   P++  VDTFGTSK  +++I E +   FD S +   +   +R     Y   + +GH GRT+++  WE+L+K++E+
  S:     8 TSEFVSPGHPDKVSDQISDAVLDACLKDDPNSRVACEVFCTTGLVVVGGEITTSTYIDVQDIVRRKIDEIGYRPGMGFDSNCGTLSCIHAQSPDIAMGVDTG---GAGDQGIMFGGAVRETEELMPLALVLSREILVKLTNMMKNNEIKWARPDQKSQVTLAYDENGKVDHVDSIVVSVQHDEDVTHDEIEKTVIEKVVKPILEKYNLNSDNIKYYINPTGRFVIGGPHGDTGVTGRKIIVDTYGGYFRHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAELADKCEIQLSYAIGVPYPVSIKVDTFGTSKVDEDKISEAVSKVFDLSPRGIEKALELREGKFKYQDLAAFGHIGRTDIDTPWERLNKIDEL 377
>gi|15673884|ref|NP_268059.1| S-adenosylmethionine synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|13878576|sp|Q9CEE0|METK_LACLA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|12724937|gb|AAK06000.1|AE006419_10 S-adenosylmethionine synthetase (EC 2.5.1.6) [Lactococcus lactis subsp. lactis Il1403] (399 aa)
Score = 845, Expect = 1.3e-88, Identities = 175/370 (47%), Positives = 248/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES----DFTII----------SNVNSQSNEIFNAVEKDNQ-------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  + + TSESV +GHPDK+ DQISDA+LD  L QDP++ VACE       + + GEI+T+ YVD+  +    +  +GY +S    D+  +          S++    NE     +K+ Q       IGAGDQG+++G+AT+E   +MPL I+++H LVK    +  + +I +++ D KSQVT++Y D+   K ID +++S QH+ +A  E I +   N +I  V+    L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA+K ++QLS+AIG + P +  VDTFGT K SD+++   I   FD      I+  ++  PIY   + YGHFGRT++   WEQ DKVEE+
  S:     1 MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDDNGKAKRIDTVVISTQHAASARNEEIHDDVINKVIKAVIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLAEKAQIQLSYAIGVATPTSINVDTFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTAAYGHFGRTDVELPWEQTDKVEEL 393
>gi|124268436|ref|YP_001022440.1| S-adenosylmethionine synthetase [Methylibium petroleiphilum PM1] >gi|158512864|sp|A2SKW6|METK_METPP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|124261211|gb|ABM96205.1| methionine adenosyltransferase [Methylibium petroleiphilum PM1] (393 aa)
Score = 845, Expect = 1.4e-88, Identities = 170/365 (46%), Positives = 243/365 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--QNATKESIE-SFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD    QDP S+VA E      L+V+ GEITT  +VD +++A + +  +GYD +++        ++   + QSN+I   V++  D+ +  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QHS  Q+ T + ++ SF  AII+ ++K         D K +IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++C++Q+++AIG ++P+   V T GT    D+Q+  ++   FD   K  I+  ++  PIY   + YGHFGR E    WE+ DK   +
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFAQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDQASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGKPHSIDTVVLSTQHSPDQSETAKKMKASFTEAIIEEIIKPVLPKEWLKDTKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNITVYTEGTGVIPDDQLARLVAEHFDLRPKGIIQMLDLLRPIYEKTAAYGHFGREEPEFSWEKTDKANAL 387
>gi|19703697|ref|NP_603259.1| S-adenosylmethionine synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22095828|sp|Q8RGE5|METK_FUSNN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|19713821|gb|AAL94558.1| S-adenosylmethionine synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (383 aa)
Score = 845, Expect = 1.6e-88, Identities = 175/363 (48%), Positives = 252/363 (69%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYD-----ESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADS-QNPKIDQIIMSVQHSQNATKESIESFC-NAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSP--IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           TSE V  GHPDKI DQISDA+LD CLK DPNS+VACEVF    L+V+GGEITT+ Y+DV  +    +  +GY      +S+   +S +++QS +I   V+     GAGDQG+++G A  E E  MPL + ++ +++     ++ + +I++ + D KSQVT+ Y ++ +   +D I++SVQH ++ T + IE      ++  V++KYNL+SD  K  IN +G+F IGGP GDTG+TGRK++VDTYG   KHGGGAFSGKD +KVDRS AY AR++AKNIVAA+LA KCE+QLS+AIG  KP++  VDTFGTSK  +++I E +   FD S +   +   +R     Y   + +GH GRT+++  WE+L+KV+E+
  S:     8 TSEFVSPGHPDKISDQISDAILDACLKDDPNSRVACEVFCTTGLVVVGGEITTSTYIDVQDIVRKKIDEIGYRPGMGFDSNCGTLSCIHAQSPDIAMGVDIG---GAGDQGIMFGGAVRETEELMPLALVLSREILVKLTNMMKSNEIEWARPDQKSQVTLAYDENGKVDHVDSIVVSVQHDEDTTHDEIEKIVIEKVVKPVLEKYNLSSDNIKYYINPTGRFVIGGPHGDTGVTGRKIIVDTYGGYFKHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAELADKCEIQLSYAIGVPKPVSVKVDTFGTSKVDEDKISEAVSKVFDLSPRGIEKALELREGNFKYQDLAAFGHIGRTDIDTPWERLNKVDEL 377
>gi|89902639|ref|YP_525110.1| S-adenosylmethionine synthetase [Rhodoferax ferrireducens T118] >gi|109892658|sp|Q21RM4|METK_RHOFD S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|89347376|gb|ABD71579.1| methionine adenosyltransferase [Rhodoferax ferrireducens T118] (393 aa)
Score = 844, Expect = 1.7e-88, Identities = 169/365 (46%), Positives = 240/365 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK------ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD   KQDP S+VA E      L+V+ GEITT  +VD +++A + L  +GYD +++        ++   + QSN+I   V+   D+ +  GAGDQG+++GYA +E    MP PI  AH LV+   Q+  + ++ F++ D KSQ+T+ Y D +   ID +++S QHS   +         IE+    II  V  K  L +D K +IN +G+F +GGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA++C++Q+++AIG +KP+   V T GT    D++I E++   FD   K  I+  ++  PIY   + YGHFGR E    WE+ DK + +
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFKQDPKSRVAAETLCNTGLVVLAGEITTNAHVDYIQVARDTLKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACNETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQITMHYVDGKPHSIDTVVLSSQHSPEMSNGLTMKPAFIEAVMEDIIKPVCPKEWLTADTKYLINPTGRFVVGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVAKPMNVTVYTEGTGVIPDDKIAELVHELFDLRPKGIIQMLDLLRPIYEKTAAYGHFGREEPEFTWERTDKAQAL 387
>gi|88798490|ref|ZP_01114074.1| S-adenosylmethionine synthetase [Reinekea sp. MED297] >gi|88778590|gb|EAR09781.1| S-adenosylmethionine synthetase [Reinekea sp. MED297] (384 aa)
Score = 844, Expect = 1.8e-88, Identities = 167/368 (45%), Positives = 246/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDAVLD  + +DP+++VA E      + +I GE+ T+ YVD+  +  +V+  +GY  SD         +I+ +  QS++I   V++  D  +GAGDQG+++GYAT+E E +MP PI  +H LV+   ++  N  + +++ D KSQVT+ Y + +   +D +++S QH  +   + + E+    +I  V+    L++D K  IN +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + A++TFGT+K  +  I E++   FD   +  IE  ++R PIY P + YGHFGR   +  WE  DKV+
  S:     1 MSEYSLFTSESVSEGHPDKMADQISDAVLDAIITEDPHARVAVETLVKTGMAIIAGEVRTSTYVDLEDIVRDVIRDIGYTSSDVGFDGSSCAVINAIGKQSSDIAVGVDEAEDKDLGAGDQGLMFGYATNETETYMPAPIYYSHRLVEQQAKLRKNGVLPWLRPDAKSQVTLRYENGKPVAVDAVVLSTQHDPSIKLDDLREAVLENVIKEVLPSEWLHADTKFHINPTGIFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSIAINTFGTNKVDEALIAELVREHFDLRPRGIIEMLDLRKPIYRPTAAYGHFGRDGFS--WEATDKVD 376
>gi|157150952|ref|YP_001450276.1| S-adenosylmethionine synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|189081738|sp|A8AWW6|METK_STRGC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|157075746|gb|ABV10429.1| S-adenosylmethionine synthetase [Streptococcus gordonii str. Challis substr. CH1] (396 aa)
Score = 844, Expect = 1.9e-88, Identities = 169/372 (45%), Positives = 250/372 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           M  RK+ TSESV +GHPDKI DQISDA+LD  L QDP++ VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y ++ +P ++D +++S QH   AT E I       +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ ++ E +   FD      I+  +++ PIY   + YGH GRT+++  WE+ DKV+ + E
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAVLSQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDHPVRVDTVVISTQHDPEATNEEIHRDVIEKVIKAVIPAQYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGIVAESKLQEAVRQIFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDIDLPWEKTDKVQALKE 393
>gi|77974474|ref|ZP_00830014.1| COG0192: S-adenosylmethionine synthetase [Yersinia frederiksenii ATCC 33641] (384 aa)
Score = 844, Expect = 1.9e-88, Identities = 166/363 (45%), Positives = 240/363 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT  +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E    MP PI  AH LV+    V  N  + +++ D KSQVT  Y D +   ID +++S QHS++  ++ + E+    II  V+    + S  K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+ FGT K   +Q+  ++   FD      I+  ++  PIY   + YGHFGR   N  WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTNAWVDIEEITRRTVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAAVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEDINQKDLHEAVMEEIIKPVLPAEWITSATKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVEAFGTEKIPADQLTALVREFFDLRPYGLIKMLDLLHPIYRETAAYGHFGRE--NFPWEKTDK 373
>gi|116624354|ref|YP_826510.1| S-adenosylmethionine synthetase [Solibacter usitatus Ellin6076] >gi|116227516|gb|ABJ86225.1| methionine adenosyltransferase [Solibacter usitatus Ellin6076] (389 aa)
Score = 844, Expect = 1.9e-88, Identities = 175/367 (47%), Positives = 242/367 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R I TSESV +GHPDKI DQISDAVLD  L  DP  +VACEV       ++ GEITT  YVDV ++A + +  +GY+++ +   SN       + SQS +I   V+     GAGDQG+++GYA DE    MPLPI +AH L +       +  ++F++ D KSQV+++Y D +  +I+ +++S QHS + + E +       IID VV    +++D K  IN +G+F +GGP GDTGLTGRK++VDTYG + +HGGGAFSGKD TKVDRS  Y ARYIAKNIVA+KLA +CEVQL++AIG ++P++  V+TFGT    D +  E++   F  +    IE  N+R PIY   + +GHFGRT+    WE+ DK E +
  S:     6 RHIFTSESVTEGHPDKIADQISDAVLDAVLADDPTGRVACEVLVTTGTCIVAGEITTKTYVDVQRIARSTIEYVGYNDATYGFDSNTCGVHNLIQSQSPDISMGVDTG---GAGDQGLMFGYACDETPELMPLPIMMAHKLCQRLSDARRDGTLNFLRPDGKSQVSVEYVDGKPKRIEAVVISTQHSPDVSTEDLRREVRKHIIDAVVPANMVDADTKYHINPTGRFVVGGPHGDTGLTGRKIIVDTYGGMGRHGGGAFSGKDPTKVDRSACYMARYIAKNIVASKLASRCEVQLAYAIGVAEPVSVMVNTFGTGTIPDARFTELVRKNFKLTPAGIIESLNLRRPIYRKTAAFGHFGRTDETFTWEKTDKAEAL 377
>gi|123430763|ref|XP_001307947.1| methionine adenosyltransferase, putative [Trichomonas vaginalis G3] >gi|121889602|gb|EAX95017.1| methionine adenosyltransferase, putative [Trichomonas vaginalis G3] (390 aa)
Score = 844, Expect = 2.0e-88, Identities = 173/368 (47%), Positives = 255/368 (69%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           +SESV +GHPDK+CDQISDA+LD+ L +D N++VACE  A+  +IVI GEI+T  YVD  K A  VL  +GY+ + F        ++S +  QS++I   V++  +         GAGDQG+++G+A +E E  MPLPI++AH L +   +V  N  +D+++ D K+QVT++Y + +  ++  +++S QH+     E I E     +++ VV K  ++ D +  IN +G+F IGGP+ D GLTGRK++VDTYG   +HGGGAFSGKD TKVDRSGAY+ARYIAKN+VAA LA K E+ L++AIG ++P +  V+TFGT K S E+I +II+  FD    + I   ++  PIY   +TYGHF R +L+  WE+ D+VE++ ++ K
  S:     7 SSESVTEGHPDKVCDQISDAILDKILAEDKNARVACETMASTGMIVITGEISTETYVDFEKTAREVLEDIGYNRAKFGFDGRTCAVLSAIKEQSSDIAMGVDRFKEEGVDELDSFGAGDQGIMFGFACNETEELMPLPISLAHKLSRRLTEVRKNRTLDYLRPDGKTQVTVEYEEDKPVRLKNVVVSSQHAPGVPMEQIREDIIREVVEKVVPKKFIDKDTEFFINPTGRFVIGGPMADAGLTGRKIIVDTYGGFGRHGGGAFSGKDPTKVDRSGAYYARYIAKNLVAAGLADKVEIGLAYAIGIARPTSVYVETFGTGKLSHEEIEKIIMENFDMRPAAIIRDLDLLRPIYRQTATYGHFERNDLDLPWEKTDRVEDLKKYLK 390
>gi|90020119|ref|YP_525946.1| S-adenosylmethionine synthetase [Saccharophagus degradans 2-40] >gi|109892661|sp|Q21NJ5|METK_SACD2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|89949719|gb|ABD79734.1| methionine adenosyltransferase [Saccharophagus degradans 2-40] (382 aa)
Score = 844, Expect = 2.0e-88, Identities = 162/367 (44%), Positives = 247/367 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           M    + TSESV +GHPDK+ DQISDA+LD  L  D N++VA E      + ++ GE+ T+ Y+D+  +  +V++ +GY+ SD         +++ +  QS +I   V++ N   +GAGDQG+++GYAT+E +  MP PI  +H LV+   ++  N K+++++ D KSQVT+ Y + +   +D +++S QH+ + ++ +I E+    II   +    L++D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA +CE+Q+S+AIG ++P + +V+TFGT   +D +I +++   FD   +  IE  ++  PIY   + YGHFGR E    WE+ DKV
  S:     1 MAQYSLFTSESVSEGHPDKMADQISDAILDAILADDKNARVAVETMVKTGMAIVAGEVRTSTYIDLEDLIRDVILDIGYNSSDVGFDGASCAVLNAIGKQSADIAMGVDEANNKDLGAGDQGLMFGYATNETDVLMPAPIYYSHRLVEKQAELRKNGKLNWLRPDAKSQVTLRYDNGKPVAVDAVVLSTQHNPDVSQATIREAVMEEIIKTTLPAEWLHADTKYHINPTGQFIIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLASRCEIQVSYAIGVAEPTSISVNTFGTGSIADSEISKLVAQHFDLRPRGIIEMLDLLRPIYRKTAAYGHFGREEPEFTWEKTDKV 377
>gi|154248824|ref|YP_001409649.1| S-adenosylmethionine synthetase [Fervidobacterium nodosum Rt17-B1] >gi|171769437|sp|A7HJA9|METK_FERNB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|154152760|gb|ABS59992.1| Methionine adenosyltransferase [Fervidobacterium nodosum Rt17-B1] (396 aa)
Score = 843, Expect = 2.6e-88, Identities = 160/368 (43%), Positives = 253/368 (68%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIF-------------NAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +R++ TSESV +GHPDK+ DQISDA+LD  ++QDP ++VA E      + ++ GE+TT  YVDV  +    ++ +GY  + +        ++S+++SQS +I               A ++  ++GAGDQG+++GYAT+E E  MPLPI +AH L     +V  N  + F++ D K+QVTI+Y +++ P ++D +++S QH  + T   I E+    +I+ ++ +   + + K ++N +G+F +GGP  DTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS  YFARY+AKN+VAA LA K  +Q+++AIG ++P++  ++TFGT+K  +E++ +++   FDF   + I+K ++  PIY   + YGHFGR + +  WE+ D V E+
  S:     1 MRRLFTSESVTEGHPDKMADQISDAILDAIIEQDPKARVAVETLLTTGVAIVAGEVTTKAYVDVQDIVRKTVLDIGYTRAKYGFDGETCAVLSSIHSQSPDIALGVNEAAEFKQGDKAEDEIEKVGAGDQGMMFGYATNETEELMPLPIMLAHKLAMKLAEVRKNGTVPFLRPDGKTQVTIEYDENEKPVRVDTVLISTQHEPDVTIPEIREALVKYVINPIIPENLRDDNMKILVNPTGRFVLGGPSADTGLTGRKIIVDTYGGAIPHGGGAFSGKDPTKVDRSAHYFARYVAKNVVAAGLADKFMIQVAYAIGVARPVSIMINTFGTAKVDEEKLRKVVEEIFDFRPGAIIKKLDLLRPIYRKTAAYGHFGRNDPDFTWERTDMVREL 390
>gi|110835478|ref|YP_694337.1| S-adenosylmethionine synthetase [Alcanivorax borkumensis SK2] >gi|123050228|sp|Q0VL83|METK_ALCBS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|110648589|emb|CAL18065.1| methionine adenosyltransferase [Alcanivorax borkumensis SK2] (382 aa)
Score = 842, Expect = 3.0e-88, Identities = 164/370 (44%), Positives = 247/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    I TSESV +GHPDK+ DQISDA+LD  +K DP+++VA E      + V+ GE+ T  YV++  +   V++ +GYD S+         +++ +  QS +I   V++  + ++GAGDQG+++G+ATDE +  MP P+  +H LV+   ++  N+ + +++ D KSQVT+ Y + +   +D +++S QHS +     + E+    II  V+ +  L+ D    +N +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +V+TFGT K SD  I +++   FD   +  IE  ++R PIY P ++YGHFGR   +  WE+ DK E +
  S:     1 MSEYSIFTSESVSEGHPDKMADQISDAILDAIIKDDPHARVAVETMVKTGMAVVAGEVRTNTYVELEDIVRQVILDIGYDSSEKGFDGASCAVLNGIGKQSADIAIGVDEAEEKEMGAGDQGLMFGFATDETDTLMPAPVYYSHRLVERQAKLRKNSTLPWLRPDAKSQVTLRYDNGKPVAVDAVVLSTQHSPDIKLADLREAVMEEIIKPVLPEEWLHKDTLYHVNPTGIFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLASKCEIQVSYAIGVAEPTSISVNTFGTGKISDSAIVDLVREHFDLRPRGIIEMLDLRKPIYRPTASYGHFGREGFS--WEKTDKTEAL 378
>gi|121611746|ref|YP_999553.1| S-adenosylmethionine synthetase [Verminephrobacter eiseniae EF01-2] >gi|158514007|sp|A1WSC8|METK_VEREI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|121556386|gb|ABM60535.1| methionine adenosyltransferase [Verminephrobacter eiseniae EF01-2] (403 aa)
Score = 842, Expect = 3.0e-88, Identities = 166/361 (45%), Positives = 245/361 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH--SQNATKESI-ESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD  L+QDP S+VA E      L+V+ GEI+T  +VD +++A + +  +GYD++D+        ++   + QSN+I   V+   D+ +  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QH   Q+AT  ++ +SF +A+I+ +++         D + +IN +G+F  GGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY AR++AKN+VAA LA++C++Q+++AIG ++P+   V T GT   +DE+I  +I   FD   +  I+  ++  PIY   + YGHFGR E    WE+ DK
  S:     6 LFTSESVSEGHPDKVADQISDAILDALLRQDPRSRVAAETLTNTGLVVLAGEISTNAHVDYIQVARDTIRRIGYDDTDYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTLRYVDGKPHSIDTVVLSTQHHPDQSATATTMKQSFIDAVIEEIIRPVLPKEWLHDTRFLINPTGRFVTGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARHVAKNVVAAGLARQCQIQVAYAIGVAEPMNITVYTEGTGVIADERIAALIKQHFDLRPRGIIQMLDLLRPIYEKTAAYGHFGREEPEFTWERTDK 383
>gi|55737166|gb|AAV60808.1| S-adenosylmethionine synthetase [Streptococcus thermophilus LMG 18311] (412 aa)
Score = 842, Expect = 3.0e-88, Identities = 166/370 (44%), Positives = 251/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + + GE++T  YVD+ ++  + +  +GY+ +++   +       ++  QS +I   V +             + IGAGDQG+++G+A DE   FMPLP++++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG + P++  VDTFGT+  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ +
  S:    16 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDAL 406
>gi|15900656|ref|NP_345260.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae TIGR4] >gi|111658347|ref|ZP_01409035.1| hypothetical protein SpneT_02000487 [Streptococcus pneumoniae TIGR4] >gi|148997162|ref|ZP_01824816.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP11-BS70] >gi|149025530|ref|ZP_01836463.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP23-BS72] >gi|168575421|ref|ZP_02721357.1| methionine adenosyltransferase [Streptococcus pneumoniae MLV-016] >gi|22095897|sp|Q97RN9|METK_STRPN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|14972236|gb|AAK74900.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae TIGR4] >gi|147756862|gb|EDK63902.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP11-BS70] >gi|147929402|gb|EDK80399.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP23-BS72] >gi|183578649|gb|EDT99177.1| methionine adenosyltransferase [Streptococcus pneumoniae MLV-016] (396 aa)
Score = 842, Expect = 3.0e-88, Identities = 171/375 (45%), Positives = 251/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE E  MPLPI ++H LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I +   + +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ Q+ +     FD      I+  +++ PIY   S YGH GRT+++  WE+LDKV+ + E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK 396
>gi|15902715|ref|NP_358265.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae R6] >gi|116515567|ref|YP_816158.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae D39] >gi|148989843|ref|ZP_01821137.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP6-BS73] >gi|148992425|ref|ZP_01822120.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP9-BS68] >gi|149007642|ref|ZP_01831259.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP18-BS74] >gi|149010612|ref|ZP_01831983.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP19-BS75] >gi|168484833|ref|ZP_02709778.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|168488431|ref|ZP_02712630.1| methionine adenosyltransferase [Streptococcus pneumoniae SP195] >gi|169833973|ref|YP_001694223.1| methionine adenosyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|182683682|ref|YP_001835429.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae CGSP14] >gi|194397216|ref|YP_002037409.1| S-adenosylmethionine synthetase, central domain [Streptococcus pneumoniae G54] >gi|122278956|sp|Q04LE0|METK_STRP2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|29611807|sp|Q8DQH0|METK_STRR6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|15458258|gb|AAK99475.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae R6] >gi|116076143|gb|ABJ53863.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae D39] >gi|147760797|gb|EDK67768.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP18-BS74] >gi|147765093|gb|EDK72022.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147924785|gb|EDK75869.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP6-BS73] >gi|147928742|gb|EDK79755.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168996475|gb|ACA37087.1| methionine adenosyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|172041995|gb|EDT50041.1| methionine adenosyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|182629016|gb|ACB89964.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae CGSP14] >gi|183572942|gb|EDT93470.1| methionine adenosyltransferase [Streptococcus pneumoniae SP195] >gi|194356883|gb|ACF55331.1| S-adenosylmethionine synthetase, central domain [Streptococcus pneumoniae G54] (396 aa)
Score = 842, Expect = 3.1e-88, Identities = 171/375 (45%), Positives = 251/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE E  MPLPI ++H LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I +   + +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ Q+ +     FD      I+  +++ PIY   S YGH GRT+++  WE+LDKV+ + E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK 396
>gi|148324467|gb|EDK89717.1| methionine adenosyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (382 aa)
Score = 842, Expect = 3.3e-88, Identities = 174/363 (47%), Positives = 252/363 (69%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYD-----ESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADS-QNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSP--IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           TSE V  GHPDK+ DQISDAVLD CLK DPNS+VACEVF    L+V+GGEITT+ Y+DV  +    +  +GY      +S+   +S +++QS +I   V+     GAGDQG+++G A  E E  MPL + ++ +++     ++ N +I + + D KSQVT+ Y ++ +   +D I++SVQH ++ + + IE +    ++  V++KYNL+S+  K  IN +G+F IGGP GDTGLTGRK++VDTYG   +HGGGAFSGKD +KVDRS AY AR++AKNIVAA+LA KCE+QLS+AIG  KP++  VDTFGTSK  +++I E +   FD S +   +   +R     Y   + +GH GRT+++  WE+L+KV+E+
  S:     8 TSEFVSPGHPDKVSDQISDAVLDACLKDDPNSRVACEVFCTTGLVVVGGEITTSTYIDVQDIVRKKIDEIGYRPGMGFDSNCGTLSCIHAQSPDIAMGVDIG---GAGDQGIMFGGAVRETEELMPLALVLSREILVKLTNMMKNNEIKWARPDQKSQVTLAYDENGKVDHVDSIVVSVQHDEDVSHDEIEKTVIEKVVKPVLEKYNLSSENIKYYINPTGRFVIGGPHGDTGLTGRKIIVDTYGGYFRHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAELADKCEIQLSYAIGVPKPVSIKVDTFGTSKVDEDKISEAVSKVFDLSPRGIEKALELREGKFKYQDLAAFGHIGRTDIDTPWERLNKVDEL 377
>gi|116627905|ref|YP_820524.1| S-adenosylmethionine synthetase [Streptococcus thermophilus LMD-9] >gi|116101182|gb|ABJ66328.1| methionine adenosyltransferase [Streptococcus thermophilus LMD-9] (397 aa)
Score = 842, Expect = 3.6e-88, Identities = 167/370 (45%), Positives = 251/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + I GE++T  YVD+ ++  + +  +GY+ +++   +       ++  QS +I   V +             + IGAGDQG+++G+A DE   FMPLP++++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG + P++  VDTFGT+  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHIFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDAL 391
>gi|120609673|ref|YP_969351.1| S-adenosylmethionine synthetase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|158513027|sp|A1TKT9|METK_ACIAC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|120588137|gb|ABM31577.1| methionine adenosyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] (393 aa)
Score = 841, Expect = 3.8e-88, Identities = 171/361 (47%), Positives = 240/361 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH----SQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD   ++DP S+VA E      L+V+ GEITT  +VD +++A + +  +GYD +D+        ++   + QSN+I   V+   D+ +  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QH    S+ AT+    SF  A+I+ ++K         + K +IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++C++Q+S+AIG ++PI   V T GT    DE+I  ++   FD   K  I+  ++  PIY   + YGHFGR E    WE+ DK
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFREDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGKPHSIDTVVLSTQHHPDQSETATRMK-ASFIEAVIEEIIKPVLPKEWLQETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVSYAIGVARPINVTVYTEGTGVIPDEKIAALVQEHFDLRPKGIIQMLDLLRPIYEKTAAYGHFGREEPEFTWEKTDK 383
>gi|48428370|sp|Q7WYG5|METK_AMOPS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|32892067|gb|AAP88975.1| S-adenosylmethionine synthetase [Amoeba proteus symbiotic bacterium] (381 aa)
Score = 841, Expect = 4.1e-88, Identities = 165/362 (45%), Positives = 246/362 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ--IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           + TSESV +GHPDKI DQISDA+LD  L +DP ++VACE F    ++++GGEITT+ +VDV  +   V+  +GY+ SD        +++S +  QS +I   V+      +GAGDQG+++GYA+ E +  MP PI  +H L+    ++  N K+ +++ D K Q+T+ Y   +   ID I+ S QH+   + K+ +E+    II  V+ +  L++  +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGG FSGKD +KVDRSGAY AR++AKN+VAA +A+KCE+Q+S+AIG ++P + +VDTFGT    +  I ++I   FD + +  I+  ++ SPIY   + YGH+GR  L   WE+LDKV
  S:     5 VFTSESVSEGHPDKIADQISDAILDAILAKDPLARVACETFVKTGMVLVGGEITTSAWVDVETITREVIKDIGYNSSDMGFDWASCSVLSAIGKQSLDIAQGVDNRETKILGAGDQGLMFGYASRETDVCMPAPIAYSHRLMARQAELRKNNKLPWLRPDGKCQLTLKYDQGKPVAIDTIVFSTQHAPEISHKDLVEAVREEIIKPVLPEEWLSAATRYYINPTGRFVIGGPLGDCGLTGRKIIVDTYGGMARHGGGCFSGKDPSKVDRSGAYAARHVAKNLVAAGIAEKCEIQVSYAIGVAEPTSISVDTFGTGHLRNNVIIDLIKTHFDLTPQGIIDHHDLFSPIYRQTAAYGHYGRDGLP--WERLDKV 374
>gi|160901036|ref|YP_001566618.1| S-adenosylmethionine synthetase [Delftia acidovorans SPH-1] >gi|160366620|gb|ABX38233.1| Methionine adenosyltransferase [Delftia acidovorans SPH-1] (393 aa)
Score = 841, Expect = 4.4e-88, Identities = 169/361 (46%), Positives = 241/361 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE---SFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD    QDP S+VA E      L+V+ GEITT   VD +++A + +  +GYD +D+        ++   + QS +I   V+K  D+++  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QHS + ++ + +   SF  AII+ ++K         D K +IN +G+F +GGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++C++Q+++AIG ++P+   V T GT    D +I +++   FD   K  I+  ++  PIYS  + YGHFGR E    WE+ DK
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFAQDPYSRVAAETLTNTGLVVLAGEITTGANVDYIQVARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSQDIAQGVDKASDDELNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGKPHSIDTVVLSTQHSPDQSETATKMKASFTEAIIEEIIKPVLPSEWLQDTKYLINPTGRFVVGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNITVYTEGTGVIPDAEIAKLVAAHFDLRPKGIIQMLDLLRPIYSKTAAYGHFGREEPEFTWERTDK 383
>gi|148985889|ref|ZP_01818983.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP3-BS71] >gi|147922035|gb|EDK73159.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP3-BS71] (396 aa)
Score = 841, Expect = 4.8e-88, Identities = 170/375 (45%), Positives = 251/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE E  MPLPI ++H L++   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I +   + +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ Q+ +     FD      I+  +++ PIY   S YGH GRT+++  WE+LDKV+ + E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLIRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK 396
>gi|161611286|ref|YP_139623.2| S-adenosylmethionine synthetase [Streptococcus thermophilus LMG 18311] >gi|109892674|sp|Q5M434|METK_STRT2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) (397 aa)
Score = 840, Expect = 5.5e-88, Identities = 166/370 (44%), Positives = 251/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + + GE++T  YVD+ ++  + +  +GY+ +++   +       ++  QS +I   V +             + IGAGDQG+++G+A DE   FMPLP++++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG + P++  VDTFGT+  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDAL 391
>gi|169181014|ref|ZP_02841654.1| Methionine adenosyltransferase [Thauera sp. MZ1T] >gi|169011869|gb|EDS58625.1| Methionine adenosyltransferase [Thauera sp. MZ1T] (387 aa)
Score = 840, Expect = 5.6e-88, Identities = 168/361 (46%), Positives = 246/361 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQ+SD VLD  L +DP ++VACE   +  L+VI GEITT  + +  ++A +V+  +GYD SD         +++ +N QS +I   V   N      GAGDQG+++GYAT+E  + MPLPI+ AH +++   +V  + ++ +++ D KSQ+T+ Y D +   ID +++S QH  + T+E I E+    II  V+    +  D + ++N +G+F +GGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY  RY+AKN+VAA LA +CEVQ+++AIG ++P++  V+TFGT + +DE+I ++I   FD   K+ I+  ++  PIYS  + YGHFGR E    WEQ DK
  S:     5 LFTSESVSEGHPDKVADQVSDGVLDAVLAEDPKARVACETLVSTGLVVISGEITTTAHPNYREIAQDVIRRIGYDNSDIGFDYKSCAVLAAINRQSPDIAQGVNNANDDPLDQGAGDQGLMFGYATNETASLMPLPIHYAHRVMQRQAEVRKDGRLPWLRPDAKSQLTVKYVDGKPVAIDTVVVSTQHDPDVTQEQIREAVIELIIKPVLPPELMQGDVRYLVNPTGRFVVGGPHGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAGRYVAKNVVAAGLADRCEVQVAYAIGVARPVSLMVNTFGTGRIADEKIVDLIGRHFDLRPKAIIQTLDLLRPIYSRTAAYGHFGRDEPGFTWEQTDK 377
>gi|171056817|ref|YP_001789166.1| methionine adenosyltransferase [Leptothrix cholodnii SP-6] >gi|170774262|gb|ACB32401.1| Methionine adenosyltransferase [Leptothrix cholodnii SP-6] (393 aa)
Score = 839, Expect = 6.8e-88, Identities = 170/363 (46%), Positives = 242/363 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--QNATKESIESFCNAI----IDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDK+ DQISDA+LD   +QDP S+VA E      L+V+ GEITT  +VD +++A + +  +GYD +++        ++   + QSN+I   V+   D+ +  GAGDQG+++GYA DE    MP PI  AH LV+   Q+  + ++ F++ D KSQVT+ Y D +   ID I++S QHS  Q+   + I SF  AI    I  V+ K  + ++ + +IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA++C++Q+++AIG ++P+   V T GT    D +I +++   FD   K  I+  ++  PIY   + YGHFGR E    WE+ DK +
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGKPHSIDTIVLSTQHSPEQSLGDKMIPSFYEAIREELIKPVLPKEWITAETQYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNITVYTEGTGVIPDAEIAKLVEAHFDLRPKGIIQMLDLLRPIYQKTAAYGHFGREEPEFTWERTDKAQ 385
>gi|161936369|ref|YP_141534.2| S-adenosylmethionine synthetase [Streptococcus thermophilus CNRZ1066] >gi|109892673|sp|Q5LZI0|METK_STRT1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) (397 aa)
Score = 839, Expect = 6.9e-88, Identities = 166/370 (44%), Positives = 250/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + I GE++T  YVD+ ++  + +  +GY+ +++   +       ++  QS +I   V +             + IGAGDQG+++G+A DE   FMPLP++++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT + I       +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LA+K EVQL++AIG + P++  VDTFGT+  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHIFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRHDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDAL 391
>gi|55739078|gb|AAV62719.1| S-adenosylmethionine synthetase [Streptococcus thermophilus CNRZ1066] (412 aa)
Score = 839, Expect = 7.0e-88, Identities = 166/370 (44%), Positives = 250/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + I GE++T  YVD+ ++  + +  +GY+ +++   +       ++  QS +I   V +             + IGAGDQG+++G+A DE   FMPLP++++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT + I       +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LA+K EVQL++AIG + P++  VDTFGT+  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ +
  S:    16 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHIFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRHDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDAL 406
>gi|165976503|ref|YP_001652096.1| S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150407|ref|YP_001968932.1| S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165876604|gb|ABY69652.1| S-adenosylmethionine synthase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915538|gb|ACE61790.1| S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (383 aa)
Score = 839, Expect = 7.5e-88, Identities = 174/365 (47%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++ + +  GAGDQG+++GYAT+E E  MP PI  AH L++   +V  + K+D+++ D KSQ+T  Y +++   ID +++S QH+++ + K+ +E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K S+E + ++I   FD      I+  ++  PIY   + YGHFGR      WEQ DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGVDRADPLEQGAGDQGIMFGYATNETEVLMPAPITYAHRLMEQQAKVRKSGKLDWLRPDAKSQLTFAYENNKIVGIDAVVLSTQHAEHVSQKDLVEGVMEEIIKPVLPSEWLSQNTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVSNETLVKLIYQNFDLRPYGLIKMLDLIRPIYRETAAYGHFGREHFP--WEQTDKAEAL 377
>gi|167575211|ref|ZP_02368085.1| S-adenosylmethionine synthetase [Borrelia valaisiana VS116] (392 aa)
Score = 839, Expect = 8.1e-88, Identities = 180/372 (48%), Positives = 256/372 (68%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVK-----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           +I+TSE+V +GHPDKI DQISDA+LDE LK D N+KVACEV  A  L+VI GEI +    ++D+ ++A N++  +GY   D+       T+I  + +QS++I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I++++ D KSQVT++Y  ++NP KI  II+S QH  N +++ I      II+ ++K     K  ++ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +         + +I   IVN FD +    IEK  ++ PIY   STYGHFG+ E    WE+LD V++I    KK
  S:     9 QILTSEAVSEGHPDKIADQISDAILDEMLKLDKNAKVACEVIIAQNLVVIAGEINSPEKKHIDIKEIAKNIIKDIGYTNIDYGLDYKTITVIDAIGNQSHDIVNAIEKKGSNTLGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSGAIEWLRPDSKSQVTMEYDKNRNPVKIKNIIVSHQHHPNISQKLIR---QTIIEEIIKPTIQDKSMIDENTNYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFEIQLAYAIGIENPISIQITAGINDPKYENKILNFIVNNFDLTPNGIIEKLKLKQPIYLKTSTYGHFGKNEFE--WEKLDFVKKIHAVLKK 392
>gi|81301272|ref|YP_401480.1| S-adenosylmethionine synthetase [Synechococcus elongatus PCC 7942] >gi|109892677|sp|Q31KC6|METK_SYNP7 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|81170153|gb|ABB58493.1| methionine adenosyltransferase [Synechococcus elongatus PCC 7942] (417 aa)
Score = 838, Expect = 8.6e-88, Identities = 177/370 (47%), Positives = 252/370 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--DESDF-----TIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESIES------FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM-RSP------IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R + TSESV +GHPDKICDQISD +LD  L +DP+S+VA EV     L++I GE++T    +++ +A   +  +GY  ++S F     T++  ++ QS +I   V            E+ + IGAGDQG+++GYA +E    MPLPI+++H L +    V  N ++D+++ D K+QVTI Y D +   ID I++S QH          NA +E I+S            D V++    +S  + ++N +GKF IGGP GD GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKNIVAA LA+KCEVQLS+AIG ++P++  V+TFGT K +DE + +++   F+      IE FN+ R P       Y   + YGHFGR +L+  WEQ DK + +
  S:     1 MTRRYLFTSESVTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAEIGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQP---DSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELRPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTL 407
>gi|171779621|ref|ZP_02920577.1| hypothetical protein STRINF_01458 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281723|gb|EDT47157.1| hypothetical protein STRINF_01458 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (404 aa)
Score = 838, Expect = 9.5e-88, Identities = 174/375 (46%), Positives = 252/375 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS-------NVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVK-----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L+QDP++ VA E       + + GEI+T  YVD+ ++  + +  +GY  +D+   +       ++  QS +I   V +             + IGAGDQG+++G+A DE    MPLPI+++H LVK    +  + +I +++ D KSQVT++Y ++  P ++D +++S QH   AT E I    N +I+ V+K     KY L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA  A K EVQL++AIG + P++  VDTFGT+  ++ ++   +   FD      I+  +++ PIY   + YGH GRT+++  WE+LDKV+ + E  K
  S:     9 MSERKLFTSESVSEGHPDKIADQISDAILDAVLEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRIVRDTIAEIGYTNADYGFAAESVGVHPSLVEQSPDIAQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDKPVRVDTVVISTQHDPEATNEQIH---NDVIEKVIKAVIPAKY-LDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGFASKAEVQLAYAIGVAHPVSVRVDTFGTNTVAESKLEAAVREVFDLRPAGIIKMLDLKRPIYRQTAAYGHMGRTDIDLPWEKLDKVDALKEAVK 404
>gi|149003381|ref|ZP_01828270.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP14-BS69] >gi|147758564|gb|EDK65562.1| S-adenosylmethionine synthetase [Streptococcus pneumoniae SP14-BS69] (396 aa)
Score = 838, Expect = 9.7e-88, Identities = 170/375 (45%), Positives = 250/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF------------------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY  +++                   I   VN ++ E+    ++D  + IGAGDQG+++G+A DE E  MPLPI ++H LV+   ++  + +I +++ D KSQVT++Y ++  P ++D +++S QH    T E I +   + +I  V+    L+   K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG ++P++  +DTFGT   ++ Q+ +     FD      I+  +++ PIY   S YGH GRT+++  WE+LDKV+ + E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVN-EALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEVTNEQIHQDVIDKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK 396
>gi|188590301|ref|YP_001919908.1| methionine adenosyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188500582|gb|ACD53718.1| methionine adenosyltransferase [Clostridium botulinum E3 str. Alaska E43] (391 aa)
Score = 838, Expect = 1.0e-87, Identities = 171/375 (45%), Positives = 266/375 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           ++++ TSESV +GHPDK+CDQISDA+LD  L +D N++VACE      L+++ GEI+T  YVD+ K+    +  +GYD + +       ++++ ++ QS +I   V         +KD    +GAGDQG+++G+AT+E + +MPLPI +AH L +   +V  +  +D+++ D K+QVT++Y +++  +ID I++S QH +  + E+IE      +I+ VV    L+++ +  IN +G+F +GGP GD+GLTGRK++VDTYG   +HGGGAFSGKD TKVDRS AY AR++AKN+VAA +A K E+QL++AIG +KP++  ++TFGT K  +++I EI+   FD    + I   ++R PI+   + YGHFGRT+L+  WE+L+K+EEI    KKY
  S:     1 MKRLFTSESVTEGHPDKMCDQISDAILDAILAKDSNARVACETCTTTGLVMVMGEISTNCYVDIPKVVRETVREIGYDRAKYGFDCDTCSVMTTIDEQSADIAMGVDEALESKKGQKDEVEAVGAGDQGMMFGFATNETDAYMPLPIYMAHKLSRRLTEVRKDGTLDYLRPDGKTQVTVEYENNKPKRIDTIVISTQHGEEVSLETIEKDIKEHVINAVVPAELLDAETRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDSTKVDRSAAYAARWVAKNLVAAGIADKLEIQLAYAIGVAKPVSIEIETFGTGKMPEDKIVEIVEKVFDLRPGAIIRDLDLRKPIFKQTAAYGHFGRTDLDLPWERLNKIEEI----KKY 390
>gi|119503494|ref|ZP_01625577.1| S-adenosylmethionine synthetase [marine gamma proteobacterium HTCC2080] >gi|119460556|gb|EAW41648.1| S-adenosylmethionine synthetase [marine gamma proteobacterium HTCC2080] (385 aa)
Score = 838, Expect = 1.0e-87, Identities = 164/370 (44%), Positives = 250/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    + TSESV +GHPDK+ DQISDA+LD  L  D  ++VA E      ++VI GE+TT  YVD+ ++   V+  +GY+ SD         +++ +  QS++I   V+  +D + GAGDQG+++GYA++E +  MP PI  AH LV+   ++     + +++ D KSQVT+ Y +S  P ++D +++S QH    ++  I +     +I  V+ +  L++D +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA++CE+Q+S+AIG ++P + +V+TFGTS   D +I  ++   FD   K  IE  +++ PIY   ++YGHFGR +++  WE+ DK + +
  S:     1 MSEYSLFTSESVSEGHPDKMADQISDAILDAILTDDQQARVAVETLVKTGMVVIAGEVTTNTYVDLEEVVRGVVNDIGYNSSDVGFDGSSCAVLNAIGKQSHDIAMGVDEGQDKEQGAGDQGLMFGYASNETDVLMPAPIYYAHRLVEKQAELRKAGALPWLRPDAKSQVTLAYDESGKPARVDAVVLSTQHDPGISQADIHAEILEHVIRPVLPEAWLHADTRYHINPTGQFIIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAERCEIQVSYAIGVAEPTSISVNTFGTSAIGDAEIARLVREHFDLRPKGIIEMLDLKRPIYRMTASYGHFGRNDVDFPWERTDKADAL 381
>gi|125624931|ref|YP_001033414.1| S-adenosylmethionine synthetase [Lactococcus lactis subsp. cremoris MG1363] >gi|158512803|sp|A2RN40|METK_LACLM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|124493739|emb|CAL98727.1| MetK protein [Lactococcus lactis subsp. cremoris MG1363] (399 aa)
Score = 838, Expect = 1.0e-87, Identities = 172/370 (46%), Positives = 247/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES----DFTII----------SNVNSQSNEIFNAVEKDNQ-------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  + + TSESV +GHPDK+ DQISDA+LD  L QDP++ VACE       + + GEI+T+ YVD+  +    +  +GY +S    D+  +          S++    NE     +K+ Q       IGAGDQG+++G+AT+E   +MPL I+++H LVK    +  + +I +++ D KSQVT++Y ++   K +D +++S QH+  AT E I +   N +I  ++    L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA K ++QLS+AIG + P +  V+TFGT K SD+++   I   FD      I+  ++  PIY   + YGHFGRT++   WEQ DKVEE+
  S:     1 MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDNNGKAKRVDTVVISTQHAATATNEEIHDDVINKVIKAIIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLADKAQIQLSYAIGVATPTSINVETFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTAAYGHFGRTDIELPWEQTDKVEEL 393
>gi|195977814|ref|YP_002123058.1| S-adenosylmethionine synthetase MetK [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974519|gb|ACG62045.1| S-adenosylmethionine synthetase MetK [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (401 aa)
Score = 837, Expect = 1.2e-87, Identities = 166/372 (44%), Positives = 243/372 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  YVD+ ++  + +  +GY E+++   +              ++    NE   A E      N IGAGDQG+++G+A DE    MPLPI+++H LV+    +  + +I +++ D KSQVT++Y +   P ++D +++S QH    + + I +     +I  V+  + L+   + +IN +G+F IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS  S+  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE LDKV  + E
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAREGQSDDFNVIGAGDQGLMFGFAIDETPELMPLPISLSHQLVRRLATLRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEVSNDQIRQDMIEQVIKAVIPAHYLDEKTRFLINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLASKAEVQLAYAIGVAQPVSVRVDTFGTSTVSESILEAAVRQVFDLRPAGIIKMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLDKVSPLTE 392
>gi|153093363|gb|EDN74359.1| methionine adenosyltransferase [Mannheimia haemolytica PHL213] (383 aa)
Score = 837, Expect = 1.3e-87, Identities = 175/365 (47%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++ + +  GAGDQG+++GYAT+E E  MP PI  AH L++   +V  + K+D+++ D KSQ+T  Y +++   ID +++S QH+++ + KE IE     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K S+E + ++I   FD      I+  ++  PIY   + YGHFGR      WE+ DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGVDRADPLEQGAGDQGIMFGYATNETEVLMPAPITYAHRLMEQQSKVRKSGKLDWLRPDAKSQLTFAYENNKIIGIDAVVLSTQHAEHISQKELIEGVMEEIIKPVLPSEWLSQNTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVSNEILVKLIYQNFDLRPYGLIKMLDLIKPIYRETAAYGHFGRKHFP--WEKTDKAEAL 377
>gi|52424724|ref|YP_087861.1| S-adenosylmethionine synthetase [Mannheimia succiniciproducens MBEL55E] >gi|60389940|sp|Q65UT4|METK_MANSM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|52306776|gb|AAU37276.1| MetK protein [Mannheimia succiniciproducens MBEL55E] (383 aa)
Score = 837, Expect = 1.4e-87, Identities = 173/365 (47%), Positives = 249/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +A  V+  +GY  S+         +++ +  QS++I   V++D+ +  GAGDQG+++GYAT+E E  MP  I  AH L++    V  N  + +++ D KSQVT+ Y +++   +D +++S QHS + T+E + E+    II  V+    L+ D K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  V+TFGT K +DE +  ++   FD      I+  ++  PIY   + YGHFGR +    WE+ D+  E+
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIEYIARQVICDIGYTSSEMGFDGHSCAVLNGIGKQSSDINQGVDRDDPLNQGAGDQGIMFGYATNETEVLMPAAITYAHRLMERQAWVRKNGTLPWLRPDAKSQVTLKYENNKIVGVDAVVLSTQHSDSVTQEDLHEAVMEEIIKPVLPAKWLSKDTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVAEPTSIMVETFGTGKVADELLVALVREHFDLRPYGLIKMLDLIKPIYRETAAYGHFGREQFP--WEKTDRAAEL 377
>gi|196194119|gb|EDX89078.1| S-adenosylmethionine synthetase [Alcanivorax sp. DG881] (382 aa)
Score = 837, Expect = 1.4e-87, Identities = 163/370 (44%), Positives = 246/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M    I TSESV +GHPDK+ DQISDA+LD  +K DP+++VA E      + V+ GE+ T  YV++  +   V++ +GYD S+         +++ +  QS +I   V++  + ++GAGDQG+++G+ATDE +  MP P+  +H LV+   ++  N  + +++ D KSQVT+ Y + +   +D +++S QHS +     + E+    II  V+ +  L+ D    +N +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +V+TFGT K SD  I +++   FD   +  IE  ++R PIY P ++YGHFGR   +  WE+ DK  ++
  S:     1 MSEYSIFTSESVSEGHPDKMADQISDAILDAIIKDDPHARVAVETLVKTGMAVVAGEVRTNTYVELEDIVRQVILDIGYDSSEKGFDGASCAVLNGIGKQSADIAIGVDEAEEKEMGAGDQGLMFGFATDETDTLMPAPVYYSHRLVERQAELRKNGTLPWLRPDAKSQVTLRYDNGKPVAVDAVVLSTQHSPDIKLADLREAVMEEIIKPVLPEEWLHKDTLYHVNPTGIFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLASKCEIQVSYAIGVAEPTSISVNTFGTGKISDNAIVDLVREHFDLRPRGIIEMLDLRKPIYRPTASYGHFGREGFS--WEKTDKAADL 378
>gi|15675292|ref|NP_269466.1| S-adenosylmethionine synthetase [Streptococcus pyogenes M1 GAS] >gi|71910921|ref|YP_282471.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS5005] >gi|22095903|sp|Q99Z77|METK_STRP1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|13622468|gb|AAK34187.1| S-adenosylmethionine synthetase [Streptococcus pyogenes M1 GAS] >gi|71853703|gb|AAZ51726.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS5005] (398 aa)
Score = 836, Expect = 1.6e-87, Identities = 165/375 (44%), Positives = 248/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE F + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA L  K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEAFESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLVTKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVK 395
>gi|118052030|ref|ZP_01520577.1| S-adenosylmethionine synthetase [Comamonas testosteroni KF-1] >gi|118000158|gb|EAV14315.1| S-adenosylmethionine synthetase [Comamonas testosteroni KF-1] (395 aa)
Score = 836, Expect = 1.6e-87, Identities = 167/361 (46%), Positives = 243/361 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE---SFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD    QDP+S+VA E      L+V+ GEITT   VD +++A + +  +GYD +++       +++   + QS +I   V+K  D+++  GAGDQG+++GYA DE    MP PI  AH L++   Q+  + ++ F++ D KSQVT+ Y D +   ID +++S QHS + ++ + +   SF  AII+ ++K         D K +IN +G+F +GGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA++C+VQ+++AIG ++P+   V T GT    D +I +++   FD   K  I+  ++  PIYS  + YGHFGR E    WE+ DK
  S:     7 LFTSESVSEGHPDKVADQISDAILDAIFTQDPHSRVAAETLTNTGLVVLAGEITTGANVDYIQVARDTIKRIGYDNTEYGIDYKGCSVLVAYDKQSQDIAQGVDKASDDELNTGAGDQGLMFGYACDETPELMPAPIYYAHRLMERQAQLRKDGRLPFLRPDAKSQVTLRYVDGKPHSIDTVVLSTQHSPDQSETATKMKASFTEAIIEEIIKPVLPSEWLQDTKYLINPTGRFVVGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLARQCQVQVAYAIGVARPMNITVYTEGTGVIPDAEIAKLVAAHFDLRPKGIIQMLDLLRPIYSKTAAYGHFGREEPEFTWERTDK 384
>gi|161621816|ref|YP_172351.2| S-adenosylmethionine synthetase [Synechococcus elongatus PCC 6301] (417 aa)
Score = 835, Expect = 2.0e-87, Identities = 177/370 (47%), Positives = 251/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--DESDF-----TIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESIES------FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM-RSP------IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  R + TSESV +GHPDKICDQISD +LD  L +DP+S+VA EV     L++I GE++T    +++ +A   +   GY  ++S F     T++  ++ QS +I   V            E+ + IGAGDQG+++GYA +E    MPLPI+++H L +    V  N ++D+++ D K+QVTI Y D +   ID I++S QH          NA +E I+S            D V++    +S  + ++N +GKF IGGP GD GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKNIVAA LA+KCEVQLS+AIG ++P++  V+TFGT K +DE + +++   F+      IE FN+ R P       Y   + YGHFGR +L+  WEQ DK + +
  S:     1 MTRRYLFTSESVTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAETGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQP---DSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELHPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTL 407
>gi|19746332|ref|NP_607468.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS8232] >gi|56808178|ref|ZP_00365958.1| COG0192: S-adenosylmethionine synthetase [Streptococcus pyogenes M49 591] >gi|94988782|ref|YP_596883.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS9429] >gi|94992667|ref|YP_600766.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS2096] >gi|139473599|ref|YP_001128315.1| S-adenosylmethionine synthetase [Streptococcus pyogenes str. Manfredo] >gi|158512780|sp|A2RE06|METK_STRPG S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158564175|sp|Q1JB36|METK_STRPB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158564196|sp|Q1JL80|METK_STRPC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|24211976|sp|Q8P0G6|METK_STRP8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|19748525|gb|AAL97967.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS8232] >gi|94542290|gb|ABF32339.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS9429] >gi|94546175|gb|ABF36222.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS2096] >gi|134271846|emb|CAM30081.1| S-adenosylmethionine synthetase [Streptococcus pyogenes str. Manfredo] (398 aa)
Score = 835, Expect = 2.1e-87, Identities = 165/375 (44%), Positives = 248/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVK 395
>gi|94990687|ref|YP_598787.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10270] >gi|158564186|sp|Q1JGA1|METK_STRPD S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|94544195|gb|ABF34243.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10270] (398 aa)
Score = 835, Expect = 2.1e-87, Identities = 166/375 (44%), Positives = 250/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I   C  +I+ V+K       L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+K++ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQI---CQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKIDALVEAVK 395
>gi|21910570|ref|NP_664838.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS315] >gi|28895738|ref|NP_802088.1| S-adenosylmethionine synthetase [Streptococcus pyogenes SSI-1] >gi|25090682|sp|Q8K715|METK_STRP3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21904771|gb|AAM79641.1| putative S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS315] >gi|28810987|dbj|BAC63921.1| putative S-adenosylmethionine synthetase [Streptococcus pyogenes SSI-1] (398 aa)
Score = 835, Expect = 2.4e-87, Identities = 165/375 (44%), Positives = 247/375 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLNKVDALVEAVK 395
>gi|19552815|ref|NP_600817.1| S-adenosylmethionine synthetase [Corynebacterium glutamicum ATCC 13032] >gi|62390485|ref|YP_225887.1| S-adenosylmethionine synthetase [Corynebacterium glutamicum ATCC 13032] >gi|24212014|sp|Q9K5E4|METK_CORGL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|8346733|emb|CAB93961.1| methionine adenosyltransferase [Corynebacterium glutamicum] >gi|21324372|dbj|BAB98996.1| S-adenosylmethionine synthetase [Corynebacterium glutamicum ATCC 13032] >gi|41325822|emb|CAF21611.1| S-Adenosylmethionine Synthetase [Corynebacterium glutamicum ATCC 13032] (407 aa)
Score = 834, Expect = 2.5e-87, Identities = 166/366 (45%), Positives = 248/366 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNL----NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSK--YSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++ TSESV +GHPDKICD ISD +LD  L++DP S+VA E      ++ + GE+ T+ YV++ ++  N LI +G++ S+         +  ++  QS EI + V            E+D++ GAGDQG+++GYAT+E E +MPLPI +AH L +   QV     +  ++ D K+QVT  Y     P  +D +++S QH     +  +E+     +ID+V+K   +      +   +IN SG F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA + EVQ+++AIG +KP+   V+TF T+K   SDEQI   ++  FD    + I + ++  PIY+  + YGHFGRT+L+  WE +D+V+E+
  S:     8 RLFTSESVTEGHPDKICDAISDTILDALLEKDPQSRVAVETVVTTGIVHVVGEVRTSAYVEIPQLVRNKLIEIGFNSSEVGFDGRTCGVSVSIGEQSQEIADGVDNSDEARTNGDVEEDDRAGAGDQGLMFGYATNETEEYMPLPIALAHRLSRRLTQVRKEGIVPHLRPDGKTQVTFAYDAQDRPSHLDTVVISTQHDPEVDRAWLETQLREHVIDWVIKDAGIEDLATGEITVLINPSGSFILGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFDTNKEGLSDEQIQAAVLEVFDLRPAAIIRELDLLRPIYADTAAYGHFGRTDLDLPWEAIDRVDEL 400
>gi|71903765|ref|YP_280568.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS6180] >gi|109892672|sp|Q48SU7|METK_STRPM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71802860|gb|AAX72213.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS6180] (398 aa)
Score = 834, Expect = 2.5e-87, Identities = 165/375 (44%), Positives = 248/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTKAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVK 395
>gi|152993631|ref|YP_001359352.1| S-adenosylmethionine synthetase [Sulfurovum sp. NBC37-1] >gi|166201414|sp|A6QBY6|METK_SULNB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|151425492|dbj|BAF72995.1| S-adenosylmethionine synthetase [Sulfurovum sp. NBC37-1] (386 aa)
Score = 834, Expect = 2.6e-87, Identities = 164/368 (44%), Positives = 245/368 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAV-EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           I TSESV +GHPDK+ DQISDA+LD  +++DP ++VACE   +N   VI GE+ TA Y  + ++A  V+  +GY ++ +        +++ +  QS +I   V +K  +IGAGDQG+++GYA  E +  MPLPI++AH + +    V  N  + F++ D K+QV++ Y D +   +D I++S QH +  + E ++ +    +ID V+  Y+++ SD    IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARY+AKN+VAA    K  +Q+++AIG +KP++  VDT GT+   +E+I   + + FD + K  I+  ++  PIY   + YGHFGR ++   WE++DKV+EI  F
  S:     6 IFTSESVTEGHPDKMADQISDAILDYIIERDPQARVACETLLSNGFCVIAGELKTAAYAPMQEIAREVVREIGYTDAAYGFDYRSAGVLNGIGEQSPDINVGVDQKGGEIGAGDQGLMFGYACKETKELMPLPISLAHHITRKLAAVRKNGTVPFLRPDGKAQVSVKYVDGKPVAVDTIVVSTQHHETVSLEQVQKAVKEEVIDPVLATYDIDISDITYHINPTGRFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPTKVDRSAAYAARYVAKNLVAAGACDKATLQVAYAIGVAKPVSIYVDTHGTAHIDEEKIVSCVESLFDLTPKGIIDSLDLLKPIYKKTAAYGHFGREDMGFSWEKIDKVDEIKAF 383
>gi|167856359|ref|ZP_02479087.1| S-adenosylmethionine synthetase [Haemophilus parasuis 29755] >gi|167852526|gb|EDS23812.1| S-adenosylmethionine synthetase [Haemophilus parasuis 29755] (382 aa)
Score = 834, Expect = 3.0e-87, Identities = 171/365 (46%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++ N +  GAGDQG+++GYAT+E E  MP P+  AH L++   +V  + K+D+++ D KSQ+T  Y D++   ID +++S QH+++  ++++ E     II  ++    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  V+TFGT K S+E +  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGVDRANPLEQGAGDQGIMFGYATNETEVLMPAPVTYAHRLMEQQAKVRKSGKLDWLRPDAKSQLTFIYEDNKIKGIDTVVLSTQHAEHVDQKTVFEGVMEEIIKPILPSEWLSQNTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGIAEPTSIMVETFGTGKVSNEVLVRLVREHFDLRPYGLIKMLDLIRPIYRETAAYGHFGREHFP--WEKTDKAEAL 377
>gi|50914428|ref|YP_060400.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10394] >gi|60389912|sp|Q5XBJ6|METK_STRP6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|50903502|gb|AAT87217.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10394] (398 aa)
Score = 834, Expect = 3.1e-87, Identities = 165/375 (44%), Positives = 247/375 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT   I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNNQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVK 395
>gi|94994603|ref|YP_602701.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10750] >gi|158564167|sp|Q1J626|METK_STRPF S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|94548111|gb|ABF38157.1| S-adenosylmethionine synthetase [Streptococcus pyogenes MGAS10750] (398 aa)
Score = 833, Expect = 3.3e-87, Identities = 165/375 (44%), Positives = 248/375 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP + VA E       + + GEI+T  Y+D+ ++  + +  +GY E+++   +              ++    NE   + E D    + IGAGDQG+++G+A +E    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH   AT + I +     +I  V+    L+ D K  IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKN+VAA LA K EVQL++AIG ++P++  VDTFGTS   +  +   +   FD      I+  +++ PIY   + YGH GRT+++  WE+L+KV+ ++E  K
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKDVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVK 395
>gi|177671693|ref|ZP_02944701.1| Methionine adenosyltransferase [Micrococcus luteus NCTC 2665] >gi|172071371|gb|EDT57414.1| Methionine adenosyltransferase [Micrococcus luteus NCTC 2665] (420 aa)
Score = 833, Expect = 3.6e-87, Identities = 167/369 (45%), Positives = 249/369 (67%)
  Q:     2 ELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVK--CAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSDFKRII-NNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ELR + TSESV  GHPDKICDQISDA+LD  L  DP++KVA E      L+ + GE+ T+ YV++ K+    ++ +GYD S          +  ++  QS++IF  V +             ++ GAGDQG+++GYATDE   +MP+PI +AH L +   A +   NT + ++  D K+QVTI YA    P  ++ +++S QH +  T+E + +     +I  V+++  L++   RII N  GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA + E Q+++AIG+++P+   VDTFGT+   +E+I E +   FD    + +++ N+  PIY   +  GHFGR + +  WE+ D+VE++
  S:    23 ELR-LFTSESVTAGHPDKICDQISDAILDAILAADPSAKVAVETLTTTGLVQVAGEVNTSAYVEIPKIVRETILDIGYDSSANGFDGAQCGVNISIGQQSSDIFAGVSRSLEAREYGSADEVDEQGAGDQGIMFGYATDETPAYMPMPIYLAHRLSERLTAVRRAENTPMPYLLPDGKTQVTIGYAPGHVPTTVEAVVVSTQHHEWVTQEQLRADVEEHVIRPVIERSGLDTSGMRIIINPGGKFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYMLRWVAKNVVAAGLASRAEFQVAYAIGSARPVGLYVDTFGTATVPEEKIIEAVNAVFDLRPAAIVKELNLLRPIYRRTAANGHFGRDDADFTWERTDRVEQL 414
>gi|160942359|ref|ZP_02089667.1| hypothetical protein CLOBOL_07244 [Clostridium bolteae ATCC BAA-613] >gi|158434723|gb|EDP12490.1| hypothetical protein CLOBOL_07244 [Clostridium bolteae ATCC BAA-613] (394 aa)
Score = 833, Expect = 3.6e-87, Identities = 166/360 (46%), Positives = 241/360 (66%)
  Q:     7 MTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIESFCN-AIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           +TSESV +GHPDK+CDQISD +LD  L +DP S+VA E  A+   +++ GE+T++G+VDVV  A  ++  +GY       D     I +N+++QS +I   V +        +G GDQG++YGYA +E E+ MPL  ++A+ L +    V    K DF+  D K+QVT+ Y ++  P  I  I++S QHS+N + + +E+F    +I+ V+    +    +  +N +G+F IGGP GDTG+TGRK+MVDTYG++ KHGGGAFSGKD TKVDRS AY ARY+AKNIVAA+LA +CEV L++ IG   P A  V+TFGT +  D  I E++ + F F +  +I + N+R+P +   + YGHFGR +    WE+ DK
  S:    12 VTSESVTEGHPDKVCDQISDGILDAYLGKDPKSRVAIEAMASANTLMLAGEVTSSGHVDVVAKAREIIRNIGYTEHGKGFDADTCMIFTNIHNQSPDISMGVTRSAGTGKEVLGGGDQGIMYGYAVNETESLMPLSCHLANRLAERLAYVRKVQKADFLYPDGKTQVTMKYNEAGKPVCIHSIVVSTQHSENISHKLLEAFIRCTVIEPVIDPQWITPKTRIHVNPTGRFVIGGPAGDTGVTGRKIMVDTYGTVGKHGGGAFSGKDPTKVDRSAAYMARYVAKNIVAAELADRCEVALAYVIGGIGPEAITVNTFGTGRIPDSSIEELVKSVFSFGVADYISELNLRTPQFLKTAAYGHFGRDDQGFRWEETDK 385
>gi|114331868|ref|YP_748090.1| S-adenosylmethionine synthetase [Nitrosomonas eutropha C91] >gi|122313401|sp|Q0AEV7|METK_NITEC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|114308882|gb|ABI60125.1| methionine adenosyltransferase [Nitrosomonas eutropha C91] (387 aa)
Score = 833, Expect = 3.7e-87, Identities = 171/366 (46%), Positives = 249/366 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV----EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEIL 371
           + TSESV +GHPDK+ DQISDA+LD  L+QDP+++VACE   +  LIV+ GEITT   +D   +  + +  +GY       D S   +++  N QS +I   V    E++   GAGDQG+++GYA DE    MPLPI  AH LV+   ++  + ++ +++ D KSQV++ Y D +   I+ +++S QH  + +   + E     II  V+    L+SD + ++N +G+F +GGP+GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA+KCEVQ+++AIG +KP++  ++TFGT K SDE++ E+I   FD   ++ I + N+  PIYS  + YGHFGR E +  WE+ D  E+++
  S:     5 LFTSESVSEGHPDKVADQISDAILDAILQQDPHARVACETMCSTGLIVLSGEITTHATIDYNVIPRDTVREIGYTSSEIGFDASTCAVLTAFNKQSPDIALGVNRSKEEEMDQGAGDQGLMFGYACDETPQLMPLPIYYAHRLVEQQAKLRKSGQLSWLRPDAKSQVSVRYIDGKPKNIETVVISTQHDPDISNGDLFEGVVEEIIKPVLPAEMLSSDIRYLVNPTGRFVVGGPMGDCGLTGRKIIVDTYGGTAHHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLARKCEVQVAYAIGVAKPVSLMLETFGTGKVSDEKLAELITRNFDLRPRAIIHELNLLRPIYSKTAAYGHFGREEPSFTWEKTDIAEQLI 382
>gi|46143465|ref|ZP_00135202.2| COG0192: S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208552|ref|YP_001053777.1| S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae L20] >gi|158513507|sp|A3N186|METK_ACTP2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|126097344|gb|ABN74172.1| S-adenosylmethionine synthetase [Actinobacillus pleuropneumoniae L20] (383 aa)
Score = 833, Expect = 3.7e-87, Identities = 172/365 (47%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP PI  AH L++   +V  + K+D+++ D KSQ+T  Y +++   ID +++S QH+++ + K+ +E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT + S+E + ++I   FD      I+  ++  PIY   + YGHFGR      WEQ DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGVDRADPLEQGAGDQGIMFGYATNETDVLMPAPITYAHRLMEQQAKVRKSGKLDWLRPDAKSQLTFAYENNKIVGIDAVVLSTQHAEHVSQKDLVEGVMEEIIKPVLPSEWLSQNTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGRVSNETLVKLIYQNFDLRPYGLIKMLDLIQPIYRETAAYGHFGREHFP--WEQTDKAEAL 377
>gi|42527970|ref|NP_973068.1| S-adenosylmethionine synthetase [Treponema denticola ATCC 35405] >gi|60390053|sp|Q73JR4|METK_TREDE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|41819015|gb|AAS12987.1| S-adenosylmethionine synthetase [Treponema denticola ATCC 35405] (389 aa)
Score = 833, Expect = 4.0e-87, Identities = 175/363 (48%), Positives = 247/363 (68%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNL-NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           TSESV +GHPDK+CDQISDAVLD CL+ DP S VACE FA+  L+++GGEITT  YVD+ ++A ++   +GY  +DF        +++ ++SQS +I   V      E   Q GAGDQG+++G+A  E    MP PI  +H +++ A ++     I +++ D K+Q+T+ Y   +  KID +++S QH  +   + + ++  N +I  V+    L   D K  IN +G+F IGGP GDTGLTGRK++VDTYG + +HGGGAFSGKD +KVDRS AY ARYIAKN+VAA LA++CEVQL++AIG   P+A  VDTFGT +  +E+I + I   FD S    I+  +++ PIY   + YGHFGR E +  WE+ DK E +
  S:     9 TSESVSEGHPDKLCDQISDAVLDACLRDDPESHVACETFASTALVLVGGEITTNTYVDIQEIARSIAEEIGYTNTDFGLDCHSMAVMNMIHSQSPDISQGVDGTGLDEYKGQQGAGDQGMMFGFACKETPELMPAPIMFSHSVLRYAAKLRKEKVIPWLRPDSKTQITVKYEGFKPIKIDTVVLSHQHYPDVQYDELKDTLINRVIKPVLGPTGLLADDTKYFINPTGRFVIGGPFGDTGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMARYIAKNVVAADLARRCEVQLAYAIGVPFPVAVRVDTFGTGEVPEEKIEKAIKEVFDMSPAGIIKTLDLKRPIYKETAAYGHFGRPEFS--WEKTDKTEAL 384
>gi|113461759|ref|YP_719828.1| S-adenosylmethionine synthetase [Haemophilus somnus 129PT] >gi|170718526|ref|YP_001783736.1| methionine adenosyltransferase [Haemophilus somnus 2336] >gi|123031457|sp|Q0I559|METK_HAES1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|189081718|sp|B0UWT3|METK_HAES2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|112823802|gb|ABI25891.1| methionine adenosyltransferase [Haemophilus somnus 129PT] >gi|168826655|gb|ACA32026.1| Methionine adenosyltransferase [Haemophilus somnus 2336] (384 aa)
Score = 833, Expect = 4.0e-87, Identities = 171/365 (46%), Positives = 250/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE L+QDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS++I   V++++ +  GAGDQG+++GYAT+E +  MP  I  AH L++   QV     +D+++ D KSQVT+ Y D++   ID +++S QHS N  ++++ E     II  ++    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  V+TFGT K ++E +  +I   FD      I+  ++  PIY   + YGHFGR +    WE++D+ EE+
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILRQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYKHSDIGFDGHSCAVLNAIGKQSSDINQGVDRESPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMERQAQVRKKGILDWLRPDAKSQVTLKYEDNRIVGIDAVVLSTQHSDNVDQKTVHEGVMEEIIKPILPAEWLSKETKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVAEPTSIMVETFGTGKVANELLVGLIREFFDLRPYGLIKMLDLIQPIYRQTAAYGHFGRAQFP--WEKVDRAEEL 377
>gi|83592253|ref|YP_426005.1| S-adenosylmethionine synthetase [Rhodospirillum rubrum ATCC 11170] >gi|109892615|sp|Q2RVX7|METK1_RHORT S-adenosylmethionine synthetase 1 (Methionine adenosyltransferase 1) (AdoMet synthetase 1) (MAT 1) >gi|83575167|gb|ABC21718.1| methionine adenosyltransferase [Rhodospirillum rubrum ATCC 11170] (383 aa)
Score = 832, Expect = 4.5e-87, Identities = 164/364 (45%), Positives = 232/364 (63%)
  Q:     7 MTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +TSESV +GHPDK+CDQISD +LD CL QDP ++VA E   +   + I GEITT   +D V+ A  V+  +GY       D     I++N+ +QS +I   V +  ++GAGDQGV+YGYA DE  + MP PI++AH L            + +++ D K+QVT+ Y     P+ +  +I+S QH +   +E+ +     A+I   V  + L  + + +IN +G+F IGGP GDTG+TGRKLMVDTYG  A+HGGGAFSGKD TKVDR+ AY ARY AKN+VAA LA++CEV L++AIG   P   +V+TFGT     +++   +  TF FS+   I   ++R PI+   + YGHFGR      WE+ D+V+ +
  S:     6 VTSESVTEGHPDKVCDQISDGILDACLAQDPAARVAVETLVSGNTVFIAGEITTTARLDAVRTAREVIEDIGYADPALGFDSGSCFILTNLRTQSPDIDLGVSRGAELGAGDQGVLYGYACDETASLMPAPIHMAHGLSLRLAAARHGGVLPWLRPDGKTQVTVRYDGEGRPEALTSVIVSTQHDEGVDRETLVRGIIEAVIYPEVGGW-LKPETRVLINPTGRFVIGGPAGDTGVTGRKLMVDTYGGCARHGGGAFSGKDSTKVDRTAAYMARYAAKNVVAAGLARRCEVALAYAIGERLPEMVSVETFGTETIDVDRLTAAVRETFPFSVSGMIAALDLRRPIFRKTAAYGHFGRENKGFQWEKTDRVDAL 377
>gi|119896880|ref|YP_932093.1| S-adenosylmethionine synthetase [Azoarcus sp. BH72] >gi|158512904|sp|A1K301|METK_AZOSB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|119669293|emb|CAL93206.1| methionine adenosyltransferase [Azoarcus sp. BH72] (388 aa)
Score = 832, Expect = 4.6e-87, Identities = 171/365 (46%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISD VLD  L +DP ++VACE   +  L+VI GEITT+ + +  ++A +V+  +GYD SD         +++ +N QS++I   V +    D   GAGDQG+++GYAT+E  + MPLPI  AH +++   +V  + ++ +++ D KSQ+T+ Y D +   ID +++S QH+   +   I E+    II  V+ K  +  + + +IN +G+F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY  RY+AKN+VAA LA KCEVQ+++AIG +KP++  V+TFGT K +D++I ++I   FD   K+ I+  ++  PIYS  + YGHFGR E    WEQ DK   +
  S:     6 LFTSESVSEGHPDKVADQISDGVLDAILAEDPKARVACETLVSTGLVVISGEITTSAHPNYREIAQDVVRRIGYDNSDIGFDYKSCAVLAAINRQSSDIAQGVNEGEGLDLDQGAGDQGLMFGYATNETPSLMPLPIYYAHRIMQRQAEVRKDGRLPWLRPDAKSQLTVKYVDGKPVAIDTVVVSTQHNPEVSHAQISEAVIEEIIKPVLPKELMQGEVRYLINPTGRFVIGGPHGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAGRYVAKNVVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKIADDKIVDLIRAHFDLRPKAIIQTLDLLRPIYSRTAAYGHFGRDEPEFTWEQTDKASAL 382
>gi|91786669|ref|YP_547621.1| S-adenosylmethionine synthetase [Polaromonas sp. JS666] >gi|123165372|sp|Q12FG9|METK_POLSJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|91695894|gb|ABE42723.1| methionine adenosyltransferase [Polaromonas sp. JS666] (393 aa)
Score = 832, Expect = 5.3e-87, Identities = 167/360 (46%), Positives = 240/360 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN----QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--QNATKESIE-SFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLD 365
           + TSESV +GHPDK+ DQISDA+LD   KQDP S+VA E      L+V+ GEITT  +VD +++A + +  +GYD +++        ++   + QSN+I   V+  +     IGAGDQG+++GYA DE    MP PI  AH L++   Q+  + ++ F++ D KSQVT+ Y + +   ID +++S QHS  Q+ T   ++ SF  AII+ ++K         + K +IN +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA++C++Q+++AIG ++P+   V T GT   SDE++  ++   FD   K  I+  ++  PIY   + YGHFGR E    WE+ D
  S:     6 LFTSESVSEGHPDKVADQISDAILDAIFKQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNIGAGDQGLMFGYACDETPELMPAPIYYAHRLMERQAQLRKDGRLPFLRPDAKSQVTMRYVNGKPHSIDTVVLSTQHSPDQSETPHKMKASFTEAIIEEIIKPVLPKEWLKETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNVTVYTEGTGVISDEKLSALVHEHFDLRPKGIIQMLDLLRPIYEKTAAYGHFGRDEPEFSWERTD 382
>gi|146319275|ref|YP_001198987.1| S-adenosylmethionine synthetase [Streptococcus suis 05ZYH33] >gi|146321479|ref|YP_001201190.1| S-adenosylmethionine synthetase [Streptococcus suis 98HAH33] >gi|158514136|sp|A4VWU8|METK_STRSY S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158514153|sp|A4W351|METK_STRS2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|145690081|gb|ABP90587.1| S-adenosylmethionine synthetase [Streptococcus suis 05ZYH33] >gi|145692285|gb|ABP92790.1| S-adenosylmethionine synthetase [Streptococcus suis 98HAH33] (396 aa)
Score = 832, Expect = 5.5e-87, Identities = 162/370 (43%), Positives = 246/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKDNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + + GEI+T  YVD+ ++  + +  +GY + ++   +              ++    NE     +  +Q     IGAGDQG+++G+A DE    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH    ++E I +     +I  ++  + L+      IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG + P++  +DTFGTS  ++ ++   + + FD      I+  +++ PIY   + YGH GRT+++  WE+LDKVE +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTKGEYGFSAESVGVHPSLVEQSPDIAQGVNEALETRQDASQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLSHKLVRRLAELRKSGEIAYLRPDAKSQVTVEYDEDNQPVRVDTVVISTQHDPEVSQEQIRQDVIERVIKEIIPAHYLDDQTNYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAHPVSVRIDTFGTSTVAESKLEAAVRHIFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWEKLDKVEAL 391
>gi|148652688|ref|YP_001279781.1| S-adenosylmethionine synthetase [Psychrobacter sp. PRwf-1] >gi|172048515|sp|A5WDU0|METK_PSYWF S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|148571772|gb|ABQ93831.1| methionine adenosyltransferase [Psychrobacter sp. PRwf-1] (388 aa)
Score = 831, Expect = 5.8e-87, Identities = 162/364 (44%), Positives = 244/364 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR--TELNPGWEQLDKVE 368
           ++ TSESV +GHPDK+ DQISDA+LD  +++D +++VACE       +V+ GEI+T   +D+ ++  + +  +GY+ SD         +I+ +  QS EI   V++ N    GAGDQG+++GYA++E E  MP PI  AH L++   ++  + ++ +++ D K+QVT+ Y +     ID +++S QH  + ++  + E+    II  V+    L++  +  IN +GKF IGGP+GD G+TGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA++CEVQ+S+AIG ++P + +V+TFGT+K S E I E+I   FD          N+  P+Y   +TYGHFGR  +E    WE+ DK E
  S:     5 QLFTSESVSEGHPDKMADQISDALLDAIMREDLHARVACETLVKTGAVVLAGEISTTANIDIERIVRDTVNSIGYNHSDLGFDGETCAVINMIGKQSPEIAQGVDRMNPEDQGAGDQGLMFGYASNETEVLMPAPIEFAHRLMERQSELRRSGELKWLRPDAKAQVTLKYTNGTPSAIDAVVLSTQHDPDISQADLQEAVMENIIKHVLPADLLHAGTRYHINPTGKFVIGGPVGDAGITGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAERCEVQISYAIGVAEPTSISVNTFGTAKVSAEVIIELIRTHFDLRPYGITHMLNLLQPMYQQTATYGHFGRPGSETAFTWEKTDKAE 380
>gi|172040655|ref|YP_001800369.1| hypothetical protein cu0975 [Corynebacterium urealyticum DSM 7109] >gi|171851959|emb|CAQ04935.1| unnamed protein product [Corynebacterium urealyticum DSM 7109] (401 aa)
Score = 831, Expect = 6.2e-87, Identities = 162/367 (44%), Positives = 245/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE------------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNL----NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +++ TSESV +GHPDKICD ISD +LD  L +DP ++VA E      L+ + GE+ T+GYV++ ++  + L  +G+  SD         +  ++ +QS EI   V+            +D++ GAGDQG+++GYAT+E   +MPLPI++AH L +   +V     +  ++ D K+QVT +Y D+  P ++D +++S QH    T++ + E     ++  V+   +L      D   ++N SG F +GGP GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA + EVQ+++AIG ++P+   V+TFGT K   E I   +   FD    S + + ++  PIY+  + YGHFGR +L+  WE+LDKVEE+
  S:     3 KRLFTSESVTEGHPDKICDAISDTILDAMLTEDPQARVAVETVVTTGLVHVVGEVRTSGYVEIPQLVRDTLKEIGFTSSDMGFDGTTCGVSVSIGAQSPEIGAGVDTSHEVRGSSSTDEDDRQGAGDQGLMFGYATNETPEYMPLPISVAHRLSRRLTEVRKEEIVTGLRPDGKTQVTFEYDDAGTPVRLDTVVISTQHDPERTQDELRELLSEHVVGHVLADESLKPFVTEDLNLLVNPSGSFILGGPAGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLADRAEVQVAYAIGVARPVGLYVETFGTEKAPVEDIQRAVAEVFDLRPASILRELDLLRPIYAQTAAYGHFGRNDLDLPWERLDKVEEL 394
>gi|156740184|ref|YP_001430313.1| methionine adenosyltransferase [Roseiflexus castenholzii DSM 13941] >gi|189081727|sp|A7NFR6|METK_ROSCS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|156231512|gb|ABU56295.1| Methionine adenosyltransferase [Roseiflexus castenholzii DSM 13941] (405 aa)
Score = 831, Expect = 7.0e-87, Identities = 162/367 (44%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEIT-TAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEK------DNQ--------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R   TSESV +GHPDKICDQ+SDAVLD  L  DP ++VACE      LIV+ GE+T   GY+ + ++    +  +GY ++ +        ++  ++ QS +I   V +      D Q        IGAGDQG+++G+A +E    MPLPI +AH + +   ++  +  + +++ D KSQVTI+Y+  +  ++D +++S QH+ + T+E I     + +I  V+    L+   K  +N +G+F IGGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY  R++AKN+VAA LA + E+Q+S+AIG ++P++ +V+ FGT+K  +E I  +I   FD    + I    +R PIY P + YGHFGR +++  WEQ D+ E +
  S:    10 RLFFTSESVTEGHPDKICDQVSDAVLDAFLSHDPRARVACETATTTGLIVVIGEVTYEQGYIPIEEIVRKTIKDIGYTDAAYGFDADTCGVMVAIHGQSPDIAQGVNRALEVRSDGQVTEEEVATIGAGDQGMMFGFACNETPELMPLPIALAHRIGRRLSRLRKDGVLPYLRPDGKSQVTIEYSYGRPVRVDTVLVSNQHAPDVTQEQIRHDIIHHVIHEVIPNDLLDEKTKYFVNPTGRFVIGGPMGDSGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYACRWVAKNVVAAGLADRFEIQVSYAIGVARPLSISVECFGTNKVPEETIVRLIDEHFDLRPGAIIRDLRLRRPIYRPTAAYGHFGRDDIDAPWEQTDRAEAL 399
>gi|67157480|ref|ZP_00418729.1| S-adenosylmethionine synthetase [Azotobacter vinelandii AvOP] >gi|67085388|gb|EAM04862.1| S-adenosylmethionine synthetase [Azotobacter vinelandii AvOP] (396 aa)
Score = 830, Expect = 7.4e-87, Identities = 166/370 (44%), Positives = 246/370 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRT--ELNPG--------WEQLDKVEEI 370
           M    + TSESV +GHPDKI DQISDAVLD  + +D +++VACE      + ++ GEITT+ ++D+ ++   V++ +GYD SD         II+ +  QS +I   V+  K    GAGDQG+++GYA+DE E  MP PI  +H LV+   +   +  + +++ D KSQVT  Y + +   ID +++S QH+   T+  + E+    II   +    L+ D +  IN +GKF IGGP+GD GLTGRK++VD+YG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA++CE+Q+S+AIG ++P + +++TFGT K  D++I +++   FD    +     ++  P+Y P + YGHFGRT  E+  G        WE+ DK E +
  S:     1 MSEYSLFTSESVSEGHPDKIADQISDAVLDAIIAEDKHARVACETLVKTGVAIVAGEITTSAWIDLEELVRKVIVDIGYDSSDVGYDGHTCGIINIIGKQSVDINQGVDRAKPEDQGAGDQGLMFGYASDETEVLMPAPICFSHRLVERQTEARKSGLLPWLRPDAKSQVTCRYENGKVVGIDAVVLSTQHNPEITQADLHEAVMELIIKHTLPAELLHKDTQFHINPTGKFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKIGDDRIVQLVREHFDLRPYAITHMLDLLHPMYRPTAAYGHFGRTPVEMTVGNDSFTAFTWERTDKAEAL 390
>gi|119963556|ref|YP_947999.1| S-adenosylmethionine synthetase [Arthrobacter aurescens TC1] >gi|119950415|gb|ABM09326.1| S-adenosylmethionine synthetase [Arthrobacter aurescens TC1] (409 aa)
Score = 830, Expect = 7.5e-87, Identities = 163/369 (44%), Positives = 253/369 (68%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEI----FNAVEK---------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           ++ TSESV +GHPDKICDQISDA+LD  L  DP S+VA E  A   L+ + GE+TT  YV++ ++    ++ +GYD S          +  ++  QSN+I    FN++E          D Q GAGDQG+++GYA+DE  ++MP PI +AH L +   +V  N ++ +++ D K+QVT+ Y   +   ++ +++S QH++ A+ + + +   + +ID V+   NL+ +    I+N +G F IGGP+GD GLTGRK++VDTYG  ++HGGGAFSGKD +KVDRS AY  R++AKN+VAA LAK+ E+Q+++AIG ++P+   V+TFGT      +I E I   FD   ++ I+  +++ PIY+  + +GHFGR E +  WE+LD+V ++ E+
  S:    17 RLFTSESVTEGHPDKICDQISDAILDALLAADPESRVAVETMATTGLVHVAGEVTTDAYVEIPQIVRETILGIGYDSSANGFDGARCGVSVSIGQQSNDIAGGVFNSLEAREGRQEDDYDLQ-GAGDQGIMFGYASDETASYMPTPIWLAHRLSERLTEVRKNGELAYLRPDGKTQVTVGYDGDRPVSVETVVISSQHAEEASLDQLRADLASYVIDPVLSASNLDIARTANILNPAGAFVIGGPVGDAGLTGRKIIVDTYGGFSRHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAKRAEIQIAYAIGQARPVGTYVETFGTETVDPARISEAIDELFDLRPRAIIDALDLKRPIYTKTAAHGHFGRDEPDFTWERLDRVADLKEY 406
>gi|152966933|ref|YP_001362717.1| methionine adenosyltransferase [Kineococcus radiotolerans SRS30216] >gi|151361450|gb|ABS04453.1| Methionine adenosyltransferase [Kineococcus radiotolerans SRS30216] (399 aa)
Score = 829, Expect = 9.5e-87, Identities = 164/366 (44%), Positives = 240/366 (65%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVEK--------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNA--TKESIESFCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++ TSESV +GHPDKICDQISD +LD  L QDP S+VA E      L+ + GE+TT  Y D+  +    L+ +GYD S          +  ++ SQS +I   V++              D Q GAGDQG+++GYA DE    MPLPI++AH L +   +V    +I +++ D K+QVTI Y   +  ++D +++S QH  +    K         +I+ V++  +L+ SD + ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT K +  +I   I + FD    + +    +  PIY+P + YGHFGR      WE+ D+VE +
  S:     6 RLFTSESVTEGHPDKICDQISDGILDALLAQDPKSRVAVETMVTTGLVHVAGEVTTDAYADIPTIVRRTLLDIGYDSSAKGFDGRTCGVEVSIGSQSPDIAQGVDEAWENRQDGGGADPLDLQ-GAGDQGLMFGYACDETPELMPLPIHLAHQLSQRLSEVRKKGEIPYLRPDGKTQVTIGYDGDRAVRLDTVVLSTQHEPDVDLVKTLTPDVRRHVIEPVLEGLDLDTSDIRLLVNPTGRFEIGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLATRCEVQVAYAIGKAQPVGLYVETFGTEKVARGRIESAIRDVFDLRPAAIVRDLQLLQPIYAPTAAYGHFGRELPGFSWERTDRVEAL 394
>gi|24196438|gb|AAN49832.1|AE011430_8 S-Adenosylmethionine Synthetase [Leptospira interrogans serovar Lai str. 56601] >gi|45600470|gb|AAS69955.1| s-adenosylmethionine synthetase protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (422 aa)
Score = 829, Expect = 9.9e-87, Identities = 179/365 (49%), Positives = 252/365 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE------SDFTIIS-NVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM--RSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           I TSESVG+GHPDK+CDQISDAVLD  L+QDP S+VACE      L+VI GEIT+ G VD  ++A NV+  +GY++      +DF ++S +V++QS +I   V +   +    GAGDQG+++G+A +E    MP+PI  +H+LVK    +    K+ F++ D KSQVT++Y D +  +ID +++S QHS + T + IE    A+I+  +KK    NL ++ K  IN +G+F IGGP GD GLTGRK++VDTYG   +HGGGAFSGKD +KVDRS AY  RYIAKN+VA+ LA KCEVQL++AIG ++P++  VDTFGT K S+E++ + I   F  + +  IE   +  +   Y   ++YGHFGR      WE+ DK   +
  S:    43 IFTSESVGEGHPDKVCDQISDAVLDAYLEQDPKSRVACETLVTTNLVVIAGEITSKGKVDAQEIARNVIRDIGYNDITMGFDADFAVVSAHVHAQSPDISQGVTEGEGLFKEQGAGDQGLMFGFAINETPELMPMPIYYSHELVKHLAGLRHGNKLKFLRPDAKSQVTVEYKDGKPVRIDTVVISTQHSPDVTHKQIEE---ALIEECIKKVIPANLLNNTKYFINPTGQFIIGGPHGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPSKVDRSAAYMGRYIAKNVVASGLADKCEVQLAYAIGVAEPVSVHVDTFGTGKISEEELVKRIRANFKLTPRGIIESLKLLEKGRKYRETASYGHFGRKGSTFTWEETDKASAL 420
>gi|117928497|ref|YP_873048.1| S-adenosylmethionine synthetase [Acidothermus cellulolyticus 11B] >gi|117648960|gb|ABK53062.1| methionine adenosyltransferase [Acidothermus cellulolyticus 11B] (417 aa)
Score = 829, Expect = 1.2e-86, Identities = 164/367 (44%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIF------------NAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTK---IDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLN-----SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISDA+LD  LK+DP S+VA E       + + GE+TT  + D+  +  +V++ +GYD S          +  ++ SQS +I              AV++ ++ GAGDQG++ GYA D+    MPLPI +AH L   A ++ W  K   + +++ D K+QVTI+Y   +  ++D +++S QH+ +   +++      I ++VV    ++     SD+  ++N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY  R++AKN+VAA LA++CEVQ+++AIG + PI   V+TFGT    DE+I +++   FD    + I   ++  PIY P + YGHFGR E N  WE  D+ + +
  S:    23 RRLFTSESVTEGHPDKIADQISDAILDALLKEDPRSRVAVETLITTGQVHVAGEVTTEAWADIPAIVRDVILGIGYDSSKKGFDGGSCGVSVSIGSQSPDIAMGVDDAYEARHGEAVDELDRQGAGDQGMMVGYACDDTPELMPLPIALAHRL---ARRLAWVRKEGIVPYLRPDGKTQVTIEYERDKPVRLDTVVVSTQHAPDIDIDTL--LAPDIAEYVVAPELVDLGIDVSDYTLLVNPTGRFEIGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYAVRWVAKNVVAAGLARRCEVQVAYAIGKAHPIGLYVETFGTGVLPDEKIQDLVAQVFDLRPAAIIRDLDLLRPIYLPTAAYGHFGRLEPNFTWEITDRADAL 411
>gi|113478041|ref|YP_724102.1| S-adenosylmethionine synthetase [Trichodesmium erythraeum IMS101] >gi|123056100|sp|Q10VU5|METK_TRIEI S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|110169089|gb|ABG53629.1| methionine adenosyltransferase [Trichodesmium erythraeum IMS101] (420 aa)
Score = 829, Expect = 1.2e-86, Identities = 173/368 (47%), Positives = 251/368 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--DESDFT-----IISNVNSQSNEIFNAVEKDNQ------------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS------------QNATKESIESFCNAIIDFVVKKYNL--NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISD ++D  L QDP S+VA EV     L++I GEITT   V+ +++A   +  +GY   E+ F+     ++  ++ QS +I   V+K  +            +GAGDQG+++G+A +E    MPLPI++AH + +    V    ++ +++ D KSQVTI Y D +   ID I++S QH+            Q   KE +  +   +++ + K   +  NS  + ++N +GKF IGGP GD GLTGRK+++DTYG  ++HGGGAFSGKD TKVDRS AY  RYIAKNIVAA LA+KCEVQ+S+AIG +KP++  ++TFGTSK  ++++ E++   F+      I+ FN+R+         Y   + YGH GRT+L+  WEQ DKVE
  S:     1 MSSRYLFTSESVTEGHPDKICDQISDTIIDAILAQDPQSRVAAEVVVNTGLVLITGEITTKAQVNYIELARKKIADIGYVHAENGFSADSCSVLVALDEQSADIAQGVDKAQETRELLSEEELDAVGAGDQGLMFGFACNETPELMPLPISLAHRVCRQLTAVRKTGQLPYLRPDGKSQVTITYEDGRPVGIDTILISTQHTAKIGEITELSDIQAKIKEDLWKY---VVEPIFKDAEIKPNSQTRFLVNPTGKFVIGGPQGDCGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYIAKNIVAADLAEKCEVQISYAIGVAKPVSMMIETFGTSKVDEDKLLEVVKENFELRPAGIIQNFNLRNLPGERGGRFYQDVAAYGHLGRTDLDLPWEQTDKVE 405
>gi|145619620|ref|ZP_01775667.1| Methionine adenosyltransferase [Geobacter bemidjiensis Bem] >gi|144944025|gb|EDJ79103.1| Methionine adenosyltransferase [Geobacter bemidjiensis Bem] >gi|197087470|gb|ACH38741.1| S-adenosylmethionine synthetase [Geobacter bemidjiensis Bem] (402 aa)
Score = 828, Expect = 1.2e-86, Identities = 160/369 (43%), Positives = 247/369 (66%)
  Q:     2 ELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           E R + TSESV +GHPDK+ DQISDAVLD  L QDP+S+VACE      L+++ GE+++   V+  ++A + +  +GY ++ F        ++ +++ QS +I   V+               + +GAGDQG+V+G+ATDE   ++P  I +AH L +   +   + +I +++ D K+QVT++Y      ++D +++S QH      E I E     +I+ VV +  L+   +  +N +G+F IGGP GD GLTGRK++VD+YG  ++HGGGAFSGKD TKVDRSGAY ARY+AKN+VAA LAKK EVQ+++AIG ++P++  VD+FGT    +E++  +I + FD    + IE+  ++ PIY   + YGHFGR +L+  WE+ DK + +
  S:     3 EQRFLFTSESVTEGHPDKLADQISDAVLDALLAQDPDSRVACETSVTTGLVLLFGEVSSQARVNFARIARDTIAQVGYTDTKFGIDAEHAAVLVSLDQQSADIAQGVDVALEQRKGSDHDGYLDSVGAGDQGMVFGFATDETPEYLPTSIALAHKLARRLTEARKSGEIPYLRPDGKTQVTVEYRGDTPVRVDTVVISAQHDPEVEIEQIREDLVAKVIEKVVPEGLLDDKTRIFVNPTGRFVIGGPHGDAGLTGRKIIVDSYGGFSRHGGGAFSGKDSTKVDRSGAYAARYVAKNLVAAGLAKKVEVQIAYAIGVARPVSIFVDSFGTGVLRNEELAGLISSHFDLRPAAIIEELGLKRPIYRQTAAYGHFGRPDLDLPWERTDKAQAL 392
>gi|44888147|sp|Q7VNG7|METK_HAEDU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33147983|gb|AAP95504.1| S-adenosylmethionine synthase [Haemophilus ducreyi 35000HP] (386 aa)
Score = 828, Expect = 1.2e-86, Identities = 172/365 (47%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++++ +  GAGDQG+++GYAT+E +  MP PI  AH L++   +V  + K+ +++ D KSQ+T  Y ++Q   ID +++S QH++    KE IE     II   +    LN   K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AK+IVAA LA +CE+QLS+AIG + P +  V+TFGT K S++ + ++I   FD      I+  ++  PIY   + YGHFGR +    WE+ DK E +
  S:    10 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVIYDIGYSHSDMGFDAHSCAVLNAIGKQSPDINQGVDREDPLAQGAGDQGIMFGYATNETDVLMPAPITYAHRLMQRQAEVRKSGKLAWLRPDAKSQLTFAYENNQIIGIDAVVLSTQHAEEVKQKELIEGVMEEIIKPTLPSKWLNQHTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKSIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVSNDTLVKLIYQNFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WERTDKAEAL 382
>gi|15602892|ref|NP_245964.1| S-adenosylmethionine synthetase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431697|sp|P57897|METK_PASMU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|12721359|gb|AAK03111.1| MetX [Pasteurella multocida subsp. multocida str. Pm70] (384 aa)
Score = 828, Expect = 1.3e-86, Identities = 170/367 (46%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS++I   V+++N +  GAGDQG+++GYAT+E E  MP  I  AH L++   +V     + +++ D KSQVT+ Y D +   +D +++S QH  + ++  + E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ EE+
  S:     3 RYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYKHSDMGFDGHSCAVLNAIGKQSSDINQGVDRENPLDQGAGDQGIMFGYATNETEVLMPAAITYAHRLMERQAKVRKEGTLPWLRPDAKSQVTLKYEDHKIVGVDAVVLSTQHCDSISQHDLHEAVMEEIIKPVLPAEWLSKETKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVALVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEEL 377
>gi|84496646|ref|ZP_00995500.1| S-adenosylmethionine synthetase [Janibacter sp. HTCC2649] >gi|84383414|gb|EAP99295.1| S-adenosylmethionine synthetase [Janibacter sp. HTCC2649] (406 aa)
Score = 828, Expect = 1.3e-86, Identities = 164/366 (44%), Positives = 249/366 (68%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVEK------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-------FCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTEL----NP-GWEQLDKVEEI 370
           ++ TSESV +GHPDKICDQISD++LD  L QDP ++VA E      L+ + GE+TT  YV++ K+  + ++ +GYD S          +  ++  QS +I   V+             D Q GAGDQG+++GYA D+    MPLPI +AH L +    V  + ++ +++ D K+QVTI Y   +  K+D +++S QH+   + + + S           + +      +L+ SD++ +IN +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA++CEVQ+++AIG ++P+   V+TFGT     ++I + I++ FD    + ++  ++  PIY P + YGHFGRTE     NP  WE+LD+VE++
  S:     4 RLFTSESVTEGHPDKICDQISDSILDAMLAQDPGARVAVETMVTTGLVHVAGEVTTEAYVEIPKIVRDTVLGIGYDSSTKGFDGASCGVEVSIGQQSPDIAQGVDTAYESRTGGIDPLDKQ-GAGDQGLMFGYACDDTAELMPLPIYLAHRLAERLTAVRKSEELAYLRPDGKTQVTISYDGDKAVKLDTVVLSTQHADGISLDGLLSPDIEKHVIAPVLAELAEHGTDLDTSDYRSLINPTGTFVIGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYATRWVAKNVVAAGLARRCEVQVAYAIGKAQPVGIYVETFGTETVPADKIQDAILSVFDLRPAAILDALDLLRPIYKPTAAYGHFGRTEAAGYDNPFTWERLDRVEDL 400
>gi|116512840|ref|YP_811747.1| S-adenosylmethionine synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|123125311|sp|Q02WN8|METK_LACLS S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116108494|gb|ABJ73634.1| methionine adenosyltransferase [Lactococcus lactis subsp. cremoris SK11] (399 aa)
Score = 828, Expect = 1.4e-86, Identities = 171/376 (45%), Positives = 248/376 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES----DFTII----------SNVNSQSNEIFNAVEKDNQ-------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           M  + + TSESV +GHPDK+ DQISDA+LD  L QDP++ VACE       + + GEI+T+ YVD+  +    +  +GY +S    D+  +          S++    NE     +K+ Q       IGAGDQG+++G+AT+E   +MPL I+++H LVK    +  + +I +++ D KSQVT++Y ++   K +D +++S QH+  AT E I +   N +I  ++    L+ + K  IN +G+F IGGP GD+GLTGRK++VDTYG  A HGGGAFSGKD TKVDRS +Y ARY+AKNIVAA LA K ++QLS+AIG + P +  V+TFGT K SD+++   I   FD      I+  ++  PIY   ++YGHFGRT++   WEQ DK  E+    +K
  S:     1 MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDNNGKAKRVDTVVISTQHAAAATNEEIHDDVINKVIKAIIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLADKAQIQLSYAIGVATPTSINVETFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTASYGHFGRTDIELPWEQTDKANELKAMLEK 399
>gi|73539907|ref|YP_294427.1| S-adenosylmethionine synthetase [Ralstonia eutropha JMP134] >gi|109892657|sp|Q476V0|METK_RALEJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|72117320|gb|AAZ59583.1| methionine adenosyltransferase [Ralstonia eutropha JMP134] (387 aa)
Score = 828, Expect = 1.6e-86, Identities = 165/361 (45%), Positives = 238/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VA E      L+V+ GEITT   VD +++A + +  +GYD +++        ++   + QS +I   V++      NQ GAGDQG+++GYA DE    MP PI  +H LV+   Q+  + ++ +++ D KSQVT+ Y D +   +D +++S QH+ + T+  I     A+I+ ++K      +  D K ++N +G+F IGGP GD GLTGRK++VDTYG  + HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT K SD +I E++   FD   K  ++  ++  PIY   + YGHFGR E    WE  DK
  S:     6 LFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQ-GAGDQGLMFGYACDETPELMPFPIYYSHRLVERQSQLRRDGRLPWLRPDAKSQVTVRYVDGRPHSVDTVVLSTQHAPDITQAQIRE---AVIEEIIKPVLPPEMLKDTKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINVTVYTEGTGKISDAKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDK 377
>gi|168184770|ref|ZP_02619434.1| methionine adenosyltransferase [Clostridium botulinum Bf] >gi|182672180|gb|EDT84141.1| methionine adenosyltransferase [Clostridium botulinum Bf] (384 aa)
Score = 827, Expect = 1.7e-86, Identities = 168/370 (45%), Positives = 260/370 (70%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY----NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           ++ + TSESV +GHPDKICDQISD+++DE + +D N+++ACE      ++++ GEI+T  +VD+ ++    +  +GY +  F        +I++++ QS +I   V+K  +IGAGDQG+V+G+A +E   +MPLPI +AH L      V  N ++ ++  D K+QVT++Y      ++D I++S QH+ N + E I+     IID+V++K      +++D K +IN +G+F +GGP GD+GLTGRK++VDTYG + KHGGGAFSGKD TK DRSGAY AR++AKN+VAA +A K E+Q+++AIG S P++ ++DTF T KYSDE I +++   F  +  S I +  +R+PIY   + YGHFGR +L+  WE+L+KV++I E
  S:     1 MKSLFTSESVTEGHPDKICDQISDSIVDEIISKDENARIACETVVTTGMVIVMGEISTKCHVDISEIVRKTISDIGYRDGKFGFDCKNCAVITSIDKQSPDIAMGVDKVKEIGAGDQGMVFGFAANETPEYMPLPIVLAHKLAGRLAYVRKNNELTYLGPDGKTQVTVEYDGDVPKRVDCIVVSTQHTDNVSNEKIQ---QDIIDYVIEKTIPKKFIDNDTKILINPTGRFVVGGPQGDSGLTGRKIIVDTYGGVGKHGGGAFSGKDPTKADRSGAYAARWVAKNLVAAGVADKIEIQIAYAIGVSNPVSISIDTFSTGKYSDEFIIKLVNKVFKLTPLSIINELELRNPIYKQTAAYGHFGRLDLDLPWERLNKVKKIKE 378
>gi|145590181|ref|YP_001156778.1| methionine adenosyltransferase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189081724|sp|A4T0F0|METK_POLSQ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|145048587|gb|ABP35214.1| methionine adenosyltransferase [Polynucleobacter sp. QLW-P1DMWA-1] (388 aa)
Score = 827, Expect = 1.7e-86, Identities = 171/359 (47%), Positives = 241/359 (67%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           TSESV +GHPDK+ DQISDA+LD  L QDP ++VA E      L+V+ GEITT   VD +++A N L  +GYD +D+        ++   + QS +I   V+K  D+ +  GAGDQG+++GYA DE    MP+PI+++H LV+   Q+  + ++++++ D KSQVT+ Y D +   ID +++S QH +  + E + E+    II  V+ K+ +      ++N +G+F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY  RY+AKN+VAA LA KC +Q+S+AIG +KP +  V TFGT K SDE+I +++   FD   K  ++  N+  PIY   + YGHFGR E    WEQ DK
  S:     8 TSESVSEGHPDKVADQISDAILDAILAQDPTARVAAETLCNTGLVVLAGEITTHANVDYIQVARNTLREIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDKAHDDGLDQGAGDQGLMFGYACDETSELMPMPIHLSHRLVERQSQLRRDGRLNWLRPDAKSQVTLRYVDGKPDSIDTVVLSTQHDEEISLEKLREAVIEEIIKPVLPKHLIKGAINFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAGRYVAKNVVAAGLASKCLIQISYAIGVAKPTSVMVSTFGTGKISDEKIAQLVSENFDLRPKGIVKMLNLLRPIYRKTAAYGHFGREEPEFTWEQTDK 378
>gi|161511521|ref|NP_873115.2| S-adenosylmethionine synthetase [Haemophilus ducreyi 35000HP] (381 aa)
Score = 827, Expect = 1.8e-86, Identities = 172/365 (47%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY  SD         +++ +  QS +I   V++++ +  GAGDQG+++GYAT+E +  MP PI  AH L++   +V  + K+ +++ D KSQ+T  Y ++Q   ID +++S QH++    KE IE     II   +    LN   K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AK+IVAA LA +CE+QLS+AIG + P +  V+TFGT K S++ + ++I   FD      I+  ++  PIY   + YGHFGR +    WE+ DK E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVIYDIGYSHSDMGFDAHSCAVLNAIGKQSPDINQGVDREDPLAQGAGDQGIMFGYATNETDVLMPAPITYAHRLMQRQAEVRKSGKLAWLRPDAKSQLTFAYENNQIIGIDAVVLSTQHAEEVKQKELIEGVMEEIIKPTLPSKWLNQHTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKSIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVSNDTLVKLIYQNFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WERTDKAEAL 377
>gi|77166136|ref|YP_344661.1| S-adenosylmethionine synthetase [Nitrosococcus oceani ATCC 19707] >gi|109892644|sp|Q3J7R5|METK_NITOC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|76884450|gb|ABA59131.1| methionine adenosyltransferase [Nitrosococcus oceani ATCC 19707] (403 aa)
Score = 827, Expect = 1.9e-86, Identities = 162/369 (43%), Positives = 248/369 (67%)
  Q:     2 ELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNSDF------KRI-INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           E+R+  TSESV +GHPDK+ DQISD +LD  L QD  ++VACE      ++++ GEITT  ++D  ++    +  +GY+ S+         +++ +  QS++I   V+++     GAGDQG+++GYA+DE +  MP PI  AH LV+   ++  N ++ +++ D KSQVT+ Y D     ID I++S QHS   ++ ++     A+I+ ++K   L +D+      + I +N +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKN+VAA LA++CEVQ+S+AIG ++P + +V+TFGT + ++ ++ E+I   FD      ++  ++  PIY   + YGHFGR E    WEQ DK E +
  S:     3 EIRQ-FTSESVSEGHPDKVADQISDVILDAILAQDRRARVACETLVKTGMVLVAGEITTQAHIDYEQIIRETITEIGYNHSEIGFDGATCAVVNAIGKQSSDIAQGVDRELEEDQGAGDQGMMFGYASDETDVLMPAPITYAHRLVQRQAEIRRNGELPWLRPDAKSQVTLLYEDDVPVAIDAIVLSTQHSPEISQATLRE---AVIETIIKPV-LPADWFAHCRSENIHVNPTGNFIIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNLVAAGLAERCEVQISYAIGVAEPTSVSVNTFGTGRIAESRLVELIQAHFDLRPVGLLQMLDLIRPIYRKTAAYGHFGREEPEFTWEQTDKAEAL 382
>gi|71280871|ref|YP_267999.1| S-adenosylmethionine synthetase [Colwellia psychrerythraea 34H] >gi|109892627|sp|Q486L6|METK_COLP3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71146611|gb|AAZ27084.1| S-adenosylmethionine synthetase [Colwellia psychrerythraea 34H] (395 aa)
Score = 827, Expect = 2.0e-86, Identities = 166/367 (45%), Positives = 244/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRT--ELNPG--------WEQLDKVEEI 370
           R   TSESV +GHPDKI DQISDAVLD  + +D +++VACE      + +I GE++T  +VD+ K+  NV+  +GY  SD         I++ +  QS EI   V++ N  + GAGDQG+++GYAT+E    MP P+  +H LV+   +   +  + +++ D KSQVT  Y D++   ID +++S QH+ +  +E  + +    II+ V+    L  D K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA +CE+Q+S+AIG ++P + ++DTFGT   S+E++ EI+   FD       +  ++  P+Y   + YGHFGR   E+  G        WE+ DK +++
  S:     3 RHFFTSESVSEGHPDKIADQISDAVLDAIIAKDKHARVACETMVKTGVAIISGEVSTNAWVDLEKLTRNVISDIGYTSSDVGFDGATCGIMNLIGQQSPEIAQGVDRSNPEEQGAGDQGLMFGYATNETPTLMPAPLYYSHRLVERQAEARKSGVLPWLRPDAKSQVTFIYEDNKPVAIDTVVLSTQHNPDIKQEDLVSAVMENIINHVLPAELLTEDTKYHINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADRCEIQISYAIGVAEPTSISIDTFGTGSISEERLVEIVREHFDLRPYGITKMLDLLHPMYQQTAAYGHFGREPFEMTVGDDTFTAFSWEKTDKADDL 389
>gi|81097218|ref|ZP_00875520.1| S-adenosylmethionine synthetase [Streptococcus suis 89/1591] >gi|80976733|gb|EAP40314.1| S-adenosylmethionine synthetase [Streptococcus suis 89/1591] (396 aa)
Score = 826, Expect = 2.6e-86, Identities = 162/370 (43%), Positives = 244/370 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIIS--------------NVNSQSNEIFNAVEKDNQ-----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M  RK+ TSESV +GHPDKI DQISDA+LD  L +DP++ VA E       + + GEI+T  YVD+ ++  + +  +GY + ++   +              ++    NE     +  +Q     IGAGDQG+++G+A DE    MPLPI+++H LV+   ++  + +I +++ D KSQVT++Y +   P ++D +++S QH    ++E I +     +I  ++  + L+      IN +G+F IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA LAKK EVQL++AIG + P++  +DTFGTS  ++ ++   +   FD      I+  +++ PIY   + YGH GRT++   WE+LDKVE +
  S:     1 MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTKGEYGFSAESVGVHPSLVEQSPDIAQGVNEALETRQDASQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLSHKLVRRLAELRKSGEIAYLRPDAKSQVTVEYDEDNQPVRVDTVVISTQHDPEVSQEQIRQDVIERVIKDIIPAHYLDDQTNYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAHPVSVRIDTFGTSTVAESKLEAAVRQIFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIVLPWEKLDKVEAL 391
>gi|33564986|emb|CAE39933.1| S-adenosylmethionine synthetase [Bordetella parapertussis] >gi|33575231|emb|CAE30694.1| S-adenosylmethionine synthetase [Bordetella bronchiseptica RB50] (432 aa)
Score = 825, Expect = 2.9e-86, Identities = 162/361 (44%), Positives = 236/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD    QDPN++VA E      L+V+ GEITT   VD +++A + +  +GYD +++        ++   + QS +I   V++ ++     GAGDQG+++GYA DE  + MP PI  AH LV+   ++  + ++ +++ D KSQVT  Y D +  ++D +++S QHS   ++ SI E+    II     +  +    K ++N +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT    DEQI +++   FD   K  +   ++  PIY+  + YGHFGR+E    WE  DK
  S:    52 LFTSESVSEGHPDKVADQISDAILDAIFTQDPNARVAAETLCNTGLVVLAGEITTTANVDYIQVARDTIRHIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRSSEDYLNQGAGDQGLMFGYACDETPDLMPAPIWYAHRLVQRQSELRKDGRLPWLRPDAKSQVTFRYVDGRPAEVDTVVLSTQHSPEISQASIREAVIEDIIKPSFPEGLITPKTKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVAEPINITVYTEGTGVIPDEQIAKLVREHFDLRPKGIVNMLDLLRPIYTKTAAYGHFGRSEPEFSWEATDK 424
>gi|161484949|ref|NP_712814.2| S-adenosylmethionine synthetase [Leptospira interrogans serovar Lai str. 56601] >gi|161621776|ref|YP_001318.2| S-adenosylmethionine synthetase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|44888153|sp|Q8CXS7|METK_LEPIN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|59798335|sp|Q72SM5|METK_LEPIC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) (386 aa)
Score = 825, Expect = 3.0e-86, Identities = 179/365 (49%), Positives = 252/365 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE------SDFTIIS-NVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM--RSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           I TSESVG+GHPDK+CDQISDAVLD  L+QDP S+VACE      L+VI GEIT+ G VD  ++A NV+  +GY++      +DF ++S +V++QS +I   V +   +    GAGDQG+++G+A +E    MP+PI  +H+LVK    +    K+ F++ D KSQVT++Y D +  +ID +++S QHS + T + IE    A+I+  +KK    NL ++ K  IN +G+F IGGP GD GLTGRK++VDTYG   +HGGGAFSGKD +KVDRS AY  RYIAKN+VA+ LA KCEVQL++AIG ++P++  VDTFGT K S+E++ + I   F  + +  IE   +  +   Y   ++YGHFGR      WE+ DK   +
  S:     7 IFTSESVGEGHPDKVCDQISDAVLDAYLEQDPKSRVACETLVTTNLVVIAGEITSKGKVDAQEIARNVIRDIGYNDITMGFDADFAVVSAHVHAQSPDISQGVTEGEGLFKEQGAGDQGLMFGFAINETPELMPMPIYYSHELVKHLAGLRHGNKLKFLRPDAKSQVTVEYKDGKPVRIDTVVISTQHSPDVTHKQIEE---ALIEECIKKVIPANLLNNTKYFINPTGQFIIGGPHGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPSKVDRSAAYMGRYIAKNVVASGLADKCEVQLAYAIGVAEPVSVHVDTFGTGKISEEELVKRIRANFKLTPRGIIESLKLLEKGRKYRETASYGHFGRKGSTFTWEETDKASAL 384
>gi|71274656|ref|ZP_00650944.1| S-adenosylmethionine synthetase [Xylella fastidiosa Dixon] >gi|71899632|ref|ZP_00681786.1| S-adenosylmethionine synthetase [Xylella fastidiosa Ann-1] >gi|170730923|ref|YP_001776356.1| methionine adenosyltransferase [Xylella fastidiosa M12] >gi|71164388|gb|EAO14102.1| S-adenosylmethionine synthetase [Xylella fastidiosa Dixon] >gi|71730584|gb|EAO32661.1| S-adenosylmethionine synthetase [Xylella fastidiosa Ann-1] >gi|167965716|gb|ACA12726.1| Methionine adenosyltransferase [Xylella fastidiosa M12] (403 aa)
Score = 825, Expect = 3.2e-86, Identities = 170/363 (46%), Positives = 248/363 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR-------TELNPG--------WEQLDKVE 368
           + TSESV +GHPDK+ DQISDAVLD  L QDP ++VACE      + +I GEITT+ +VD+  +   V++ +GY+ SD         +++ +  QS +I   V+  K  + GAGDQG+++GYAT+E +++MP  I+I+H LV+   ++    N+ + +++ D K+Q+T+ Y D     ID +++S QH      K+ +E+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS +Y  RY+AKN+VAA LA +CEVQ+S+AIG ++PI+ +V TFGT K  D++I ++I   FD      I+  ++  PIY P ++YGHFGR       T  N G        WE++DK E
  S:     5 LFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSPLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKVPDDKIEKLIRQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPREFAYTNSNGGRVVATAFSWEKIDKAE 394
>gi|167749747|ref|ZP_02421874.1| hypothetical protein EUBSIR_00714 [Eubacterium siraeum DSM 15702] >gi|167657230|gb|EDS01360.1| hypothetical protein EUBSIR_00714 [Eubacterium siraeum DSM 15702] (393 aa)
Score = 825, Expect = 3.4e-86, Identities = 177/367 (48%), Positives = 253/367 (68%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIF----NAVE-KDNQ---IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + + TSESV +GHPDKICD+ISD VLD  L QD N++VACE  A   +++I GEITT   VD+  +A +V+   GYD SD+        I++ ++ QS +I     NA+E +DN     GAGDQG+++GYA DE E  MPL I++AH L K    V  + +I ++  D K+QVT++Y +   P +ID +++S QH  + T+E + +     +I   V    L+ + K +IN +G+F +GGP GD+GLTGRK++VDTYG + +HGGGAFSGKD TKVDRS AY AR++AKNIVAA +AK+CEV+L++AIG ++P++  VDTFGT    D +I   +   FD    + I   N+R+  Y P + YGH GRT+L+  WE+ DKV+E+
  S:     3 KYLFTSESVTEGHPDKICDRISDGVLDAILAQDKNARVACETCATTGMVLIMGEITTTANVDIPAIARDVIKETGYDNSDYGFDYKTCAILTTLDKQSPDIAMGVDNALEGRDNNEFDTGAGDQGMMFGYACDETEELMPLTISLAHALSKKLTAVRKSGEIPYLLPDGKTQVTVEYNEDGTPSRIDTVVVSSQHKADVTQEQLRADIIEKVIKTTVPASLLDENTKMLINPTGRFVVGGPQGDSGLTGRKIIVDTYGGVGRHGGGAFSGKDPTKVDRSAAYAARHVAKNIVAAGIAKRCEVELAYAIGVAQPVSVFVDTFGTGIKPDSEISAAVSKVFDLRPSAIISSLNLRNTKYRPLAAYGHMGRTDLDVAWEKTDKVDEL 386
>gi|167039888|ref|YP_001662873.1| S-adenosylmethionine synthetase [Thermoanaerobacter sp. X514] >gi|166854128|gb|ABY92537.1| Methionine adenosyltransferase [Thermoanaerobacter sp. X514] (391 aa)
Score = 824, Expect = 3.7e-86, Identities = 172/374 (45%), Positives = 244/374 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAV-----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           ++ +T+ESV  GHPDK+CD I+D++LD CL++D  S+VACEV A    I++ GEI+ +  +D+  +  NVL  LGY+   F I   V++QS++I + V           E+   IGAGDQG +YGYAT E    +PLP+ ++H +VK  ++      I  I  D K+QVTI+Y D    ++  I++SVQH +N T+E ++S   N ++    + +  + + + +IN SG+F +GGP  DTGLTGRK+MVDTYG LA HGGGA  GKD TKVDRSGAY ARYIAK+IV   LA+KCEV +S+AIG + P+AF+++TFGT   SDE +       F+    + IEK  +R+  YS  + YGHF    L P WE ++K  E+ E   KY
  S:     3 KRYLTAESVCAGHPDKLCDIIADSILDACLRKDKASRVACEVMATKGKIIVAGEISCSEKIDIRNIVKNVLKELGYNPLKFLIYVYVHNQSSDIASGVNTALEARNGINEQYGSIGAGDQGTMYGYATKETREMLPLPLVLSHRIVKRLDEARKGKLIKGILPDGKAQVTIEYDDDVPVRVKTIVVSVQHEKNKTQEELKSDILNNVLWQCFEDFPFDDETEILINPSGQFVLGGPAADTGLTGRKIMVDTYGGLASHGGGALCGKDPTKVDRSGAYMARYIAKHIVWCDLAEKCEVAISYAIGKANPVAFSINTFGTGTVSDEVLTIAAQEVFNLRPAAIIEKLRLRNIHYSDTAVYGHFNSC-LFP-WEDVNKYSELKEAVGKY 386
>gi|42631472|ref|ZP_00157010.1| COG0192: S-adenosylmethionine synthetase [Haemophilus influenzae R2866] (384 aa)
Score = 824, Expect = 3.7e-86, Identities = 168/365 (46%), Positives = 251/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  ++K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSSKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPTEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEDL 377
>gi|94501837|ref|ZP_01308349.1| S-adenosylmethionine synthetase [Oceanobacter sp. RED65] >gi|94426058|gb|EAT11054.1| S-adenosylmethionine synthetase [Oceanobacter sp. RED65] (403 aa)
Score = 824, Expect = 4.1e-86, Identities = 167/368 (45%), Positives = 242/368 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    I TSESV +GHPDK+ DQISDAVLD  + +D +++VA E      + V+ GE+TT+ YVD+  +  +V+  +GY+ SD         +++ +  QS +I   V+  K    GAGDQG+++GYAT+E  N MP P+  +H LVK   ++  N  + +++ D KSQVTI+Y +  +PK+D +++S QH  + ++E + E+    II  V  +  L +D    IN +GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA +CEVQ+S+AIG ++P + + +TFGT K SD ++ +II   FD    +   + N+  P+Y   + YGHFGR      +E  D+ E
  S:     1 MSEYSIFTSESVSEGHPDKVADQISDAVLDAIIARDEHARVAVETLVKTGMAVVAGEVTTSCYVDLEDIVRDVITGIGYNSSDVGFDGATCAVLNGIGKQSVDINQGVDRAKPEDQGAGDQGLMFGYATNETPNLMPAPVYYSHLLVKRQSELRRNGTLPWLRPDAKSQVTINY-EGASPKVDAVVLSTQHDPSISQEELREAVLEHIIKPVFPEGWLTADTLYHINPTGKFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYMGRYVAKNIVAAGLADRCEVQVSYAIGVAEPTSISANTFGTGKVSDIELAKIIREVFDLRPYAIQNQLNLLYPMYQLTAAYGHFGREPFQHTYEYNDRGE 377
>gi|169177975|ref|ZP_02839437.1| Methionine adenosyltransferase [Arthrobacter chlorophenolicus A6] >gi|169014133|gb|EDS60703.1| Methionine adenosyltransferase [Arthrobacter chlorophenolicus A6] (411 aa)
Score = 824, Expect = 4.3e-86, Identities = 161/366 (43%), Positives = 252/366 (68%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEI----FNAVEK---------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLN-SDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++ TSESV +GHPDKICDQISDA+LD  L  DP S+VA E  A   L+ + GE+TT  YV++ ++    ++ +GYD S          +  ++  QSN+I    FN++E          D Q GAGDQG+++GYA+DE  ++MP PI +AH L +   +V  + ++ +++ D K+QVT+ Y   +   ++ +++S QH++ A+ E + +   + +I  V+   NL+ S    I+N +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LAK+ E+Q+++AIG ++P+   V+TFGT      +I   I   FD   ++ I+  +++ PIY+  + +GHFGR + +  WE+LD+V+++
  S:    19 RLFTSESVTEGHPDKICDQISDAILDALLAADPESRVAVETMATTGLVHVAGEVTTDAYVEIPQIVRETILGIGYDSSANGFDGARCGVSVSIGQQSNDIAGGVFNSLEAREGRQEDDYDLQ-GAGDQGIMFGYASDETPSYMPTPIWLAHRLSERLTEVRKSGELAYLRPDGKTQVTVGYDRDRPVSVETVVISSQHAEGASLEQLRADLASVVIKPVLAAANLDVSRAANILNPAGEFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAKRAEIQIAYAIGQARPVGTYVETFGTETVDPARISAAIAEIFDLRPRAIIDALDLKRPIYAKTAAHGHFGRDDPDFTWERLDRVDDL 405
>gi|15836994|ref|NP_297682.1| S-adenosylmethionine synthetase [Xylella fastidiosa 9a5c] >gi|24212019|sp|Q9PGB0|METK_XYLFA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|9105228|gb|AAF83202.1|AE003891_1 methionine adenosyltransferase [Xylella fastidiosa 9a5c] (403 aa)
Score = 823, Expect = 5.2e-86, Identities = 170/363 (46%), Positives = 248/363 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR-------TELNP--------GWEQLDKVE 368
           + TSESV +GHPDK+ DQISDAVLD  L QDP ++VACE      + +I GEITT+ +VD+  +   V++ +GY+ SD         +++ +  QS +I   V+  K  + GAGDQG+++GYAT+E +++MP  I+I+H LV+   ++    N+ + +++ D K+Q+T+ Y D     ID +++S QH      K+ +E+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS +Y  RY+AKN+VAA LA +CEVQ+S+AIG ++PI+ +V TFGT K SD++I ++I   FD      I+  ++  PIY P ++YGHFGR       T  N          WE++DK E
  S:     5 LFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSPLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKISDDKIEKLIRQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPRELAYTNSNGERVVATAFSWEKIDKAE 394
>gi|148654658|ref|YP_001274863.1| methionine adenosyltransferase [Roseiflexus sp. RS-1] >gi|172048071|sp|A5UQL0|METK_ROSS1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|148566768|gb|ABQ88913.1| methionine adenosyltransferase [Roseiflexus sp. RS-1] (405 aa)
Score = 823, Expect = 5.5e-86, Identities = 159/367 (43%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEIT-TAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEK-----------DNQ---IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R   TSESV +GHPDKICDQ+SDAVLD  L  DP ++VACE      LIV+ GE+T   GY+ + ++    +  +GY ++ +        ++  ++ QS +I   V++           D +   IGAGDQG+++G+A +E    MPLPI +AH + +   ++     + +++ D KSQVT++Y+  +  ++D +++S QH+ + T++ I     + +I  VV    ++   K  +N +G+F IGGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS AY  R++AKN+VAA LA + E+Q+++AIG + P++ +V+ FGT+K S+E I  +I   FD    + I    +R PIY P + YGHFGR +++  WEQ D+ E +
  S:    10 RLFFTSESVTEGHPDKICDQVSDAVLDAFLTHDPRARVACETATTTGLIVVIGEVTYEQGYIPIEEIVRKTVKDIGYTDASYGFDADTCGVMVAIHGQSPDIAQGVDRALEVRGDGYVTDEEVATIGAGDQGMMFGFACNETPELMPLPIALAHRIGRRLSRLRKEGVLPYLRPDGKSQVTVEYSYGRPVRVDTVLVSNQHAPDVTQDQIRHDIIHQVIHAVVPPELIDEKTKYFVNPTGRFVIGGPMGDSGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYACRWVAKNVVAAGLADRFEIQVAYAIGVAHPLSISVECFGTNKVSEETILRLINEHFDLRPGAIIRDLRLRRPIYRPTAAYGHFGRDDIDAPWEQTDRAEAL 399
>gi|148828326|ref|YP_001293079.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittGG] >gi|166201394|sp|A5UIU0|METK_HAEIG S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|148719568|gb|ABR00696.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittGG] (384 aa)
Score = 822, Expect = 7.1e-86, Identities = 168/365 (46%), Positives = 250/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPSEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEDL 377
>gi|71065388|ref|YP_264115.1| S-adenosylmethionine synthetase [Psychrobacter arcticus 273-4] >gi|109892655|sp|Q4FTH7|METK_PSYA2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71038373|gb|AAZ18681.1| methionine adenosyltransferase [Psychrobacter arcticus 273-4] (388 aa)
Score = 822, Expect = 7.5e-86, Identities = 160/368 (43%), Positives = 246/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR--TELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LD  L+QD +++VACE       +++ GEITT   +DV ++  + +  +GY  SD         +I+ +  QS EI   V++ +  + GAGDQG+++GYA++E E  MP PI  AH L++   ++    ++ +++ D K+Q+T+ Y  S+   ID +++S QH  + ++  + E+   +II  V+    L++  +  IN +GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA +A +CEVQ+S+AIG ++P + +++TFGT+K S+++I  +I   FD          N+  P+Y   +++GHFGR  +E    WE++DK E
  S:     1 MREYNLFTSESVSEGHPDKMADQISDAILDAILRQDLHARVACETLVKTGAVILAGEITTTANIDVERIVRDTVNGIGYHHSDLGFDGETCAVINMLGKQSPEIAQGVDRADPEEQGAGDQGLMFGYASNETEVLMPAPIEYAHRLMERQSELRRAGELPWLRPDAKAQITLKYDGSKPVAIDAVVLSTQHDPSISQADLQEAIMESIIKQVLPAELLHAGTRYHINPTGKFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAVRYVAKNIVAAGIADRCEVQVSYAIGVAEPTSISINTFGTNKISNDEIIRLIRTHFDLRPYGITRMLNLLQPMYQQTASFGHFGRQGSETAFTWEKIDKAE 380
>gi|72161469|ref|YP_289126.1| S-adenosylmethionine synthetase [Thermobifida fusca YX] >gi|109892680|sp|Q47R14|METK_THEFY S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|71915201|gb|AAZ55103.1| methionine adenosyltransferase [Thermobifida fusca YX] (397 aa)
Score = 822, Expect = 7.5e-86, Identities = 161/367 (43%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVE-----KDNQI-------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI--ESFCNAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISDA+LD  L+ DP+S+VA E      L+ + GE+TT+ YVD+  +    ++ +GYD S          +  ++  QS +I   V+     ++ +I       GAGDQG+++GYA +E    MPLPI +AH L +   +V  +  I +++ D K+QVT++Y  ++  ++D +++S QH+ +     +        ++D VV +YNL +D ++ ++N +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA + EVQ+++AIG + P+   ++TFGT K + EQ+ + ++  FD    + I   ++  PIYS  S YGHFGR   +  WE+ D+V+ +
  S:     3 RRLFTSESVTEGHPDKIADQISDAILDSMLRDDPHSRVAVETLITTGLVHVAGEVTTSTYVDIPTIIREKILEIGYDSSAKGFDGASCGVSVSIGGQSPDIAQGVDNAYEAREEEIFDDLDRQGAGDQGLMFGYANNETPELMPLPITLAHALSQRLAEVRRDGTIPYLRPDGKTQVTVEYDGNRPVRLDTVVVSSQHAPDIDLRELLTPDIKEHVVDPVVARYNLEADNYRLLVNPTGRFEIGGPMGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLADRVEVQVAYAIGKAHPVGVFLETFGTEKVAPEQLEKAVLEVFDLRPAAIIRDLDLLRPIYSQTSVYGHFGRELPDFTWERTDRVDAL 391
>gi|53732466|ref|ZP_00154423.2| COG0192: S-adenosylmethionine synthetase [Haemophilus influenzae R2846] >gi|145639307|ref|ZP_01794913.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittII] >gi|145641234|ref|ZP_01796814.1| S-adenosylmethionine synthetase [Haemophilus influenzae R3021] >gi|145271610|gb|EDK11521.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittII] >gi|145274071|gb|EDK13937.1| S-adenosylmethionine synthetase [Haemophilus influenzae 22.4-21] (384 aa)
Score = 822, Expect = 7.7e-86, Identities = 168/365 (46%), Positives = 250/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPSEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEDL 377
>gi|68249720|ref|YP_248832.1| S-adenosylmethionine synthetase [Haemophilus influenzae 86-028NP] >gi|145635022|ref|ZP_01790728.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittAA] >gi|81335851|sp|Q4QLC5|METK_HAEI8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|68057919|gb|AAX88172.1| S-adenosylmethionine synthetase [Haemophilus influenzae 86-028NP] >gi|145267630|gb|EDK07628.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittAA] (384 aa)
Score = 821, Expect = 8.2e-86, Identities = 168/365 (46%), Positives = 250/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPTEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEDL 377
>gi|148244825|ref|YP_001219519.1| S-adenosylmethionine synthetase [Candidatus Vesicomyosocius okutanii HA] >gi|146326652|dbj|BAF61795.1| S-adenosylmethionine synthetase [Candidatus Vesicomyosocius okutanii HA] (377 aa)
Score = 821, Expect = 8.4e-86, Identities = 166/361 (45%), Positives = 238/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           I TSESV  GHPDKICDQISDA+LD  L QD NS+VA E       +V+ GEITT   +D  K+  N +I +GYD+ ++        I + +  QS +I   V +  +++ GAGDQG+++GYA +  +  MP PI  AH LV    +++ +  + +++ D KSQV++ Y   +   ID +++S QH  + +   +       II  V+    L++  +  IN++G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RYIAKNIVAA LA +CE+Q+S+AIG ++PI+  V+TFGT K +++ I  +I   FD   K  IE  +++ PIY   ++YGHFGRTE +  WE+ D+
  S:     2 IFTSESVSAGHPDKICDQISDAILDAALTQDKNSRVAVETLVKGNHVVLAGEITTGANIDYEKIVRNTIIDIGYDKQEYGFNGNTCNITNLLGEQSQDIAIGVNESSNHEQGAGDQGLMFGYACNATDTLMPAPILYAHLLVARQAKLMKDGVLPWLRPDAKSQVSMIYNGHKIVGIDAVVLSTQHDNDISLTDLRKVILEKIIKPVLPSKWLSNKTQYHINSTGHFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSTAYATRYIAKNIVAAGLADRCEIQVSYAIGVAEPISINVETFGTGKINNQAIEHLIHKHFDLRPKGLIEMLDLKRPIYQQTASYGHFGRTENDISWEKTDR 372
>gi|94676924|ref|YP_588494.1| S-adenosylmethionine synthetase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|158564239|sp|Q1LU70|METK_BAUCH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|94220074|gb|ABF14233.1| S-adenosylmethionine synthetase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (385 aa)
Score = 821, Expect = 9.5e-86, Identities = 168/363 (46%), Positives = 234/363 (64%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD----------FTIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + + TSESV +GHPDKI DQISD VLD  L QD  ++VACE +    ++++GGEITT  ++D+ ++  N +  +GY  S+           +IIS  +   N+  N ++   Q GAGDQG ++GYAT+E +  MP PI  AH LV     V  N  + ++  D KSQVT  Y + +   ID ++ S QH +N T  ++ E+    II  V+    L+   K  IN +G+F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA+KCE+Q+S+AIG ++P +  ++TFGT K S + +  ++   FD    S I   N+  PIY   +TYGHFGR      WE+ DK
  S:     3 KHLFTSESVSEGHPDKIADQISDTVLDAILAQDLKARVACETYVKTGMVLVGGEITTNAWIDIEELTRNTIRDIGYTNSEMKFDANSCAVLSIISKQSPDINKGINNIDPREQ-GAGDQGFMFGYATNETDVLMPAPITYAHRLVARQSLVRKNGTLPWLCPDAKSQVTFAYDEGKVVGIDTVVFSTQHVENITLPNLKEAVMEEIIKPVLPIELLSEHTKFFINPTGRFVVGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAEKCEIQVSYAIGIAEPTSITIETFGTEKISADHLTALVNEFFDLRPYSLITMLNLLQPIYRETATYGHFGREHFP--WEKTDK 373
>gi|33593998|ref|NP_881642.1| S-adenosylmethionine synthetase [Bordetella pertussis Tohama I] >gi|161609282|ref|NP_886745.2| S-adenosylmethionine synthetase [Bordetella bronchiseptica RB50] >gi|161610404|ref|NP_882553.2| S-adenosylmethionine synthetase [Bordetella parapertussis 12822] >gi|44888149|sp|Q7VUL5|METK_BORPE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|44888150|sp|Q7W200|METK_BORPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|44888151|sp|Q7WQX8|METK_BORBR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33564072|emb|CAE43340.1| S-adenosylmethionine synthetase [Bordetella pertussis Tohama I] (387 aa)
Score = 821, Expect = 1.0e-85, Identities = 162/361 (44%), Positives = 236/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDA+LD    QDPN++VA E      L+V+ GEITT   VD +++A + +  +GYD +++        ++   + QS +I   V++ ++     GAGDQG+++GYA DE  + MP PI  AH LV+   ++  + ++ +++ D KSQVT  Y D +  ++D +++S QHS   ++ SI E+    II     +  +    K ++N +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT    DEQI +++   FD   K  +   ++  PIY+  + YGHFGR+E    WE  DK
  S:     7 LFTSESVSEGHPDKVADQISDAILDAIFTQDPNARVAAETLCNTGLVVLAGEITTTANVDYIQVARDTIRHIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRSSEDYLNQGAGDQGLMFGYACDETPDLMPAPIWYAHRLVQRQSELRKDGRLPWLRPDAKSQVTFRYVDGRPAEVDTVVLSTQHSPEISQASIREAVIEDIIKPSFPEGLITPKTKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVAEPINITVYTEGTGVIPDEQIAKLVREHFDLRPKGIVNMLDLLRPIYTKTAAYGHFGRSEPEFSWEATDK 379
>gi|116010466|emb|CAJ43279.1| SAM synthetase [Streptomyces peucetius ATCC 27952] (402 aa)
Score = 821, Expect = 1.0e-85, Identities = 164/367 (44%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---------NLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y D+  +  N ++ +GYD S          +  ++ +QS +I   V             E D Q GAGDQG+++GYA+DE    MPLPIN+AH L +   +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   +S+      I +FVV+            L++D ++ ++N +G+F IGGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+    E+I + I   FD    + I   ++  PIY   + YGHFGR   +  WE+ D+V+ +
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADIPTLVRNKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYEKRVEGDEDELDKQ-GAGDQGLMFGYASDETPELMPLPINLAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLDSL--LAPDIREFVVEHVLKQLVEDGIKLDTDGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTATVDVEKIEQAIPQVFDLRPAAIIRDLDLLRPIYGQTAAYGHFGRELPDFTWERTDRVDAL 396
>gi|163859102|ref|YP_001633400.1| S-adenosylmethionine synthetase [Bordetella petrii DSM 12804] >gi|163262830|emb|CAP45133.1| metK [Bordetella petrii] (387 aa)
Score = 820, Expect = 1.1e-85, Identities = 162/365 (44%), Positives = 237/365 (64%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD    QDPN++VA E      L+V+ GEITT   VD +++A + +  +GYD +D+        ++   + QS +I   V++ ++     GAGDQG+++GYA DE  + MP PI  AH LV+   ++  + ++ +++ D KSQVT  Y D +  ++D +++S QH+   ++ +I E+    II     +  +    K ++N +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT    DEQI +++   FD   K  +   ++  PIY+  + YGHFGR E    WE  DK  E+
  S:     7 LFTSESVSEGHPDKVADQISDAILDAIFTQDPNARVAAETLCNTGLVVLAGEITTTANVDYIQVARDTIRRIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDRKSEDYLNQGAGDQGLMFGYACDETPDLMPAPIWYAHRLVQRQSELRKDGRLPWLRPDAKSQVTFRYVDGRPVEVDTVVLSTQHAPEISQSAIHEAVIEDIIKPSFPEGLITPRTKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVAEPINITVYTEGTGVIPDEQIAKLVREHFDLRPKGIVNMLDLLRPIYAKTAAYGHFGRAEPEFSWEATDKALEL 383
>gi|116328514|ref|YP_798234.1| S-adenosylmethionine synthetase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331242|ref|YP_800960.1| S-adenosylmethionine synthetase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281012|sp|Q04SB8|METK_LEPBJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|122283698|sp|Q050E4|METK_LEPBL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116121258|gb|ABJ79301.1| Methionine adenosyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124931|gb|ABJ76202.1| Methionine adenosyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (386 aa)
Score = 820, Expect = 1.1e-85, Identities = 176/361 (48%), Positives = 252/361 (69%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE------SDFTIIS-NVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM--RSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           I TSESVG+GHPDK+CDQISDA+LD  L+QDP S+VACE  A   L+VI GEIT+ G VD  ++A NV+  +GY++      +DF ++S +V++QS +I   V +   +    GAGDQG+++G+A +E   FMP+PI  +H+LVK    +  + K+ F++ D KSQVT++Y D +  ++D +++S QHS +   + IE    ++I+  +KK    NL  + K  IN +G+F +GGP GD GLTGRK++VDTYG   +HGGGAFSGKD +KVDRS AY  RYIAKN+VA+ LA KCEVQL++AIG ++P++  VDTFGT K S+E++ + I   F  + +  IE   +  +   Y   ++YGHFGR      WE+ DK
  S:     7 IFTSESVGEGHPDKVCDQISDAILDAYLEQDPKSRVACETLATTNLVVIAGEITSKGKVDAQEIARNVIRDIGYNDITMGFDADFAVVSAHVHAQSPDISQGVTEGEGLFKEQGAGDQGLMFGFAINETPEFMPMPIYYSHELVKHLAGLRHSNKLKFLRPDAKSQVTVEYKDGKPVRVDTVVISTQHSPDVAHKQIEE---SLIEECIKKVIPANLLVNTKYFINPTGQFIVGGPHGDAGLTGRKIIVDTYGGYGRHGGGAFSGKDPSKVDRSAAYMGRYIAKNVVASGLADKCEVQLAYAIGVAEPVSVHVDTFGTGKISEEELVKRIRANFKLTPRGIIESLKLLEKGRKYRETASYGHFGRKGSTFTWEKTDK 380
>gi|166710688|ref|ZP_02241895.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzicola BLS256] (403 aa)
Score = 820, Expect = 1.1e-85, Identities = 164/349 (46%), Positives = 238/349 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR 354
           + TSESV +GHPDKI DQISDAVLD  L QD  ++VACE      + ++ GE+TT+ ++D+  +   V++ +GY+ SD         +++ +  QS +I   V++ N  Q GAGDQG+++GYAT+E ++FMP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y D     ID +++S QH      K+ IE+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K +DEQI ++I   FD      I+  ++  P+Y   ++YGHFGR
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALAWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGR 365
>gi|21241583|ref|NP_641165.1| S-adenosylmethionine synthetase [Xanthomonas axonopodis pv. citri str. 306] >gi|58583414|ref|YP_202430.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|78046421|ref|YP_362596.1| S-adenosylmethionine synthetase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|84625228|ref|YP_452600.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188575335|ref|YP_001912264.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|24211980|sp|Q8PP75|METK_XANAC S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|75508078|sp|Q5GW76|METK_XANOR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892684|sp|Q3BXB7|METK_XANC5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892685|sp|Q2NZF1|METK_XANOM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21106939|gb|AAM35701.1| methionine adenosyltransferase [Xanthomonas axonopodis pv. citri str. 306] >gi|58428008|gb|AAW77045.1| methionine adenosyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|78034851|emb|CAJ22496.1| methionine adenosyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|84369168|dbj|BAE70326.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519787|gb|ACD57732.1| S-adenosylmethionine synthetase [Xanthomonas oryzae pv. oryzae PXO99A] (403 aa)
Score = 820, Expect = 1.1e-85, Identities = 164/349 (46%), Positives = 238/349 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR 354
           + TSESV +GHPDKI DQISDAVLD  L QD  ++VACE      + ++ GE+TT+ ++D+  +   V++ +GY+ SD         +++ +  QS +I   V++ N  Q GAGDQG+++GYAT+E ++FMP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y D     ID +++S QH      K+ IE+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K +DEQI ++I   FD      I+  ++  P+Y   ++YGHFGR
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGR 365
>gi|153954258|ref|YP_001395023.1| MetK1 [Clostridium kluyveri DSM 555] >gi|146347139|gb|EDK33675.1| MetK1 [Clostridium kluyveri DSM 555] (403 aa)
Score = 820, Expect = 1.2e-85, Identities = 182/374 (48%), Positives = 261/374 (69%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---------EKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYN----LNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSK-YSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + ++ TSESV +GHPDKICDQISDA+LD  +++D N +VACE      ++++ GEI+T  Y+D+ K+    +  +GY  S F        II++++ QS++I   V         EKDN   IGAGDQG+V+G+AT+E   ++PLPI +AH L K   +V  N  I ++  D K+QVT++Y   +  +ID +++S QH  N + + IE     IID V+K       L+S  K +IN +G+F  GGP  D+GLTGRK++VD+YG   +HGGGAFSGKD TKVDRSGAY AR++AKN+VAA +A K E+++++AIG + P++ +VDTFGT K  SD+QI EII   FD    + I++ N+R PIY   + YGHFGRT+++  WE+ DKV+EI    KK
  S:     1 MSRLFTSESVTEGHPDKICDQISDAILDAIIEKDENGRVACETVVNTGIVILVGEISTRAYIDIPKIVRKTISDIGYSNSKFGFDAASCAIITSIDEQSSDIALGVNDSLESRNGEKDNIEAIGAGDQGIVFGFATNETPEYLPLPIVLAHKLAKKLSEVRKNNIIPYLGPDGKTQVTVEYEKGKPVRIDTVLVSSQHEDNVSYDEIE---KDIIDKVIKAAIPSGLLDSHTKYLINPTGRFVKGGPEADSGLTGRKIIVDSYGGYGRHGGGAFSGKDPTKVDRSGAYAARWVAKNLVAAGIADKIEIEIAYAIGVASPVSVSVDTFGTGKTISDDQIVEIINEVFDLRPAAIIKELNLRRPIYKNTAAYGHFGRTDIDAPWERFDKVDEIKNIYKK 394
>gi|123965579|ref|YP_001010660.1| S-adenosylmethionine synthetase [Prochlorococcus marinus str. MIT 9515] >gi|158512728|sp|A2BUU2|METK_PROM5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123199945|gb|ABM71553.1| S-adenosylmethionine synthetase [Prochlorococcus marinus str. MIT 9515] (413 aa)
Score = 820, Expect = 1.2e-85, Identities = 177/372 (47%), Positives = 253/372 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEK--------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH--------SQNATKESI--ESFCNAII----DFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLD-KVEEILEFTKKY 377
           I TSESV +GHPDKICDQISDAVLD  LK+DP S+VACE      L ++ GEIT+   +D +K+   V+  +GY        D +   ++  ++ QS +I   V +        +N  GAGDQG+++GYA DE    MPLPI++AH L +   +V     ++++  D K+QV+IDY       I+ I++S QH        ++   ++ I  + + N ++    D  +K     + F  ++N +GKF +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AK+IV AKLAKK EVQLS+AIG +KPI+  VDTFGTS  S + + E+I N FD    + I++F++R+         Y   ++YGHFGR +LN  WE ++ K  +++E +K +
  S:     5 IFTSESVTEGHPDKICDQISDAVLDALLKEDPESRVACETVVNTGLCLLTGEITSRAKLDYIKLVRKVIKEIGYEGAKAGGFDSNSCAVLVALDEQSPDISQGVNEADDLNEDLENNTGAGDQGIMFGYACDETPELMPLPISLAHRLARQLAKVRHENVLEYLLPDGKTQVSIDYKKGVPVSINTILISTQHRAEIDGIINEKEIRQKITDDLWINVVLPVTEDLEIKPSKEKTRF--LVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVDTFGTSVISQDNLKELIENNFDLRPAAIIKEFDLRNLPKKLGGEFYRKTASYGHFGRNDLNLPWESVEVKAAQLVEASKDF 412
>gi|16273096|ref|NP_439330.1| S-adenosylmethionine synthetase [Haemophilus influenzae Rd KW20] >gi|1170942|sp|P43762|METK_HAEIN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|1574099|gb|AAC22825.1| S-adenosylmethionine synthetase (metX) [Haemophilus influenzae Rd KW20] (384 aa)
Score = 820, Expect = 1.2e-85, Identities = 167/365 (45%), Positives = 251/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGK+ +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG ++P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+ E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQSEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPSEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKEPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVAEPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAEDL 377
>gi|183222316|ref|YP_001840312.1| S-adenosylmethionine synthetase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189912364|ref|YP_001963919.1| Methionine adenosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777040|gb|ABZ95341.1| Methionine adenosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780738|gb|ABZ99036.1| S-adenosylmethionine synthetase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (388 aa)
Score = 820, Expect = 1.2e-85, Identities = 175/365 (47%), Positives = 248/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE------SDFTII-SNVNSQSNEIFNAVEKDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM--RSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           I TSESV +GHPDK+CDQISDA+LD  L QDP S+VACE      L+VI GEIT+ G VD  ++A +V+  +GY++      +DF ++ S+V++QS +I   V +   +    GAGDQG+++G+A  E    MP P+  +H L++   ++    KID+++ D KSQVTI Y D +  ++D +++S QH    T + IE    A+I+  +KK     L  + +  IN +GKF IGGP GDTGLTGRK++VDTYG + +HGGGAFSGKD +KVDRS AY  RYIAKN+VAA LA KCEVQL++AIG ++P++  VDTFGT   SDE+I + ++  F  + K  +E  ++  +   Y   + YGHFGRT     WE+ DK + +
  S:     8 IFTSESVSEGHPDKVCDQISDAILDAYLAQDPKSRVACETLVTTNLVVIAGEITSKGKVDTQEIARDVIRKIGYNDINMYFDADFAVVASHVHAQSPDIAQGVNEGEGLHTEQGAGDQGLMFGFAIAETPELMPAPLYYSHKLLEHLAELRHTNKIDWLRPDAKSQVTIQYEDGKPKRVDTVVISTQHKPGVTHKQIEE---AVIEECIKKMIPKELLVNTRYFINPTGKFEIGGPHGDTGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMGRYIAKNVVAAGLAHKCEVQLAYAIGVAQPVSVLVDTFGTGTISDEEIAKRVLANFKLTPKGIVEGLDLLGKGRTYQETAAYGHFGRTGSTFTWEKTDKADAL 385
>gi|145627851|ref|ZP_01783652.1| S-adenosylmethionine synthetase [Haemophilus influenzae 22.1-21] >gi|144979626|gb|EDJ89285.1| S-adenosylmethionine synthetase [Haemophilus influenzae 22.1-21] (384 aa)
Score = 820, Expect = 1.3e-85, Identities = 168/365 (46%), Positives = 249/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+  E+
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPSEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLCPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAAEL 377
>gi|145633097|ref|ZP_01788829.1| S-adenosylmethionine synthetase [Haemophilus influenzae 3655] >gi|145637076|ref|ZP_01792739.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittHH] >gi|144986323|gb|EDJ92902.1| S-adenosylmethionine synthetase [Haemophilus influenzae 3655] >gi|145269730|gb|EDK09670.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittHH] (384 aa)
Score = 819, Expect = 1.5e-85, Identities = 168/365 (46%), Positives = 249/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D+  E+
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPTEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDRAAEL 377
>gi|28199552|ref|NP_779866.1| S-adenosylmethionine synthetase [Xylella fastidiosa Temecula1] >gi|182682288|ref|YP_001830448.1| methionine adenosyltransferase [Xylella fastidiosa M23] >gi|32129723|sp|Q87AY6|METK_XYLFT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|28057667|gb|AAO29515.1| methionine adenosyltransferase [Xylella fastidiosa Temecula1] >gi|182632398|gb|ACB93174.1| Methionine adenosyltransferase [Xylella fastidiosa M23] (403 aa)
Score = 819, Expect = 1.5e-85, Identities = 169/363 (46%), Positives = 247/363 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR-------TELNP--------GWEQLDKVE 368
           + TSESV +GHPDK+ DQISDAVLD  L QDP ++VACE      + +I GEITT+ +VD+  +   V++ +GY+ SD         +++ +  QS +I   V+  K  + GAGDQG+++GYAT+E +++MP  I+I+H LV+   ++    N+ + +++ D K+Q+T+ Y D     ID +++S QH      K+ +E+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS +Y  RY+AKN+VAA LA +CEVQ+S+AIG ++PI+ +V TFGT K  D++I ++I   FD      I+  ++  PIY P ++YGHFGR       T  N          WE++DK E
  S:     5 LFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSLLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKIPDDKIEKLICQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPRELAYTNSNGERVVATAFSWEKIDKAE 394
>gi|70780020|gb|AAZ08331.1| AdoMet synthetase [synthetic construct] (384 aa)
Score = 819, Expect = 1.5e-85, Identities = 166/363 (45%), Positives = 241/363 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES----DF---TIISNVNSQSNEIFNAVEKDNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQN---PK-IDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESVG+GHPDKICDQ+SDA+LD CL+QDP SKVACE  A   +I++ GEITT   +D  ++  + +  +GYD+S    D+    ++  +  QS +I   +  +  +   GAGDQG+++GYAT+E    +PL I +AH L         +  + +++ D K+QVT++Y D      PK ID +++S QH+   +   + +     I++ V+ K  L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  V+TFGT K   EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+  K+E
  S:     8 LFTSESVGEGHPDKICDQVSDAILDACLEQDPFSKVACETAAKTGMIMVFGEITTKARLDYQQIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGLHYEKSLEDLGAGDQGIMFGYATNETPEGLPLTILLAHKLNMAMADARRDGSLPWLRPDTKTQVTVEYEDDNGRWVPKRIDTVVISAQHADEISTADLRTQLQKDIVEKVIPKDMLDENTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKESAAYGHFGREHFP--WEKPKKLE 383
>gi|30248670|ref|NP_840740.1| S-adenosylmethionine synthetase [Nitrosomonas europaea ATCC 19718] >gi|33301253|sp|Q82WL2|METK_NITEU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|30180265|emb|CAD84570.1| S-adenosylmethionine synthetase [Nitrosomonas europaea ATCC 19718] (387 aa)
Score = 819, Expect = 1.5e-85, Identities = 170/365 (46%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAV--EKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATK-ESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD  L+QDP+++VACE   +  LIV+ GEITT   +D   +   ++  +GY       D S   +++  N QS +I   V   KD ++  GAGDQG+++GYA DE    MPLPI  AH LV+   ++  + ++ +++ D KSQV++ Y D     I+ I++S QHS +  + E +E     +I  V+    L++  + +IN +G+F +GGP+GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA+KCEVQ+++AIG +KP++  V TFGT K  D ++ E+I   FD   ++ I + ++  PIY   + YGHFGR E +  WE+ D  E++
  S:     5 LFTSESVSEGHPDKVADQISDAILDAILQQDPHARVACETMCSTGLIVLSGEITTDATIDYNAIPRGIVREIGYTSSEIGFDASTCAVLTAFNKQSPDIAQGVNRSKDEEMDQGAGDQGLMFGYACDETPQLMPLPIYYAHRLVEQQAKLRKSGRLSWLRPDAKSQVSVRYEDGFPKNIETIVISTQHSPDVPRDELVEGVIEEVIKPVLPAEMLSNHIQYLINPTGRFVVGGPMGDCGLTGRKIIVDTYGGTAHHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLARKCEVQVAYAIGVAKPVSLMVQTFGTGKIPDGKLAELIARHFDLRPRAIIHELDLLRPIYGKTAAYGHFGREEPSFTWEKTDMAEQL 381
>gi|119510683|ref|ZP_01629811.1| S-adenosylmethionine synthetase [Nodularia spumigena CCY9414] >gi|119464637|gb|EAW45546.1| S-adenosylmethionine synthetase [Nodularia spumigena CCY9414] (420 aa)
Score = 819, Expect = 1.6e-85, Identities = 175/368 (47%), Positives = 245/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY------------------DESDFTIISNVN-SQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAII-----DFVVKKYNLNSDFKR------IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISD +LD  L +DP+S+VA EV     L++I GEIT+  + + V +A   +  +GY                  DE    I   VN +Q     N+ E  + +GAGDQG+++G+A +E    MPLPI++AH L +    V    K+ +++ D K+QVT+ Y D     ID I++S QH+++  + + E+   A I       VV+    + D K       ++N +GKF IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+KCEVQLS+AIG ++P++  ++TFGT K  DE + E++ + F+      I  FN+R+         Y   + YGHFGR +L+  WE+ DKVE
  S:     1 MSKRYLFTSESVTEGHPDKICDQISDTILDTLLTEDPSSRVAAEVVVNTGLVLITGEITSKTHANYVNIARQKIAEIGYIDAVNGFSAGSASVLVALDEQSPDIAQGVNKAQETRQQNSEELFDAVGAGDQGIMFGFACNETPELMPLPISLAHRLARRLAAVRKTGKLPYLRPDGKTQVTVAYEDGYPVGIDTILISTQHTESIGEITEEAAIQAKIKEDLWSTVVEPAFADIDIKPSQETRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYMAKNIVAAGLAQKCEVQLSYAIGVARPVSIFLETFGTGKLDDETLLELVKDQFELRPAGIIHAFNLRNLPSERGGRFYQDIAAYGHFGRNDLDLPWERTDKVE 405
>gi|187476673|ref|YP_784696.1| S-adenosylmethionine synthetase [Bordetella avium 197N] >gi|115421259|emb|CAJ47764.1| S-adenosylmethionine synthetase [Bordetella avium 197N] (387 aa)
Score = 819, Expect = 1.7e-85, Identities = 160/365 (43%), Positives = 240/365 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ----IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDK+ DQISDA+LD    QDPN++VA E      L+V+ GEITT+  VD +++A + +  +GYD +++        ++   + QS +I   V++ ++     GAGDQG+++GYA DE  + MP PI  AH LV+   ++  + ++ +++ D KSQVT  Y D +  ++D +++S QH+   ++ +I E+    II     +  +    K ++N +G+F IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA++C+VQ+S+AIG ++PI   V T GT    D+Q+ +++   FD   K  +   ++  PIY+  + YGHFGR+E    WE  DKV+ +
  S:     7 LFTSESVSEGHPDKVADQISDAILDAIFTQDPNARVAAETLCNTGLVVLAGEITTSANVDYIQVARDTIRRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRSSEDYLNQGAGDQGLMFGYACDETPDLMPAPIWYAHRLVQRQSELRKDGRLPWLRPDAKSQVTFRYVDGRPVEVDTVVLSTQHAPEISQSAIREAVIEDIIKPCFPEGLITPQTKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLARQCQVQVSYAIGVAEPINITVYTEGTGVIPDDQLAKLVREHFDLRPKGIVNMLDLLRPIYTKTAAYGHFGRSEPEFSWEATDKVQAL 383
>gi|90415445|ref|ZP_01223379.1| S-adenosylmethionine synthetase [marine gamma proteobacterium HTCC2207] >gi|90332768|gb|EAS47938.1| S-adenosylmethionine synthetase [marine gamma proteobacterium HTCC2207] (384 aa)
Score = 819, Expect = 1.8e-85, Identities = 173/362 (47%), Positives = 246/362 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKV 367
           I TSESV +GHPDK+ DQISDAVLD  LK DP+S+VA E      + +I GE+ T  YVD+ ++  +V+  +GYD S+         +++ +  QS++I   V+  +D  IGAGDQG+++GYA++E    MP PI  AH LV+   Q+  N  + +++ D KSQVT+ Y + +   ID +++S QH+ N A  +  ++    II  V+ +  L++  +  IN +G+F IGGP+GD GLTGRK++VDTYG +A HGGGAFSGKD TKVDRS AY  RY+AKNIVAA LA +CE+Q+S+AIG S+P + +V+TFGT K  DE+I  ++ + FD   +  IE  ++R PIY   ++YGHFGR   N  WE+ DKV
  S:     6 IFTSESVSEGHPDKMADQISDAVLDAILKDDPHSRVAVETLVKTGMTIIAGEVRTDTYVDLEQIVRDVITGIGYDSSEVGFDGNSCAVLNAIGKQSSDIAQGVDEAQDKDIGAGDQGLMFGYASNETSVLMPAPIYYAHRLVERQAQLRKNGVLPWLRPDAKSQVTLRYENGKPVAIDAVVLSTQHAPNIALPDLQDAVREEIIKHVLPEEWLHAGTQYHINPTGQFIIGGPMGDCGLTGRKIIVDTYGGMAHHGGGAFSGKDPTKVDRSAAYAGRYVAKNIVAAGLADRCEIQVSYAIGVSEPTSISVNTFGTGKLRDEEIVALVRDNFDLRPRGLIEMLDLRRPIYQQTASYGHFGRELENFTWEKTDKV 377
>gi|148826217|ref|YP_001290970.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittEE] >gi|166201393|sp|A5UCT6|METK_HAEIE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|148716377|gb|ABQ98587.1| S-adenosylmethionine synthetase [Haemophilus influenzae PittEE] (384 aa)
Score = 818, Expect = 1.8e-85, Identities = 168/365 (46%), Positives = 249/365 (68%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLDE LKQDP ++VACE +    + ++GGEITT+ +VD+  +   V+  +GY+ S+         +++ +  QS +I   V+++N +  GAGDQG+++GYAT+E +  MP  I  AH L++   +V  + K+ +++ D KSQVT+ Y D++   +D +++S QHS+  +++ + E     II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K ++E +  ++   FD      I+  ++  PIY   + YGHFGR +    WE++D  E++
  S:     5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQGIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVGVDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPTEWLSKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGHFGREQFP--WEKVDHAEDL 377
>gi|29833416|ref|NP_828050.1| S-adenosylmethionine synthetase [Streptomyces avermitilis MA-4680] >gi|33301251|sp|Q827Q0|METK_STRAW S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|29610539|dbj|BAC74585.1| putative S-adenosylmethionine synthetase [Streptomyces avermitilis MA-4680] >gi|76097024|gb|ABA39296.1| S-adenosylmethionine synthetase [Streptomyces avermitilis] (402 aa)
Score = 818, Expect = 1.9e-85, Identities = 163/367 (44%), Positives = 249/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIF--------NAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES----------IESFCNAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y  + ++  + ++ +GYD S          +  ++ SQS +I         N VE D    ++ GAGDQG+++GYATDE    MPLPI++AH L     +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   +S          +E    A++D  +K   L ++ ++ ++N +G+F IGGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+K   ++I + I   FD    + I   ++  PIYS  + YGHFGR   +  WE+ D+V+ +
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYAPIAQLVRDKILEIGYDSSKKGFDGASCGVSVSIGSQSPDIAQGVDTAYENRVEGDEDELDRQGAGDQGLMFGYATDETPTLMPLPIHLAHRLSHRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLDSLLAPDIREFVVEPELKALLDDGIK---LETEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTAKVEADKIEQAIATVFDLRPAAIIRDLDLLRPIYSQTAAYGHFGRELPDFTWERTDRVDAL 396
>gi|188590969|ref|YP_001795569.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Cupriavidus taiwanensis] >gi|170937863|emb|CAP62847.1| methionine adenosyltransferase 1 (AdoMet synthetase) [Cupriavidus taiwanensis] (403 aa)
Score = 817, Expect = 2.4e-85, Identities = 164/361 (45%), Positives = 236/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VA E      L+V+ GEITT   VD +++A + +  +GYD +D+        ++   + QS +I   V++      NQ GAGDQG+++GYA DE    MP PI  AH LV+    +  + ++ +++ D KSQVT+ Y D +   +D +++S QH+ + T+  I     A+I+ ++K      +  + K ++N +G+F IGGP GD GLTGRK++VDTYG  + HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT K  D +I E++   FD   K  ++  ++  PIY   + YGHFGR E    WE  DK
  S:    22 LFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQIARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQ-GAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGKPHSVDTVVLSTQHAPDITQAQIRE---AVIEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINVTVYTEGTGKIPDAKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDK 393
>gi|195961926|ref|ZP_03098131.1| S-adenosylmethionine synthetase [Borrelia spielmanii A14S] (392 aa)
Score = 817, Expect = 2.7e-85, Identities = 179/372 (48%), Positives = 252/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVK-----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDT-FGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK D N+KVACEV  A  L+V+ GEI +     +D+ ++A N++  +GY   D+       T+I  V +QS +I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I +++ D KSQVT++Y  ++ P KI  I++S QH  N +K+ +      II+ ++K     K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +       KY +E I   I+N FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEMLKIDKNAKVACEVIIAQNLVVVAGEINSPVKKAIDIKEIAKNIIKDIGYTNIDYGLDYKTTTVIDAVGNQSRDIINAIEKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKQASNLRKSGAIKWLRPDSKSQVTMEYDKNRRPIKIKNIVVSHQHHPNISKKLMR---QTIIEEIIKPAIQDKSILDENTTYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISIQITAGINDPKYENE-ILNFIINNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTVLKK 392
>gi|113866261|ref|YP_724750.1| S-adenosylmethionine synthetase [Ralstonia eutropha H16] >gi|123134518|sp|Q0KF39|METK_RALEH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|113525037|emb|CAJ91382.1| S-Adenosylmethionine synthetase [Ralstonia eutropha H16] (387 aa)
Score = 817, Expect = 2.8e-85, Identities = 164/361 (45%), Positives = 236/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VA E      L+V+ GEITT   VD +++A + +  +GYD +D+        ++   + QS +I   V++      NQ GAGDQG+++GYA DE    MP PI  AH LV+    +  + ++ +++ D KSQVT+ Y D +   +D +++S QHS + T+  I     A+I+ ++K      +  + K ++N +G+F IGGP GD GLTGRK++VDTYG  + HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ LA++C+VQ+S+AIG ++PI   V T GT K  D +I E++   FD   K  ++  ++  PIY   + YGHFGR E    WE  DK
  S:     6 LFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQIARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQ-GAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGKPHSVDTVVLSTQHSPDITQAQIRE---AVIEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVASGLARQCQVQVSYAIGVARPINVTVYTEGTGKIPDAKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDK 377
>gi|118047187|ref|ZP_01515828.1| Methionine adenosyltransferase [Chloroflexus aggregans DSM 9485] >gi|117996355|gb|EAV10555.1| Methionine adenosyltransferase [Chloroflexus aggregans DSM 9485] (403 aa)
Score = 816, Expect = 3.3e-85, Identities = 159/367 (43%), Positives = 247/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEIT-TAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R   TSESV +GHPDK+CDQISDA+LD  L  DP ++VA E      LIV+ GE+T   GY+ + ++    +  +GY  +++        ++  ++ QS +I   V+K               +GAGDQG+++G+A DE    MP  I +AH L++  E+V  +  + +++ D KSQVT++Y+  +  ++D +++S QH+ + T+E I +     +I   + +  L++  K  IN +G+F IGGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA++ E+Q+S+AIG ++P++ +V+TFGT    DE I + I   FD    + I   ++R PIY   +  GHFGRT+++  WE+ ++VEE+
  S:    10 RFYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTNAEYGFDADTCGVMVAIHGQSPDIAMGVDKALEAKIGAMQDDVEAVGAGDQGMMFGFACDETPELMPASIALAHRLIRRLERVRKDGTLPYLRPDAKSQVTVEYSFGKPVRVDTVLISSQHAPDVTQEQIRADLIEHVIKTEIPEAWLDTQTKIFINPTGRFVIGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDPSKVDRSAAYACRWVAKNIVAAGLARRVELQVSYAIGVARPLSLSVETFGTGTVPDEVILKAINEVFDLRPGAIIRDLDLRRPIYRKTAAGGHFGRTDIDLPWERTNRVEEL 397
>gi|171464279|ref|YP_001798392.1| methionine adenosyltransferase [Polynucleobacter necessarius STIR1] >gi|171193817|gb|ACB44778.1| Methionine adenosyltransferase [Polynucleobacter necessarius STIR1] (388 aa)
Score = 816, Expect = 3.4e-85, Identities = 169/359 (47%), Positives = 240/359 (66%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           TSESV +GHPDK+ DQISD++LD  L QDP ++VA E      L+V+ GEITT   VD +++A N L  +GYD +D+        ++   + QS +I   V+K  D+ +  GAGDQG+++GYA DE    MPLPI+++H LV+   Q+  + ++++++ D KSQVT+ Y D +   ID +++S QH ++ + E + E+    II  V+ K+ +      ++N +G+F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY  RY+AKN+VAA LA KC +Q+S+AIG +KP +  V  FGT K  DE+I +++   FD   K  ++  N+  PIY   + YGHFGR E    WEQ DK
  S:     8 TSESVSEGHPDKVADQISDSILDAILAQDPTARVAAETLCNTGLVVLAGEITTNANVDYIQVARNTLREIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDKAHDDGLDQGAGDQGLMFGYACDETAELMPLPIHLSHRLVERQSQLRRDGRLNWLRPDAKSQVTLRYVDGKPDSIDTVVLSTQHDEDISLEKLREAVIEEIIKPVLPKHLIKGAINFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAGRYVAKNVVAAGLASKCLIQISYAIGVAKPTSVMVSAFGTGKIVDEKIAQLVSEHFDLRPKGIVKMLNLLRPIYKKTAAYGHFGREEPEFSWEQTDK 378
>gi|82703656|ref|YP_413222.1| S-adenosylmethionine synthetase [Nitrosospira multiformis ATCC 25196] >gi|109892643|sp|Q2Y5Z1|METK_NITMU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|82411721|gb|ABB75830.1| methionine adenosyltransferase [Nitrosospira multiformis ATCC 25196] (399 aa)
Score = 816, Expect = 3.4e-85, Identities = 163/367 (44%), Positives = 245/367 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV----EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + TSESV +GHPDK+ DQISD++LD  L QDPN++VACE   +  LIV+ GEITT   VD +++A   +  +GY+ SD         +++  N QS +I   V    E++   GAGDQG+++GYA DE    MP+PI  AH L++   ++  + ++ +++ D KSQV++ Y D +  +I+ +++S QH  + +   + E+    +I  V+ K  L+ + + +IN +G+F +GGP+GD GLTGRK++VD+YG  A HGGGAFSGKD +KVDRS AY  RY+AKN+VAA +A +CEVQ+++AIG ++P++  VDTFGT K  D++I ++I   FD   +  I   ++  PIY   + YGHFGR E    WE  DK  ++ E
  S:     5 LFTSESVSEGHPDKVADQISDSILDAILAQDPNARVACETLCSTGLIVMSGEITTQANVDYMQVARAAVKRIGYNSSDIGFDYNTCAVLTAFNKQSPDIARGVNRTKEEEMDQGAGDQGLMFGYACDETPQLMPMPIYYAHRLMERQAELRKDGRLPWLRPDAKSQVSVRYLDGKPQRIETVVISTQHHPDISHTDLSEAIIEEVIKPVLPKKMLSGETRYLINPTGRFVVGGPMGDCGLTGRKIIVDSYGGTAHHGGGAFSGKDPSKVDRSAAYAGRYVAKNLVAAGIASRCEVQMAYAIGVARPVSLMVDTFGTGKIPDDKIVKLIERHFDLRPRGIIHGLDLLRPIYEKTAAYGHFGRDEPEFSWESTDKAAQLRE 383
>gi|163840698|ref|YP_001625103.1| S-adenosylmethionine synthetase [Renibacterium salmoninarum ATCC 33209] >gi|162954174|gb|ABY23689.1| S-adenosylmethionine synthetase [Renibacterium salmoninarum ATCC 33209] (408 aa)
Score = 815, Expect = 4.1e-85, Identities = 158/369 (42%), Positives = 247/369 (66%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           ++ TSESV +GHPDKICDQISD++LD  L  DPNS+VA E  A   L+ + GE+TT  YV++ ++    ++ +GYD S          +  ++  QS +IF+ V            +  +  GAGDQG+++GYA+DE   FMP PI +AH L +   +V  N ++ +++ D K+QVTI Y   +   ++ +++S QH++NA+ + +       +ID V+    L+ +  K I+N +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA++ E+Q+++AIG ++P+   V+TFGT     ++I + I+  FD   ++ I   +++ PIY+  + +GHFGR E    WE  ++V+ +  +
  S:    16 RLFTSESVTEGHPDKICDQISDSILDALLAADPNSRVAVETLATTGLVHVAGEVTTDAYVEIPQIVRETILNIGYDSSANGFDGARCGVSVSIGQQSPDIFDGVFNSLEAREGTNVDAYDLQGAGDQGIMFGYASDETATFMPTPIFLAHRLSERLSEVRKNGQLPYLRPDGKTQVTIGYDGDRPVSVETVVISSQHAENASLDQLRLDLAELVIDPVLSASGLDIERTKNILNPAGAFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLARRAEIQVAYAIGQARPVGTYVETFGTETVDPQKISDAILEIFDLRPQAIINDLDLKRPIYAKTAAHGHFGREEPEFTWELTNRVDALRSY 405
>gi|116492411|ref|YP_804146.1| S-adenosylmethionine synthetase [Pediococcus pentosaceus ATCC 25745] >gi|122266125|sp|Q03GG8|METK_PEDPA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116102561|gb|ABJ67704.1| methionine adenosyltransferase [Pediococcus pentosaceus ATCC 25745] (396 aa)
Score = 815, Expect = 4.5e-85, Identities = 176/375 (46%), Positives = 256/375 (68%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           M  R + TSESV +GHPDKI DQISD++LDE LK DP+++VACE      L+V+ GEI+T  Y+D+ K+    +  +GY       D  +  +I  ++ QS +I   V+             NQIGAGDQG+++GYAT+E E  MPLPI ++H L++   ++     I +++ D K++VT++Y D+ +P ++D +++S QH  + T E I +     +I  V+    L+ +    IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAAKLA++ EVQ+++AIG ++P++  VDTFGT   S+E++ + +   FD      IE  +++ PIY   + YGHFGRT++   WE+ DKVE + +F K
  S:     1 MSERHLFTSESVSEGHPDKIADQISDSILDELLKNDPDARVACETTVTTGLVVVVGEISTTAYIDIQKVVRKTIKDIGYVGGEYGFDGENCAVIVAIDEQSPDIAQGVDDSLETREGHEDRLNQIGAGDQGLMFGYATNETEELMPLPIMLSHHLMQRIAKLRKEQVISYLRPDAKAEVTVEYDDNDHPVRVDTVVLSTQHDPDVTLEQIRQDVIEQVIKAVIPATLLDENTNFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGAARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAKLAERVEVQIAYAIGVAEPVSVMVDTFGTGTVSEEKLTQAVRKIFDLRPAGIIEMLDLKRPIYKQTAAYGHFGRTDVELPWEKTDKVEALNDFFK 395
>gi|21219978|ref|NP_625757.1| S-adenosylmethionine synthetase [Streptomyces coelicolor A3(2)] >gi|22095913|sp|Q9L0Y3|METK_STRCO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|7209236|emb|CAB76898.1| S-adenosylmethionine synthetase [Streptomyces coelicolor A3(2)] (402 aa)
Score = 815, Expect = 4.8e-85, Identities = 165/369 (44%), Positives = 248/369 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIF--------NAVEKD----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVK---KYNL-------NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y D+  +    ++ +GYD S          +  ++ +QS +I         N VE D    ++ GAGDQG+++GYA+DE    MPLP+ +AH L K   +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   ES+      I +FVV+   K  L         +++ ++N +G+F IGGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+K   E+I + I   FD    + I   ++  PIY+  + YGHFGR   +  WE+ D+V+ + E
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADIANLVRGKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYENRVEGDEDELDRQGAGDQGLMFGYASDETPTLMPLPVFLAHRLSKRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLESL--LAPDIKEFVVEPELKALLEDGIKIDTENYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAKVDTEKIEKAIDEVFDLRPAAIIRALDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDALRE 398
>gi|188527002|ref|YP_001909689.1| S-adenosylmethionine synthetase [Helicobacter pylori Shi470] >gi|188143242|gb|ACD47659.1| S-adenosylmethionine synthetase [Helicobacter pylori Shi470] (385 aa)
Score = 815, Expect = 4.9e-85, Identities = 168/371 (45%), Positives = 243/371 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + TSESV +GHPDK+ DQISDAVLD  +++D  +KVACE   AN   +I GE+ T+ Y  + ++A  V+  +GY ++ +        +++ V  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI++AH L     Q   +  + F++ D KSQV++ Y +++   ID I++S QHS   +++ + ES    I+  V+ K  L+ + K  +N +GKF IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ +  K  VQL++AIG  +P++  V+T  TSKYS  ++ + + + F  + K  IE  ++  PIYS  S YGHFGR      WE+ +K EEI  F K+
  S:     6 LFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACETLVANGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGVGEQSPDINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLTFALAQKRKDNTLPFLRPDGKSQVSVRYENNKPVSIDTIVISTQHSPEVSQKHLKESVIEEIVYKVLPKEYLHDNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSVYVNTHNTSKYSSAELEKCVKSVFKLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKAEEIQAFFKR 385
>gi|90580294|ref|ZP_01236101.1| S-adenosylmethionine synthetase [Vibrio angustum S14] >gi|90438596|gb|EAS63780.1| S-adenosylmethionine synthetase [Vibrio angustum S14] (384 aa)
Score = 815, Expect = 4.9e-85, Identities = 174/370 (47%), Positives = 246/370 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  ++QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E FMP PI  +H LV+   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS + +T +  E+    II  V+ +  LN + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K + E I E +   FD       E  ++  PIY   + YGHFGR E    WE+ DKV  + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAIIEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVMNTIGKQSPDINQGVDKTDPKEQGAGDQGIMFGYATNETEVFMPAPITYSHRLVQRQAEVRKNGTLPWLRPDAKSQVTFAYDQGKIVGIDAVVLSTQHSDSISTSDLREAVMEEIIKPVLPEEWLNKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVAHEIIIEAVRQHFDLRPYGLQEMLDLLQPIYKKTAAYGHFGREEFP--WEKTDKVAALRDF 380
>gi|186683037|ref|YP_001866233.1| S-adenosylmethionine synthetase [Nostoc punctiforme PCC 73102] >gi|186465489|gb|ACC81290.1| S-adenosylmethionine synthetase [Nostoc punctiforme PCC 73102] (424 aa)
Score = 815, Expect = 5.1e-85, Identities = 174/368 (47%), Positives = 246/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNS-------QSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESI-ESFCNAIIDFVVKKYNL--NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISD +LD  L QDP+S+VA EV     L++I GEITT   V+ V +A   +  +GY  +D    +N  S       QS +I   V            E  ++IGAGDQG+++G+A++E    MPLPI++AH + +    V    ++ +++ D K+QVT+ Y D +   ID I++S QH+        + A +  I +   +A+++ V    ++  N   + ++N +GKF +GGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+K E+QLS+AIG ++P +  VDTFGT K  +E + E+I   F+      I  FN+R+         Y   + YGHFGR +L+  WEQ DK E
  S:     1 MSRRYLFTSESVTEGHPDKICDQISDTILDALLTQDPSSRVAAEVVVNTGLVLITGEITTKANVNFVNLARKKIAEIGYTNADNGFSANSTSVLLALDEQSPDIAQGVNTAQETRQQDSDELFDKIGAGDQGIMFGFASNETPELMPLPISLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTILISTQHTATIGEITDEAAVQAKIKQDLWSAVVEPVFGDIDVKPNDQTRFLVNPTGKFVVGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKVEIQLSYAIGVARPTSILVDTFGTGKVDEETLLELINQHFELRPAGIIHTFNLRNLPSERGGRFYQDVAAYGHFGRADLDLPWEQTDKAE 405
>gi|148980478|ref|ZP_01816075.1| S-adenosylmethionine synthetase [Vibrionales bacterium SWAT-3] >gi|145961203|gb|EDK26517.1| S-adenosylmethionine synthetase [Vibrionales bacterium SWAT-3] (384 aa)
Score = 814, Expect = 5.2e-85, Identities = 174/370 (47%), Positives = 241/370 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  +H LVK   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    +N D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K + E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDADSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEILMPAPITYSHLLVKKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPELREAVMEEIIKPVLPSEWINKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVAHEIIIEAVRQNFDLRPYGLQEMLNLLQPIYKQTAAYGHFGREEFP--WEATDKAAILADF 380
>gi|89074098|ref|ZP_01160597.1| S-adenosylmethionine synthetase [Photobacterium sp. SKA34] >gi|89050034|gb|EAR55560.1| S-adenosylmethionine synthetase [Photobacterium sp. SKA34] (384 aa)
Score = 814, Expect = 5.3e-85, Identities = 174/370 (47%), Positives = 245/370 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  ++QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E FMP PI  +H LV+   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS + +T +  E+    II  V+    LN + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K + E I E +   FD       E  ++  PIY   + YGHFGR E    WE+ DKV  + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAIIEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVMNTIGKQSPDINQGVDKTDPKEQGAGDQGIMFGYATNETEVFMPAPITYSHRLVQRQAEVRKNGTLPWLRPDAKSQVTFAYDQGKIVSIDAVVLSTQHSDSISTSDLREAVMEEIIKPVLPSEWLNKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVAHEIIIEAVRQHFDLRPYGLQEMLDLLQPIYKKTAAYGHFGREEFP--WEKTDKVAALRDF 380
>gi|94984395|ref|YP_603759.1| S-adenosylmethionine synthetase [Deinococcus geothermalis DSM 11300] >gi|189081712|sp|Q1J1P4|METK_DEIGD S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|94554676|gb|ABF44590.1| Methionine adenosyltransferase [Deinococcus geothermalis DSM 11300] (408 aa)
Score = 814, Expect = 5.7e-85, Identities = 162/368 (44%), Positives = 250/368 (67%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT-AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD------------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTI----DYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK  TSESV +GHPDK+ D ISD++LDE L+Q+P S+VA E      + V+ GE+   + +VDV K+    +  +GY  +++        ++ +++ QS EI   V++                   +++GAGDQG+++GYATDE    MPLPI++AH L +   ++  +  + +++ D K+QVT+    +  ++    +D I++S QHS++ ++E IE+     ++  V+    L  + K  IN SG+F IGGP GDTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY+ARYIAKNIVAA LA++  V++++AIG + P++  VDT+GT   SDE++ +++   FD   ++ I + +++ PIY+  + YGHFGR E    WEQ +K E +
  S:     1 MRKFYTSESVSEGHPDKLADFISDSLLDEFLRQEPESRVAVETLVTTGMAVVAGEVRARSAHVDVQKVVREAVQKVGYTRANYGFDAEYSAVLVSIHEQSPEIGGTVDRSEEWRQMTPQERARPENTFSEVGAGDQGLMFGYATDETPELMPLPISLAHRLTRRLAELRKSGALPYLRPDAKAQVTVVRNGEPHEATETHVDTIVISTQHSEDVSQEQIEADMLEHVVRAVIPHELLTPETKFFINPSGRFVIGGPHGDTGLTGRKIIVDTYGGAVPHGGGAFSGKDPTKVDRSAAYYARYIAKNIVAAGLARRALVEVAYAIGRAHPVSLRVDTYGTGTLSDERLADLVRAHFDARPQAIIAELDLQRPIYAQTAAYGHFGRPEFP--WEQTNKAEAL 397
>gi|163848564|ref|YP_001636608.1| methionine adenosyltransferase [Chloroflexus aurantiacus J-10-fl] >gi|187600976|ref|ZP_02987206.1| Methionine adenosyltransferase [Chloroflexus sp. Y-400-fl] >gi|189081706|sp|A9WGQ3|METK_CHLAA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|163669853|gb|ABY36219.1| Methionine adenosyltransferase [Chloroflexus aurantiacus J-10-fl] >gi|187486804|gb|EDU24775.1| Methionine adenosyltransferase [Chloroflexus sp. Y-400-fl] (403 aa)
Score = 814, Expect = 5.9e-85, Identities = 158/367 (43%), Positives = 248/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEIT-TAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R   TSESV +GHPDK+CDQISDA+LD  L  DP ++VA E      LIV+ GE+T   GY+ + ++    +  +GY  +++        ++  ++ QS +I   V+K               +GAGDQG+++G+A DE    MP  I +AH L++  E+V  +  + +++ D KSQVT++Y+  +  ++D +++S QH+ + T++ I +     +I   + +  L+S  K  IN +G+F IGGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA++ E+Q+S+AIG ++P++ +V+TFGT+   DE I + +   FD    + I   ++R PIY   +  GHFGRT+++  WE+ ++VEE+
  S:    10 RFYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSAEYGFDADTCGVMVAIHGQSPDIAMGVDKALEAKIGAMADDVEAVGAGDQGMMFGFACDETPELMPASIALAHRLIRRLERVRKDGTLPYLRPDAKSQVTVEYSFGKPVRVDTVLISSQHAPDITQDQIRADLIEHVIKTEIPEAWLDSQTKIFINPTGRFVIGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDPSKVDRSAAYACRWVAKNIVAAGLARRVELQVSYAIGVARPLSLSVETFGTAAVPDEVILKAVNEVFDLRPGAIIRDLDLRRPIYRKTAAGGHFGRTDIDLPWERTNRVEEL 397
>gi|50122840|ref|YP_052007.1| S-adenosylmethionine synthetase [Pectobacterium atrosepticum SCRI1043] >gi|60389967|sp|Q6D081|METK_ERWCT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|49613366|emb|CAG76817.1| s-adenosylmethionine synthetase [Erwinia carotovora subsp. atroseptica SCRI1043] (383 aa)
Score = 813, Expect = 7.3e-85, Identities = 167/369 (45%), Positives = 248/369 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDNQI--GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY       D +   ++S +  QS +I   V++ + +  GAGDQG+++GYAT+E +  MP P+  AH LV    +V  +  + +++ D KSQVT  Y D +   ID +++S QHS++ +++ + E+    II  V+    L++  K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+Q+S+AIG ++P +  ++TFGT K S+EQ+  ++   FD      I+  ++  PIY   + YGHFGR      WE+ DK  ++ E
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRRTVRDIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDRRDPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVHRQSEVRKSGSLPWLRPDAKSQVTFLYDDGKIAGIDAVVLSTQHSEDVSQKDLHEAVMEEIIKPVLPAEWLSASTKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMIETFGTEKVSNEQLTLLVREFFDLRPYGLIQMLDLLHPIYQETAAYGHFGREHFP--WEKTDKAAQLRE 379
>gi|111115199|ref|YP_709817.1| S-adenosylmethionine synthetase [Borrelia afzelii PKo] >gi|167942706|ref|ZP_02529780.1| S-adenosylmethionine synthetase [Borrelia afzelii ACA-1] >gi|123341356|sp|Q0SND7|METK_BORAP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|110890473|gb|ABH01641.1| S-adenosylmethionine synthetase [Borrelia afzelii PKo] (392 aa)
Score = 813, Expect = 7.4e-85, Identities = 176/372 (47%), Positives = 251/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD--NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNAIIDFVVK-----KYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK D N+KVACEV  A  L+VI GEI +     +D+ ++A N++  +GY   D+       T+I  V +QS +I NA+EK+  N +GAGDQG+++GYA D+ +NF+P P  +A+ ++K A  +  +  I++++ D KSQVT++Y  ++ P KI  I++S QH  N +++ +      II+ ++K     K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +           +I   IVN FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEMLKVDKNAKVACEVIIAQNLVVIAGEINSPVKKNIDIKEIAKNIIKDIGYTNIDYGLDYKTITVIDAVGNQSRDIINAIEKEGSNTLGAGDQGIIFGYACDDTKNFLPAPYELANSILKKASNLRKSGAIEWLRPDSKSQVTMEYDKNRRPIKIKNIVVSHQHHPNISQKLMR---QTIIEEIIKPTIQDKSILDENTTYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISIQITAGINDPKYASKILNFIVNNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTVLKK 392
>gi|195951074|ref|ZP_03092171.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 29805] (392 aa)
Score = 813, Expect = 8.4e-85, Identities = 180/372 (48%), Positives = 251/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKE--SIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDT-FGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK+D N+KVACEV  A  L+VI GEI +     +D+ ++A N++  +GY   D+       T+I  + +QS +I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I +++ D KSQVTI+Y  ++NP KI  II+S QH  N +++          I   V  K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  + +     KY++ +I   IVN FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEILKEDKNAKVACEVIIAQNLVVIAGEINSPVKKNIDIKEVAKNIIKDIGYTNIDYGLDYKTITVIDAIGNQSRDIINAIEKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSGAIKWLRPDSKSQVTIEYDKNRNPVKIKNIIVSHQHHPNISQKLIQQTIIEEIIKPTVQDKSMLDENTAYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISIQITSGINDPKYAN-KILNFIVNNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTALKK 392
>gi|93005678|ref|YP_580115.1| S-adenosylmethionine synthetase [Psychrobacter cryohalolentis K5] >gi|109892656|sp|Q1QCH2|METK_PSYCK S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|92393356|gb|ABE74631.1| methionine adenosyltransferase [Psychrobacter cryohalolentis K5] (388 aa)
Score = 813, Expect = 8.4e-85, Identities = 160/368 (43%), Positives = 245/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR--TELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LD  L+QD +++VACE       +V+ GEITT   +DV ++  + +  +GY  SD         +I+ +  QS EI   V++ +  + GAGDQG+++GYA++E E  MP PI  AH L++   ++    ++ +++ D K+QVT+ Y  ++   ID +++S QH  + ++  + E+   +II  V+    L++  +  IN +GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA +A +CEVQ+S+AIG ++P + +++TFGT+K S+++I  +I   FD          N+  P+Y   +++GHFGR  +E    WE+ DK +
  S:     1 MREYNLFTSESVSEGHPDKMADQISDAILDAILRQDLHARVACETLVKTGAVVLAGEITTTANIDVERIVRDTVNGIGYHHSDLGFDGETCAVINMLGKQSPEIAQGVDRADPEEQGAGDQGLMFGYASNETEVLMPAPIEYAHRLMERQSELRRAGELPWLRPDAKAQVTLKYDGNKPVAIDAVVLSTQHDPSISQADLQEAIMESIIKQVLPAELLHAGTRYHINPTGKFVIGGPVGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAVRYVAKNIVAAGIADRCEVQVSYAIGVAEPTSISINTFGTNKISNDEIISLIRTHFDLRPYGITRMLNLLQPMYQQTASFGHFGRQGSETAFTWEKTDKAK 380
>gi|154502675|ref|ZP_02039735.1| hypothetical protein RUMGNA_00488 [Ruminococcus gnavus ATCC 29149] >gi|153796558|gb|EDN78978.1| hypothetical protein RUMGNA_00488 [Ruminococcus gnavus ATCC 29149] (386 aa)
Score = 813, Expect = 8.8e-85, Identities = 167/368 (45%), Positives = 241/368 (65%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVE---------KDNQI----GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVN-TFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +RK  T+E+V +GHPDK+CDQI+DA+LD CLK D NS+VACEV A    I++ GEIT+A   DV  +   VL  +GY      + + V+ QS +I  AV+          DNQ+    GAGDQGV+ GYA DE +  MP+P+ +A+ +V+       ++ I  I  D K+QVT++Y + +  ++D +++S QH+++   + +E+     ++   ++    + D K  IN SG+F  GG   DTGLTGRKLMVD+YGS+  HGGGAFSGKDC+KVDRS AY ARYIAKNIVAA+LA +C+V L++AIG ++P+   VDTFGT K   +   E+ +   F  + K  ++   +  PI+   + +GHFGR E    WE+ DKVE +
  S:     1 MRKFYTAEAVTEGHPDKLCDQIADAILDVCLKNDENSRVACEVLATKGNIIVAGEITSAYEPDVFAVVRKVLSDIGYSSEGIAMDTFVHQQSPDIAGAVDTSKERREGVSDNQMDWFQGAGDQGVMIGYACDETKQLMPIPVVLANRIVRELSACRQSSYIQGILPDGKAQVTVEYENGKPVRLDSVVVSCQHTEDKNLKKLEAEIRKKVLLPALRLLPPDEDTKIFINPSGRFVCGGMDADTGLTGRKLMVDSYGSMVPHGGGAFSGKDCSKVDRSVAYMARYIAKNIVAARLASRCQVSLAYAIGVAQPVMVQVDTFGTGKVCADDCLELAIPLVFGLTPKQIVDSLRLTRPIFRQTAAFGHFGRKEFP--WERTDKVEAL 381
>gi|25028279|ref|NP_738333.1| S-adenosylmethionine synthetase [Corynebacterium efficiens YS-314] >gi|29611813|sp|Q8FT48|METK_COREF S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|23493563|dbj|BAC18533.1| methionine adenosyltransferase [Corynebacterium efficiens YS-314] (407 aa)
Score = 812, Expect = 9.5e-85, Identities = 164/368 (44%), Positives = 239/368 (64%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPK-IDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNL----NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSK--YSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           ++ TSESV +GHPDKICD ISD +LD  L  DP S+VA E      ++ + GE+ T+GYV++ ++    LI +G+  SD         +  ++  QS EI + V            E+D++ GAGDQG+++GYAT+E   FMPLPI +AH L +   QV     +  ++ D K+QVT  Y    NP  +D +++S QH        +E      +ID+V++   L      +   +IN SG F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA + EVQ+++AIG +KP+   V+TF T++   +DEQI   +   FD    + I + ++  PIY+  + YGHFGRT+L+  WE  ++   + E
  S:     8 RLFTSESVTEGHPDKICDAISDTILDALLTADPLSRVAVETVVTTGIVHVVGEVRTSGYVEIPQLVRRKLIEIGFTSSDVGFDGRTCGVSVSIGEQSQEIADGVDTSQEARGDGHFEEDDRAGAGDQGLMFGYATNETPEFMPLPIAVAHRLARRLTQVRKEGIVPHLRPDGKTQVTFAYDADDNPSHLDTVVISTQHDPEVDSAWLEVQLREHVIDWVIRDAGLEHLATGEITVLINPSGSFILGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFDTAREGLTDEQIQAAVSQVFDLRPAAIIRELDLLRPIYAQTAAYGHFGRTDLDLPWEATNRTGRLRE 402
>gi|15805667|ref|NP_294363.1| S-adenosylmethionine synthetase [Deinococcus radiodurans R1] >gi|24212023|sp|Q9RWM6|METK_DEIRA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|6458337|gb|AAF10215.1|AE001921_7 S-adenosylmethionine synthase [Deinococcus radiodurans R1] (408 aa)
Score = 812, Expect = 1.0e-84, Identities = 163/370 (44%), Positives = 244/370 (65%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT-AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQ------------------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTI----DYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           +RK  TSESV +GHPDK+ D ISD++LDE L+Q+P S+VA E      + V+ GE+     +VD+ K     +  +GY  +++        ++  ++ QS EI + V+   +                  +GAGDQG+++GYATDE    MPLPI++AH L +   ++  +  + +++ D K+QVT+    +   +    +D I++S QHS + T+E I +     +I  V+    LN   +  IN SG+F IGGP GDTGLTGRK++VDTYG    HGGGAFSGKD TKVDRS AY+ARY+AKNIVAA LA++  V++++AIG + P++  VDT+GT   SDE++ E+I   FD   ++ I + +++ PIY+  + YGHFGR E    WEQ D+ + + E
  S:     6 VRKFYTSESVSEGHPDKLSDFISDSILDEFLRQEPTSRVAVETLVTTGMAVVAGEVRAHTAHVDIQKTVREAVQRVGYTRANYGFDAEYSAVLVAIHEQSPEIASGVDHSEEWREMSEAERQKPENAYSMVGAGDQGLMFGYATDETPELMPLPISLAHGLTRRLAELRKDGTLPYLRPDAKAQVTVVRNGEPHSATETAVDTIVISTQHSDDVTQEQIRADMLEHVIPAVIPAELLNEQTRYFINPSGRFVIGGPHGDTGLTGRKIIVDTYGGAVPHGGGAFSGKDPTKVDRSAAYYARYVAKNIVAAGLARRALVEIAYAIGRAHPVSLRVDTYGTGTVSDEKLDELIAAHFDARPQAIIAQLDLQRPIYAQTAAYGHFGRPEFP--WEQTDRAQALKE 404
>gi|153871877|ref|ZP_02000935.1| S-adenosylmethionine synthetase [Beggiatoa sp. PS] >gi|152071659|gb|EDN69067.1| S-adenosylmethionine synthetase [Beggiatoa sp. PS] (386 aa)
Score = 811, Expect = 1.2e-84, Identities = 161/363 (44%), Positives = 235/363 (64%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV---EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           + TSESV +GHPDK+ DQISDA+LD  L QD  ++VACE      ++++ GEITT+   +V  +    +  +GY+ S+         ++S +  QS +I   V   EK  Q GAGDQG+++GYA++E +  MP PI  AH LVK   QV     + +++ D KSQVT+ Y D +   ID +++S QH+     +++ E+    I   V+     + + +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAAKLA++CEVQ+S+AIG ++P +  V+TFGT    + ++ +++   FD   +  I   ++  PIY   + YGHFGR E    WE+ DK +
  S:     6 LFTSESVSEGHPDKMADQISDAILDAILAQDSRARVACETMIKTGMVIVAGEITTSAQFEVEDVVRETVKKIGYNSSEMGFDWETCAVLSALGKQSADIAMGVDETEKHEQ-GAGDQGLMFGYASNETDVLMPAPITYAHRLVKRQAQVRKEGILPWLRPDAKSQVTLRYVDGKPVGIDAVVLSTQHAPEIDNKTLREAVREEIFKPVLPAQWFDKNTRIYINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAKLAERCEVQVSYAIGVAEPTSIRVETFGTGVIDEARLTQLVREHFDLRPRGLIAMLDLLHPIYQDTAAYGHFGREEEQFTWERTDKAD 378
>gi|153852760|ref|ZP_01994197.1| hypothetical protein DORLON_00179 [Dorea longicatena DSM 13814] >gi|149754402|gb|EDM64333.1| hypothetical protein DORLON_00179 [Dorea longicatena DSM 13814] (390 aa)
Score = 811, Expect = 1.3e-84, Identities = 163/368 (44%), Positives = 237/368 (64%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ-------------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKY-SDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +++  T+ESV +GHPDK+CD I+D++LD CLK+D NS+VACEV A  R I++ GEIT+     V ++   VL   GY+  +  + + ++ QS +I  AVE+  +              GAGDQG++ GYA DE    MP+P+ +A+ +V+       +  I  I  D K+QVT++Y D +  ++D +I+S QH +  +   +E      ++   ++    + D K +IN SG+F  GG   DTGLTGRKLMVDTYGSL  HGGGAFSGKDC+KVDRSGAY ARYIAKN+VAA LA +C+V L++AIG ++P+   VDTFGT K  +D+ +   I   F  +     +  +++ PIY   + +GHFGR E    WE+ DK E++
  S:     5 MKRFYTAESVTEGHPDKLCDLIADSILDACLKEDENSRVACEVLATKRNIIVAGEITSRFEPQVFEIIKKVLESAGYEAEEIHMDALIHKQSPDIAGAVERSRERRAGTVSVQSGLASGAGDQGIMIGYACDETPQLMPMPVVLANRIVRELSASRRSGYITGILPDGKAQVTVEYEDDRPARLDTVIVSCQHEKEKSLRKLEHEIREKVLRPALRMLPPDEDTKILINPSGRFVCGGLDADTGLTGRKLMVDTYGSLVPHGGGAFSGKDCSKVDRSGAYMARYIAKNMVAAGLASRCQVSLAYAIGVAQPVMVQVDTFGTGKICADDCLAAAIPLVFGLTPSQICDTLHLKRPIYRQSAVFGHFGRKEFP--WEKTDKAEQL 385
>gi|94309101|ref|YP_582311.1| S-adenosylmethionine synthetase [Ralstonia metallidurans CH34] >gi|158564229|sp|Q1LS34|METK_RALME S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|93352953|gb|ABF07042.1| methionine adenosyltransferase [Ralstonia metallidurans CH34] (387 aa)
Score = 811, Expect = 1.3e-84, Identities = 162/361 (44%), Positives = 236/361 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---NLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VA E      L+V+ GEITT   VD +++A   +  +GYD +++        ++   + QS +I   V++      NQ GAGDQG+++GYA DE    MP PI  +H LV+    +  + ++ +++ D KSQVT+ Y D +   +D +++S QH+ + ++  I     A+I+ ++K      +  + K ++N +G+F IGGP GD GLTGRK++VDTYG  + HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA++C+VQ+S+AIG ++PI   V T GT K SDE+I  ++   FD   K  ++  ++  PIY   + YGHFGR E    WE  DK
  S:     6 LFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQVARETIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQ-GAGDQGLMFGYACDETPELMPFPIYYSHRLVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGRPHSVDTVVLSTQHAPDISQAQIRE---AVIEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINVTVYTEGTGKISDEKIAALVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDK 377
>gi|66769773|ref|YP_244535.1| S-adenosylmethionine synthetase [Xanthomonas campestris pv. campestris str. 8004] >gi|188992987|ref|YP_001904997.1| Methionine adenosyltransferase [Xanthomonas campestris pv. campestris] >gi|81304273|sp|Q4UR08|METK_XANC8 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|66575105|gb|AAY50515.1| methionine adenosyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|167734747|emb|CAP52957.1| Methionine adenosyltransferase [Xanthomonas campestris pv. campestris] (403 aa)
Score = 811, Expect = 1.3e-84, Identities = 166/365 (45%), Positives = 246/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR---------------TELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLD  L QD  ++VACE      + ++ GE+TT+ ++D+  +   V++ +GY+ SD         +++ +  QS +I   V++ N  Q GAGDQG+++GYAT+E +++MP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y D     ID +++S QH      K+ IE+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K +DE I ++I   FD      I+  ++  P+Y   ++YGHFGR               +  +  WE+ D+ E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADELIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRAEAL 396
>gi|170078321|ref|YP_001734959.1| S-adenosylmethionine synthetase [Synechococcus sp. PCC 7002] >gi|169885990|gb|ACA99703.1| S-adenosylmethionine synthetase [Synechococcus sp. PCC 7002] (417 aa)
Score = 811, Expect = 1.4e-84, Identities = 170/368 (46%), Positives = 250/368 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAV-----EKD-------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIID-----------FVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISDA+LD  L  DP+S+VA EV     L++I GE+TT   V+ +++A   +  +GY  +D    +N       ++ QS +I   V     ++D       ++IGAGDQG+++GYA +E   FMPLPI++AH L     QV  + ++ ++  D K+QVT+ Y D +   ID I++S QH++     +  +   A I            FV     L+   K ++N +GKF IGGP GD+GLTGRK+++DTYG  ++HGGGAFSGKD TKVDRS +Y  RY+AKNIVAA LA+KCEVQ+S+AIG ++P++  ++TFGT    ++++ E++   F+      I+ F++R+         Y   + YGHFGRT+L+  WE+LDKV+
  S:     1 MSRRYLFTSESVTEGHPDKICDQISDAILDAVLAADPSSRVAAEVVTNTGLVLITGELTTQANVNFIQVARQKIKEIGYTNADNGFSANSCSVMVALDEQSPDIAQGVTSAQEQRDKLSDDQLDEIGAGDQGLMFGYACNETPEFMPLPISLAHRLSLKLSQVRKSGELPYLGPDGKTQVTVIYEDGKPVGIDTILISTQHTETIGALTDNTEIQAKIKADLLEKVIKPVFVGATVGLSDSTKFLVNPTGKFVIGGPQGDSGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSASYACRYVAKNIVAAGLAEKCEVQVSYAIGVARPVSVMIETFGTCTVDEDRLLEVVQKHFELRPAGIIQAFDLRNLPSQRNGRFYQDMAAYGHFGRTDLDLPWERLDKVD 405
>gi|148377843|ref|YP_001256719.1| S-adenosylmethionine synthetase [Mycoplasma agalactiae PG2] >gi|148291889|emb|CAL59280.1| Methionine adenosyltransferase [Mycoplasma agalactiae PG2] (382 aa)
Score = 811, Expect = 1.4e-84, Identities = 179/370 (48%), Positives = 255/370 (68%)
  Q:     4 RKIM-TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVL--IPLGYDESDFTIISNVNSQSNEIFNAVE-KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCN-AIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           RK++ TSESVG GHPDKICDQISDAV+DE +KQDP S++A E  A+   I I GE+ +   VD+  +A   +  I   Y  +   +I N+  QS++I   V   D++IGAGDQG+++GYAT+E   +MPL I +AH +V+ A ++I + +    K DMKSQVT+D+++ +  K+D ++ S QH +N  ++S ++     II  ++ +YN+N   K +IN +G+F IGG +GD GLTGRK++VDTYG  A HGGGAFSGKD TKVDRS AY  R+IAKN+VAAK+A K E+Q+S+AIG ++P++  VDTFGT+K S+E I +     FD   ++ I +  +R PIY   + +GHFGR ++   WE LDKV EI E+
  S:     5 RKVLFTSESVGLGHPDKICDQISDAVIDEFIKQDPYSRLAIETVASGNQIYITGEVASNATVDIKDVALKTIFDIDKDYQINVPEVILNIKKQSDDIAQGVLLDDDEIGAGDQGIMFGYATNETPEYMPLAITLAHRIVQKASELIKSGEFKHAKSDMKSQVTLDFSE-EKVKVDTVLFSCQHDENFDEKSFKTVIKEKIIYPIMDEYNMNMPSKILINPTGRFVIGGIVGDAGLTGRKIIVDTYGGTAHHGGGAFSGKDATKVDRSAAYACRWIAKNLVAAKVADKLEIQVSYAIGVAEPVSIFVDTFGTNKVSNESIIDATNAIFDLRPRAIIHELGLRKPIYKNTACFGHFGRKDITFPWENLDKVNEIKEY 378
>gi|121590722|ref|ZP_01678054.1| S-adenosylmethionine synthase [Vibrio cholerae 2740-80] >gi|121728592|ref|ZP_01681613.1| S-adenosylmethionine synthase [Vibrio cholerae V52] >gi|147673542|ref|YP_001215998.1| S-adenosylmethionine synthetase [Vibrio cholerae O395] >gi|153216280|ref|ZP_01950373.1| S-adenosylmethionine synthase [Vibrio cholerae 1587] >gi|153802599|ref|ZP_01957185.1| S-adenosylmethionine synthase [Vibrio cholerae MZO-3] >gi|153819162|ref|ZP_01971829.1| S-adenosylmethionine synthase [Vibrio cholerae NCTC 8457] >gi|153828417|ref|ZP_01981084.1| S-adenosylmethionine synthase [Vibrio cholerae 623-39] >gi|172047755|sp|A5F9H4|METK_VIBC3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|121547453|gb|EAX57562.1| S-adenosylmethionine synthase [Vibrio cholerae 2740-80] >gi|121629148|gb|EAX61591.1| S-adenosylmethionine synthase [Vibrio cholerae V52] >gi|124114369|gb|EAY33189.1| S-adenosylmethionine synthase [Vibrio cholerae 1587] >gi|124121862|gb|EAY40605.1| S-adenosylmethionine synthase [Vibrio cholerae MZO-3] >gi|126510307|gb|EAZ72901.1| S-adenosylmethionine synthase [Vibrio cholerae NCTC 8457] >gi|146315425|gb|ABQ19964.1| S-adenosylmethionine synthase [Vibrio cholerae O395] >gi|148876126|gb|EDL74261.1| S-adenosylmethionine synthase [Vibrio cholerae 623-39] >gi|150422877|gb|EDN14828.1| S-adenosylmethionine synthase [Vibrio cholerae AM-19226] (385 aa)
Score = 811, Expect = 1.4e-84, Identities = 174/373 (46%), Positives = 243/373 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M ++ + TSESV +GHPDKI DQISDAVLD   +QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  AH L++   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS + +T +  E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     1 MAIKHLFTSESVSEGHPDKIADQISDAVLDAIFEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRQTVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEVLMPAPITYAHRLMQRQAEVRKNGTLPWLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHSDSISTADLREAVMEEIIKPVLPAEWLSKETKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSQEIIIEAVRQFFDLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFP--WEATDKAALLRDF 381
>gi|15611253|ref|NP_222904.1| S-adenosylmethionine synthetase [Helicobacter pylori J99] >gi|6685665|sp|Q9ZMN5|METK_HELPJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|4154690|gb|AAD05755.1| S-adenosylmethionine synthetase [Helicobacter pylori J99] (385 aa)
Score = 811, Expect = 1.5e-84, Identities = 165/371 (44%), Positives = 244/371 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + TSESV +GHPDK+ DQISDAVLD  +++D  +KVACE   +N   +I GE+ T+ Y  + ++A  V+  +GY ++ +        +++ +  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI++AH L     Q   +  + F++ D KSQV++ Y +++   +D I++S QHS   +++ + E+    I+  V+ K  L+ + K  IN +GKF IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ +  K  VQL++AIG  +P++  V+T  TSK+S  ++ + + + F  + K  IE  ++  PIYS  S YGHFGR      WE+ +KVEEI  F K+
  S:     6 LFTSESVTEGHPDKMADQISDAVLDYIIERDKKAKVACETLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGIGEQSPDINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLAFALAQKRKDNTLPFLRPDGKSQVSVRYENNKPVSVDTIVISTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLHDNIKFFINPTGKFVIGGPQGDAGLTGRKIIVDTYGGFCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSIYVNTHNTSKHSSAELEKCVKSVFKLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKVEEIKAFFKR 385
>gi|34558281|ref|NP_908096.1| S-adenosylmethionine synthetase [Wolinella succinogenes DSM 1740] >gi|44888134|sp|Q7M7Z2|METK_WOLSU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|34484000|emb|CAE10996.1| METHIONINE ADENOSYLTRANSFERASE 1 (ADOMET SYNTHETASE) (S-ADENOSYLMETHIONINE SYNTHETASE) [Wolinella succinogenes] (386 aa)
Score = 810, Expect = 1.5e-84, Identities = 160/368 (43%), Positives = 238/368 (64%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + TSESV +GHPDK+ DQISDA+LD  +++DP ++VACE   +N   VI GE+ T  Y  + ++A  V+  +GY ++ +        I++ V  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI ++H + +   +   +  + F++ D KSQVT+ Y D +   ID I++S QH+ + ++E + ++    I+  V+ K  L  D +  +N +GKF IGGP GD GLTGRK++VD+YG    HGGGAFSGKD +KVDRSGAY ARY+AKN+VA+ +  K  +Q+++AIG  +P++  VDT GT K  D+Q+   +   F  + K  IE  ++  PIY   ++YGHFGR      WE+ DK E I  +
  S:     6 LFTSESVTEGHPDKMADQISDAILDYIIERDPKARVACETLLSNGFCVIAGELKTTTYAPMQEIAREVIREIGYTDALYGFDYRSAGILNGVGEQSPDINQGVDREDGEIGAGDQGLMFGYACRETETLMPLPIFLSHKITEGLAKARKDGTLPFLRPDGKSQVTVRYVDGKPVGIDTIVVSTQHAPDVSQERLRDAVIEEIVYKVLPKEYLGDDIRFFVNPTGKFVIGGPQGDAGLTGRKIIVDSYGGSCPHGGGAFSGKDPSKVDRSGAYAARYVAKNLVASGVCDKATIQIAYAIGVVEPVSILVDTHGTGKVEDDQLETCVRQLFRLTPKGIIESLDLLRPIYKKTASYGHFGRELPEFSWEKTDKAELIKNY 382
>gi|15644826|ref|NP_206996.1| S-adenosylmethionine synthetase [Helicobacter pylori 26695] >gi|3024119|sp|P56460|METK_HELPY S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|2313288|gb|AAD07267.1| S-adenosylmethionine synthetase 2 (metX) [Helicobacter pylori 26695] (385 aa)
Score = 810, Expect = 1.6e-84, Identities = 166/371 (44%), Positives = 243/371 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + TSESV +GHPDK+ DQISDAVLD  +++D  +KVACE   +N   +I GE+ T+ Y  + ++A  V+  +GY ++ +        +++ V  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI++AH L     Q   +  + F++ D KSQV++ Y +++   ID I++S QHS   +++ + E+    I+  V+ K  L+ + K  +N +GKF IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ +  K  VQL++AIG  +P++  V+T  TSKYS  ++ + + + F  + K  IE  ++  PIYS  S YGHFGR      WE+ +K EEI  F K+
  S:     6 LFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACETLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGVGEQSPDINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLTFALAQKRKDNTLPFLRPDGKSQVSVRYENNKPVSIDTIVISTQHSPEVSQKHLKEAVIEEIVYKVLSKEYLHDNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSIYVNTHNTSKYSSAELEKCVKSVFKLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKAEEIKAFFKR 385
>gi|42779472|ref|NP_976719.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 10987] >gi|42735388|gb|AAS39327.1| S-adenosylmethionine synthetase [Bacillus cereus ATCC 10987] (435 aa)
Score = 810, Expect = 1.6e-84, Identities = 169/374 (45%), Positives = 239/374 (63%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAV-----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           ++ +T+ESV  GHPDK+CD I+D++L+ CL++D  S+VACEV A    I++ GEI+ +G +D+  +  NVL  +GY+   F I   ++SQS +I   V           E+   IGAGDQG +YGYAT E    +PLP+ ++H +VK  +       I  I  D K+QVT++Y      +I  I++SVQH +N T+E +++   N ++    + +  + + + +IN SG+F +GGP  DTGLTGRK+MVDTYG LA HGGGA  GKD TKVDRSGAY ARYIAK+I     AKKCEV +S+AIG + P+AF V+T GT   SDE +      TF+    + IEK  +R+ IYS  + YGHF    L P WE ++K  E  +  +KY
  S:    47 KRYLTAESVCAGHPDKLCDIIADSILEACLRKDRASRVACEVIATKGKIIVAGEISCSGKIDIRCIVRNVLKEIGYNPLKFLIYVYIHSQSVDIAAGVNTALEVRNGINEQYGSIGAGDQGTMYGYATKETREMLPLPLVLSHRIVKRLDDCRKGKLIKGILPDGKAQVTVEYEADTPVRIKTIVISVQHDKNKTQEELKADILNNVLWQCFEDFPFDDETEILINPSGQFVLGGPAADTGLTGRKIMVDTYGGLASHGGGALCGKDPTKVDRSGAYMARYIAKHIFWCGYAKKCEVSISYAIGKANPVAFTVNTLGTGTISDEILTLAAQETFNLRPAAIIEKLRLRNVIYSDTAAYGHFNSC-LFP-WEDVNKYSEFRKAVEKY 430
>gi|153835778|ref|ZP_01988445.1| S-adenosylmethionine synthetase [Vibrio harveyi HY01] >gi|148867508|gb|EDL66866.1| S-adenosylmethionine synthetase [Vibrio harveyi HY01] (384 aa)
Score = 810, Expect = 1.7e-84, Identities = 173/370 (46%), Positives = 241/370 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  +H LV+   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    +  D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S + I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK E + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEILMPAPITYSHRLVQKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPSEWITKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQFFDLRPYGLQEMLNLLQPIYKQTAAYGHFGREEFP--WEATDKAELLRDF 380
>gi|182439851|ref|YP_001827570.1| putative S-adenosylmethionine synthetase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178468367|dbj|BAG22887.1| putative S-adenosylmethionine synthetase [Streptomyces griseus subsp. griseus NBRC 13350] (402 aa)
Score = 810, Expect = 1.9e-84, Identities = 162/367 (44%), Positives = 245/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY---------NLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y D+  +  N ++ +GYD S          +  ++ +QS +I   V             E D Q GAGDQG+++GYA DE    MPLPI++AH L +   +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   +S+      I +FVV+            L+++ ++ ++N +G+F IGGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+    E+I   I   FD    + I   ++  PIY+  + YGHFGR   +  WE+ D+V+ +
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADIPNLVRNKVLEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYEKRVEGDEDELDKQ-GAGDQGLMFGYACDETPELMPLPIHVAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLDSL--LAPDIREFVVEHVLAQLVEDGIKLDTEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAAVDTEKIENAIGEVFDLRPAAIIRDLDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDAL 396
>gi|118046767|ref|ZP_01515414.1| Methionine adenosyltransferase [Chloroflexus aggregans DSM 9485] >gi|117996806|gb|EAV11000.1| Methionine adenosyltransferase [Chloroflexus aggregans DSM 9485] (403 aa)
Score = 810, Expect = 1.9e-84, Identities = 160/367 (43%), Positives = 245/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEIT-TAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKD------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R   TSESV +GHPDK+CDQISDA+LD  L  DP + VA E      LIV+ GE+T   GY+ + ++    +  +GY       D     ++  ++ QS +I   V+K               +GAGDQG+++G+A DE    MP  I +AH L++  E+V  +  + +++ D KSQVT++Y+  +  ++D +++S QH+ + T+E I +     +I   V +  L++  K  IN +G+F IGGP+GD+GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA++ E+Q+S+AIG ++P++ +V+TFGT   +DE I + +   FD    + I   ++R PIY   +  GHFGRT+++  WE+ ++VEE+
  S:    10 RFYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKAWVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSGECGFDADTCGVMVAIHGQSPDIAMGVDKALEAKIGAMQDDVEAVGAGDQGMMFGFACDETPELMPASIALAHRLIRRLERVRKDGTLPYLRPDAKSQVTVEYSFGKPVRVDTVLISSQHAPDVTQEQIRDDLIEHVIKTEVPEAWLDTQTKIFINPTGRFVIGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDPSKVDRSAAYACRWVAKNIVAAGLARRVELQVSYAIGVARPLSLSVETFGTGAVADEVILKAVNEVFDLRPGAIIRDLDLRRPIYRKTAAGGHFGRTDIDLPWERTNRVEEL 397
>gi|15594721|ref|NP_212510.1| S-adenosylmethionine synthetase [Borrelia burgdorferi B31] >gi|195948895|ref|ZP_03089995.1| S-adenosylmethionine synthetase [Borrelia burgdorferi WI91-23] >gi|195960200|ref|ZP_03096405.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 64b] >gi|7387874|sp|O50163|METK_BORBU S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|2688287|gb|AAC66763.1| S-adenosylmethionine synthetase (metK) [Borrelia burgdorferi B31] (392 aa)
Score = 810, Expect = 1.9e-84, Identities = 180/372 (48%), Positives = 250/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKE--SIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVD-TFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK+D N+KVACEV  A  L+VI GEI +     +D+ ++A N++  +GY   D+       T+I  + +QS +I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I +++ D KSQVTI+Y  ++NP KI  II+S QH  N +++          I   V  K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +       KY++ +I   IVN FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEILKEDKNAKVACEVIIAQNLVVIAGEINSPVKKNIDIKEVAKNIIKDIGYTNIDYGLDYKTITVIDAIGNQSRDIINAIEKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSGAIKWLRPDSKSQVTIEYDKNRNPVKIKNIIVSHQHHPNISQKLIQQTIIEEIIKPTVQDKSMLDENTAYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISIQITGGINDPKYAN-KILNFIVNNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTALKK 392
>gi|167931628|ref|ZP_02518715.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 156a] >gi|167933354|ref|ZP_02520429.1| S-adenosylmethionine synthetase [Borrelia burgdorferi ZS7] >gi|167944252|ref|ZP_02531326.1| S-adenosylmethionine synthetase [Borrelia burgdorferi Bol26] >gi|168525979|ref|ZP_02719618.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 118a] >gi|168579386|ref|ZP_02723414.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 72a] >gi|168692013|ref|ZP_02724805.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 94a] >gi|195941274|ref|ZP_03086656.1| S-adenosylmethionine synthetase [Borrelia burgdorferi 80a] >gi|195954844|ref|ZP_03093537.1| S-adenosylmethionine synthetase [Borrelia burgdorferi CA-11.2a] (392 aa)
Score = 809, Expect = 2.0e-84, Identities = 180/372 (48%), Positives = 250/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKE--SIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVD-TFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK+D N+KVACEV  A  L+VI GEI +     +D+ ++A N++  +GY   D+       T+I  + +QS +I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I +++ D KSQVTI+Y  ++NP KI  II+S QH  N +++          I   V  K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +       KY++ +I   IVN FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEILKEDKNAKVACEVIIAQNLVVIAGEINSPVKKNIDIKEVAKNIIKDIGYTNIDYGLDYKTITVIDAIGNQSRDIINAIEKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSGAIKWLRPDSKSQVTIEYDKNRNPVKIKNIIVSHQHHPNISQKLIQQTIIEEIIKPTVQDKSMLDENTAYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIKNPISIQITGGINDPKYAN-KILNFIVNNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTALKK 392
>gi|163725911|ref|ZP_02133429.1| Methionine adenosyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161400720|gb|EDQ24970.1| Methionine adenosyltransferase [Desulfatibacillum alkenivorans AK-01] (389 aa)
Score = 809, Expect = 2.0e-84, Identities = 168/363 (46%), Positives = 237/363 (65%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN----QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           TSESV +GHPDK+ D ISD +LD  + QD N +VACE      L  I GEITT+ YVD+  +  N +  +GY  S         +++++++ QS +I   V++      + GAGDQG+++GYATDE    MP+PI  AH L K   +V  N  +DF++ D KSQVTI+Y + Q  ++D I+++ QH  + T   + ES    +I  V+    ++ D K  IN +G+F IGGP+GD GLTGRK++VDTYG    HGGG FSGKD +KVDRS +Y  R+IAKNIVAA LAKKCEVQ+++AIG  +P++  VD  GT     ++I EII++ FD   ++ IE  ++  PIY   + YGHFGR + +  WE  +K +EI
  S:     9 TSESVTEGHPDKVADAISDNILDGIMAQDKNCRVACETLVTTGLAFIAGEITTSCYVDIPDIVRNTIKEIGYHSSQMGFDWQTCSVLTSIDRQSEDIALGVDEQTAQFKEQGAGDQGLMFGYATDETPELMPMPITYAHKLTKRLAKVRKNGALDFLRPDGKSQVTIEYENGQPKRVDTIVIAAQHKPDVTTSQLQESVIEEVIKKVIPAEMIDGDTKYFINATGRFVIGGPMGDCGLTGRKIIVDTYGGQGSHGGGCFSGKDPSKVDRSASYMGRHIAKNIVAAGLAKKCEVQVAYAIGVPQPVSVMVDPMGTGVIPKDRIKEIILDVFDLRPRAIIEYLDLLRPIYRKTAAYGHFGREDSDFTWEATNKADEI 383
>gi|33239801|ref|NP_874743.1| S-adenosylmethionine synthetase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|44888145|sp|Q7VDM7|METK_PROMA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33237327|gb|AAP99395.1| S-adenosylmethionine synthetase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (410 aa)
Score = 809, Expect = 2.0e-84, Identities = 169/370 (45%), Positives = 247/370 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEKDN--------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQ-----NATKESIESFCNAIIDFVVKKYNLNSDFKRI-------INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQL-DKVEEILEFTK 375
           + TSESV +GHPDKICDQ+SDA+LD  L QDPNS+VACE      L +I GE+T+   VD + +   V+  +GY        D +  +++  ++ QS +I   V++ +        Q+GAGDQG+++G+A DE    MPLPI++AH L +   +V  +  + ++  D K+QV++ Y +++   ID I++S QH+       + K   E     + + VVK    +   K I       +N +GKF +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY AR++AK++VAA LA + EVQLS+AIG + P++  V+ FG+ K S+E + E++   FD    + IE+F +RS         Y   + YGHFGR +LN  WE + DK +E++E  K
  S:     5 VFTSESVTEGHPDKICDQVSDAILDALLDQDPNSRVACETVVNTGLCLITGEVTSKAKVDFINLVREVIKEIGYFGAKAGGFDSNSCSVLVALDQQSPDIAQGVDEADDHSGNPFDQVGAGDQGIMFGFACDETPELMPLPISLAHRLSRRLAKVRHDGTLKYLLPDGKTQVSVLYENNKPTAIDTILISTQHTAEVEGITSEKGIREQISKDLWELVVKPATEDLPIKPIQEKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKSLVAAGLASRVEVQLSYAIGVANPVSILVEAFGSGKMSNEALTELVTENFDLRPGAIIEQFGLRSLPNQRQGRFYRDVAAYGHFGRPDLNLPWEDVQDKAKELIESQK 410
>gi|195959055|ref|ZP_03095264.1| S-adenosylmethionine synthetase [Borrelia sp. SV1] (392 aa)
Score = 809, Expect = 2.1e-84, Identities = 180/372 (48%), Positives = 250/372 (67%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITT--AGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK--DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKE--SIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVD-TFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + +TSE+V +GHPDKI DQISDA+LDE LK+D N+KVACEV  A  L+VI GEI +     +D+ ++A N++  +GY   D+       T+I  + +QS +I NA+EK   N +GAGDQG+++GYA DE +NF+P P  +A+ ++K A  +  +  I +++ D KSQVTI+Y  ++NP KI  II+S QH  N +++          I   V  K  L+ +    IN SG F IGGP GDTGLTGRK++ D+YG  A+HGGGA+SGKD TKVDRS AY ARYIAKN+VAA ++K+ E+QL++AIG   PI+  +       KY++ +I   IVN FD +    IEK  ++ PIY    TYGHFG+ E    WE+LD V++I    KK
  S:     9 QTLTSEAVSEGHPDKIADQISDAILDEILKEDKNAKVACEVIIAQNLVVIAGEINSPVKKNIDIKEVAKNIIKDIGYTNIDYGLDYKTITVIDAIGNQSRDIINAIEKKGSNALGAGDQGIIFGYACDETKNFLPAPYELANSILKKASNLRKSGAIKWLRPDSKSQVTIEYDKNRNPVKIKNIIVSHQHHPNISQKLIQQTIIEEIIKPTVQDKSMLDENTAYCINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSAAYMARYIAKNMVAAGISKEFELQLAYAIGIENPISVQITGGINDPKYAN-KILNFIVNNFDLTPNGIIEKLKLKQPIYLKTCTYGHFGKNEFE--WEKLDFVKKIQTALKK 392
>gi|194364408|ref|YP_002027018.1| Methionine adenosyltransferase [Stenotrophomonas maltophilia R551-3] >gi|194347212|gb|ACF50335.1| Methionine adenosyltransferase [Stenotrophomonas maltophilia R551-3] (403 aa)
Score = 809, Expect = 2.1e-84, Identities = 162/349 (46%), Positives = 237/349 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR 354
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VACE      + ++ GEITT+ ++D+  +   V++ +GYD SD         +++ +  QS  I   V+  K  ++GAGDQG+++GYAT+E +++MP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y +     ID +++S QH+     K+ IE+    II  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K SD++I ++I   FD      I+  ++  P+Y   + YGHFGR
  S:     5 LFTSESVSEGHPDKVADQISDAVLDAILTQDQRARVACETMVKTGVAIVAGEITTSAWIDLEALTRKVIVDIGYDSSDVGFDGATCGVLNLIGKQSPHIAQGVDRKKPEEMGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSPLSWLRPDAKSQVTLRYENGVVSAIDAVVLSTQHAPGIKQKDLIEAVREEIIKPVLPAKWLHKGTKFHINPTGKFEIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKISDDKIEKLIRKHFDLRPYGIIKMLDLVHPMYQQTAAYGHFGR 365
>gi|148241512|ref|YP_001226669.1| S-adenosylmethionine synthetase [Synechococcus sp. RCC307] >gi|166201415|sp|A5GR07|METK_SYNR3 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|147849822|emb|CAK27316.1| S-adenosylmethionine synthetase [Synechococcus sp. RCC307] (407 aa)
Score = 809, Expect = 2.1e-84, Identities = 168/369 (45%), Positives = 243/369 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEKDN--------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH--------SQNATKESIES-FCNAIIDFVVKKYNLNSD---FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDKICDQ+SDAVLD  L QDP S+VACE      L +I GE+TT   VD   +   V+  +GY        D +   ++  ++ QS +I   V++ +        ++GAGDQG+++GYA DE    MPLPI++AH L +   +V  N  + ++  D K+QV++ Y D Q   ID I++S QH         +   +E I +     +++      +L       K ++N +GKF +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY AR++AK +VAA LA+K EVQLS+AIG +KP++  V++FGTS +S++++ E++   FD    + IE F +R+         Y   + YGHFGR++LN  WE +  +   L+
  S:     3 RYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCIITGEVTTTARVDFNTLVRGVIADIGYSSAKAGGFDANSCAVLVALDQQSPDIAQGVDEADDHAGDPLDKVGAGDQGIMFGYACDETPELMPLPISLAHRLARRLAEVRHNGTLGYLLPDGKTQVSVVYEDDQPVAIDTILISTQHIAEIDGISDEKGLRERISADLWTHVVEPATADLSLKPSKDTTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAAGLARKAEVQLSYAIGVAKPVSILVESFGTSSHSNDELTELVNANFDLRPGAIIENFKLRNLPQQRGGNFYREVAAYGHFGRSDLNLPWEDVSVIAAKLK 406
>gi|90422689|ref|YP_531059.1| S-adenosylmethionine synthetase [Rhodopseudomonas palustris BisB18] >gi|109892614|sp|Q21A46|METK1_RHOPB S-adenosylmethionine synthetase 1 (Methionine adenosyltransferase 1) (AdoMet synthetase 1) (MAT 1) >gi|90104703|gb|ABD86740.1| methionine adenosyltransferase [Rhodopseudomonas palustris BisB18] (383 aa)
Score = 809, Expect = 2.1e-84, Identities = 159/370 (42%), Positives = 232/370 (62%)
  Q:     7 MTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDE------SDFT-IISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKES-IESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           +TSESV +GHPDK+CDQISD +LD C+ QDP S+VA E   +  + VI GEITT   +D  + A  V+  +GYD+      SD   I++N+ +QS +I   V + +++GAGDQGV YGYA DE  N MP+PI +AH L      +  +  + +++ D K QVT+ Y     P  +D +++S QH +   +++ +      +I   +  + L    + +IN +G+F +GGP GDTG+TGRKLMVDTYG  A+HGGGAFSGKD TKVDR+ AY ARY AKN+VAA LA +C++ L++AIG   P   +V+TFGT     ++I   +   F +++   I    +R P +   + YGHFGR +    WE+ D+  E+L    +
  S:     6 VTSESVTEGHPDKVCDQISDGILDACVAQDPASRVAVETLVSGNIAVIAGEITTTAQIDAERTARAVIKAIGYDDPALGFDSDSCFILTNLRTQSPDINLGVSRGDELGAGDQGVFYGYACDETANLMPIPIALAHTLSLRLTMMRRDGTLPWLRPDGKVQVTMRYGRDGRPCGLDSVVVSAQHDEAVDRDTLVRGLVEGVIYPELHDW-LQPGTRVLINPTGRFVVGGPAGDTGVTGRKLMVDTYGGCAQHGGGAFSGKDATKVDRTAAYMARYAAKNVVAAGLAGRCQLALAYAIGQIDPEMISVETFGTETVDGDRICAAVREVFPWTVSGMIAALELRQPRFRKTAAYGHFGREDQGFQWEKTDRSGELLALCTR 383
>gi|146284238|ref|YP_001174391.1| S-adenosylmethionine synthetase [Pseudomonas stutzeri A1501] >gi|158514120|sp|A4VRE8|METK_PSEU5 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|145572443|gb|ABP81549.1| S-adenosylmethionine synthetase [Pseudomonas stutzeri A1501] (396 aa)
Score = 809, Expect = 2.2e-84, Identities = 162/370 (43%), Positives = 244/370 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRT--ELNPG--------WEQLDKVEEI 370
           M    I TSESV +GHPDKI DQISDAVLD  + +D +++VACE      + ++ GE+TT+ +VD+ ++  +V++ +GY+ S+         II+ +  QS +I   V+  K    GAGDQG+++GYA++E +  MP PI  +H LV+   +   N  + +++ D KSQVT  Y + Q   ID +++S QH+ +  +  + E+    II   +    L+ D +  IN +G+F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA +CE+Q+S+AIG ++P + +++TFGT K  D++I  ++   FD    +     ++  P+Y   + YGHFGRT  E+  G        WE+ DK + +
  S:     1 MSEYSIFTSESVSEGHPDKIADQISDAVLDAIIAEDKHARVACETLVKTGVAIVAGEVTTSAWVDLEQLVRDVIVDIGYNSSEVGFDGATCGIINIIGKQSVDIAQGVDRTKPEDQGAGDQGLMFGYASNETDVLMPAPIRFSHALVERQAEARKNGLLPWLRPDAKSQVTCRYENGQVVGIDAVVLSTQHNPDVKQSDLREAVMELIIKHSLPAELLHKDTQYHINPTGQFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADRCEIQVSYAIGVAQPTSISLNTFGTGKLGDDKIIALVREHFDLRPYAITRMLDLLHPMYRATAAYGHFGRTPYEMTVGADTFTAFTWEKTDKADAL 390
>gi|116334122|ref|YP_795649.1| S-adenosylmethionine synthetase [Lactobacillus brevis ATCC 367] >gi|122269194|sp|Q03QA4|METK_LACBA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|116099469|gb|ABJ64618.1| methionine adenosyltransferase [Lactobacillus brevis ATCC 367] (395 aa)
Score = 809, Expect = 2.3e-84, Identities = 165/370 (44%), Positives = 249/370 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-----------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M+ R + TSESV +GHPDKI DQISDA+LD  L QDP+S+VACE      L+++ GEI+T  YVD+ K+    +  +GY +  +        ++  ++ QS +I   V+             +QIGAGDQG+++GYA +E    MPLPI ++H L++    +     +D+++ D K++VT++Y D+  P ++D +++S QH  + T + I +     +I   +    L+   K  IN +G+F IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS +Y ARYIAKNIVAA+LA+KCEVQ+++AIG ++P++  V+TFGT   ++ ++   + + FD      I+  +++ PIY   + YGHFGRT+++  WE  DKV+ +
  S:     1 MQERHLFTSESVSEGHPDKIADQISDAILDALLAQDPDSRVACETSVTTGLVLVFGEISTKAYVDIQKVVRQTIKEIGYTDGQYGFDGDNCAVLVAIDEQSPDIAQGVDDSLETREGDADPLDQIGAGDQGLMFGYAVNETPELMPLPIELSHALMRRIAMLRKQAVLDYLRPDAKAEVTVEYDDNDQPLRVDTVVLSTQHDPDVTLDRIRQDVIEQVIKPTIPADLLDDQTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGAARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAELAQKCEVQIAYAIGVAEPVSVYVNTFGTGTVAEAKLATAVRDLFDLRPAGIIQMLDLKRPIYKQTAAYGHFGRTDIDLPWEHTDKVDAL 390
>gi|15640499|ref|NP_230126.1| S-adenosylmethionine synthetase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|153824088|ref|ZP_01976755.1| S-adenosylmethionine synthase [Vibrio cholerae B33] >gi|194531159|ref|YP_002066673.1| S-adenosylmethionine synthase [Vibrio cholerae MO10] >gi|22095912|sp|Q9KUP3|METK_VIBCH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|9654898|gb|AAF93645.1| S-adenosylmethionine synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|125618173|gb|EAZ46717.1| S-adenosylmethionine synthase [Vibrio cholerae MO10] >gi|126518389|gb|EAZ75612.1| S-adenosylmethionine synthase [Vibrio cholerae B33] (385 aa)
Score = 808, Expect = 2.7e-84, Identities = 174/373 (46%), Positives = 242/373 (64%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M ++ + TSESV +GHPDKI DQISDAVLD   +QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  AH L++    V  N  + +++ D KSQVT  Y   +   ID +++S QHS + +T +  E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     1 MAIKHLFTSESVSEGHPDKIADQISDAVLDAIFEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRQTVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEVLMPAPITYAHRLMQRQAAVRKNGTLPWLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHSDSISTADLREAVMEEIIKPVLPAEWLSKETKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSQEIIIEAVRQFFDLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFP--WEATDKAALLRDF 381
>gi|156975823|ref|YP_001446730.1| S-adenosylmethionine synthetase [Vibrio harveyi ATCC BAA-1116] >gi|166201418|sp|A7MTQ7|METK_VIBHB S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|156527417|gb|ABU72503.1| hypothetical protein VIBHAR_03568 [Vibrio harveyi ATCC BAA-1116] (384 aa)
Score = 808, Expect = 2.7e-84, Identities = 173/370 (46%), Positives = 241/370 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  +H LV+   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    +  D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S + I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK E + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEILMPAPITYSHRLVQKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPSEWITKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQFFDLRPYGLQEILNLLQPIYKQTAAYGHFGREEFP--WEATDKAELLRDF 380
>gi|114566760|ref|YP_753914.1| S-adenosylmethionine synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318214|sp|Q0AXL1|METK_SYNWW S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|114337695|gb|ABI68543.1| methionine adenosyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (396 aa)
Score = 808, Expect = 2.9e-84, Identities = 156/369 (42%), Positives = 244/369 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKD-------------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           R + TSESV +GHPDK+ DQISDA+LD  ++ DP  +VA E      L+++ GEITT  YVD+ ++  + +  +GY  + +        ++++++ QS +I   V++              + IGAGDQG+++GYA++E    MP+PI +A  + +   +V     I +++ D K+QVT++Y D +  ++  +++S QH    +  +IE      +I  V+    +++     +N +G+F IGGP GD+GLTGRK++VDTYG +A+HGGGAFSGKD TKVDRS +Y  RY+AKNIVAA LA++CE+Q+++AIG + P++  V+TFGT K SD++I E+I   FD    + I   ++R PIY   + YGHFGR +    WE+ DK + + E
  S:     3 RTLFTSESVTEGHPDKVADQISDAILDAIMELDPYGRVAAETIVTTGLVLVAGEITTNCYVDIPRLVRSTIEDIGYTRAKYGFDAETCAVLTSLDEQSGDIALGVDRAFEAKKGEMDDKELDAIGAGDQGMMFGYASNETAVLMPMPIYLASKMAERLGEVRKEGIIPYLRPDGKTQVTVEYEDYKPLRVTTVVVSAQHHPEVSSATIEKDIIEHVIKAVIPPEMIDAHTIFYVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSASYMLRYVAKNIVAAGLAERCEIQVAYAIGVANPLSINVNTFGTGKISDDKIIELIKKNFDLRPAAIIRDLDLRRPIYRKTAAYGHFGREDAEFTWERTDKADTLRE 392
>gi|54310231|ref|YP_131251.1| S-adenosylmethionine synthetase [Photobacterium profundum SS9] >gi|60390018|sp|Q6LMM8|METK_PHOPR S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|46914672|emb|CAG21449.1| putative MetK, S-adenosylmethionine synthetase [Photobacterium profundum SS9] (384 aa)
Score = 807, Expect = 3.4e-84, Identities = 171/370 (46%), Positives = 243/370 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY       D +   ++S +  QS +I   V++++  ++GAGDQG+++GYA+DE +  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS       + E+    II  V+    L  + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  ++TFGT K S + I + +   FD      IE  ++  PIY   + YGHFGR E    WE  DKVE + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRETIREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDREDPRELGAGDQGIMFGYASDETDVLMPAPVTYAHRLVQRQAKVRKNGTLPWLRPDAKSQVTFAYDQGKIVGIDAVVLSTQHSDCIDLPVLQEAVMEEIIKPVLPAEWLTKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLASRCEIQLSYAIGVADPTSIMIETFGTEKVSHDIIVDAVRQNFDLRPYGLIEMLDLLQPIYKKTAAYGHFGREEFP--WEATDKVEMLRDF 380
>gi|90412049|ref|ZP_01220056.1| S-adenosylmethionine synthetase [Photobacterium profundum 3TCK] >gi|90327027|gb|EAS43406.1| S-adenosylmethionine synthetase [Photobacterium profundum 3TCK] (384 aa)
Score = 807, Expect = 3.8e-84, Identities = 172/370 (46%), Positives = 243/370 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY       D +   ++S +  QS +I   V++++  ++GAGDQG+++GYA+DE +  MP P+  AH LV+   +V  N  + +++ D KSQVT  Y   +   ID +++S QHS       + E+    II  V+    L  + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA +CE+QLS+AIG + P +  V+TFGT K S + I + +   FD      IE  ++  PIY   + YGHFGR E    WE  DKVE + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRETVREIGYVNSEMGFDANSCAVLSAIGKQSPDINQGVDREDPRELGAGDQGIMFGYASDETDVLMPAPVTYAHRLVERQAKVRKNGTLPWLRPDAKSQVTFAYDQGKIVGIDAVVLSTQHSDCIDLPVLQEAVMEEIIKPVLPAEWLTKETKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAARCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIVDAVRQNFDLRPYGLIEMLDLLQPIYKKTAAYGHFGREEFP--WEATDKVEMLRDF 380
>gi|56707319|ref|YP_169215.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669789|ref|YP_666346.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis FSC198] >gi|123359630|sp|Q14JT0|METK_FRAT1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|60389893|sp|Q5NIC7|METK_FRATT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56603811|emb|CAG44782.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320122|emb|CAL08165.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis FSC 198] >gi|151568242|gb|EDN33896.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis FSC033] (386 aa)
Score = 807, Expect = 3.8e-84, Identities = 171/368 (46%), Positives = 249/368 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNS----DFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LDE LKQD N++VACE      + ++ GEITT+ +VD+ ++  NV+   GYD +         ++I+ +  QS +I   V++ +   +GAGDQG+++G+AT+E    MP  I  +H L++   ++  + K+ +++ D K+QVT+ Y + +   ID I++S QH+++ +++ +    +A+I+ +VKK   N     D K  IN +G F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRSGAY  RYIAKNIVAA LA KCEVQ+++AIG +KP++  V+TFGT K +D QI +++   FD  +   IE  ++  PIY   S YGHFGR      WE++DK +
  S:     1 MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACETLVKTGMALVAGEITTSAWVDIEELVRNVITETGYDNASKGIDGRTCSVINAIGKQSRDITQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLRPDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELH---DAVIEEIVKKVIPNELITKDTKYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGRYIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVGKIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKAD 378
>gi|153826544|ref|ZP_01979211.1| S-adenosylmethionine synthase [Vibrio cholerae MZO-2] >gi|149739636|gb|EDM53850.1| S-adenosylmethionine synthase [Vibrio cholerae MZO-2] (385 aa)
Score = 807, Expect = 3.9e-84, Identities = 173/373 (46%), Positives = 242/373 (64%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           M ++ + TSESV +GHPDKI DQISDAVLD   +QDP ++VACE +    ++++GGEITT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E E  MP PI  AH L++   +V  N  + +++ D KSQVT  Y   +   ID +++S QH  + +T +  E+    II  V+    L+ + K  IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     1 MAIKHLFTSESVSEGHPDKIADQISDAVLDAIFEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEEITRQTVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETEVLMPAPITYAHRLMQRQAEVRKNGTLPWLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSISTPDLREAVMEEIIKPVLPAEWLSKETKYFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSQEIIIEAVRQFFDLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFP--WEATDKAALLRDF 381
>gi|154508787|ref|ZP_02044429.1| hypothetical protein ACTODO_01296 [Actinomyces odontolyticus ATCC 17982] >gi|153798421|gb|EDN80841.1| hypothetical protein ACTODO_01296 [Actinomyces odontolyticus ATCC 17982] (395 aa)
Score = 807, Expect = 3.9e-84, Identities = 159/367 (43%), Positives = 246/367 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEK------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQH----SQNATKESIESFCNAIIDFVVKKYNL---NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +++ +SESV +GHPDK+CD++SDA+LD  L  DP S+VA E  AA  LI I GE+TT  YV++ ++    ++ +GYD S          +  +++ QS +I   V++             +++GAGDQG+++GYA+ +  + MP PI +AH L K    V     ++ ++ D K+QVT+ YAD +   ID +++S QH    SQ+A  +++  +   +I+ V+++  L         +IN SG+F +GGP  D GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS  Y AR++AKN+VAA +A++CE+QL++AIG ++PI   VDTFGT+   +++I + I   FD      IE  ++  PIY   + YGHFGR +    WE  ++VE++
  S:     3 QQLFSSESVTEGHPDKVCDRVSDAILDALLAADPRSRVAVETMAATGLIHIAGEVTTEAYVEIPEIVRREILSIGYDSSRVGFDGASCGVSVSLDGQSPDIAGGVDEALEVRGTQGGDPRDRLGAGDQGIMFGYASSDTPDLMPAPIWLAHRLAKRLTDVRKQGIVEGLRPDGKTQVTLAYADGRPVGIDTVVVSTQHDEALSQSAITDAVRDY---VINPVIEESGLALATGSMTTLINPSGRFVLGGPAADAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSATYAARWVAKNVVAAGIAQRCEIQLAYAIGRARPIGLYVDTFGTTSVPEDRIADAIREVFDLRPLGMIEDLDLLRPIYRETAAYGHFGRDQFP--WEATNRVEQL 390
>gi|68342504|gb|AAY90152.1| S-adenosylmethionine synthetase [Helicobacter pylori SS1] (385 aa)
Score = 807, Expect = 3.9e-84, Identities = 166/371 (44%), Positives = 242/371 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + TSESV +GHPDK+ DQISDAVLD  +++D  +KVACE   +N   +I GE+ T+ Y  + ++A  V+  +GY ++ +        +++ V  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI++AH L     Q   +  + F++ D KSQV++ Y +++   ID I++S QHS   +++ + E+    I+  V+ K  L+ + K  +N +GKF IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ +  K  VQL++AIG  +P++  V+T  TSKYS  ++ + +   F  + K  IE  ++  PIYS  S YGHFGR      WE+ +K EEI  F K+
  S:     6 LFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACETLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGVGEQSPDINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLTFALAQKRKDNTLPFLRPDGKSQVSVRYENNKPVSIDTIVISTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLHDNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSIYVNTHNTSKYSSAELEKCVKAVFKLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKAEEIKAFFKR 385
>gi|89257008|ref|YP_514370.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica] >gi|115315368|ref|YP_764091.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica OSU18] >gi|118498131|ref|YP_899181.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. novicida U112] >gi|156503208|ref|YP_001429273.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009388|ref|ZP_02274319.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica FSC200] >gi|187931088|ref|YP_001891072.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. mediasiatica FSC147] >gi|194323358|ref|ZP_03057142.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. novicida FTE] >gi|122324645|sp|Q0BKD0|METK_FRATO S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|158512426|sp|A0Q862|METK_FRATN S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|166201392|sp|A7NEB4|METK_FRATF S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|109892633|sp|Q2A1N2|METK_FRATH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|89144839|emb|CAJ80178.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica LVS] >gi|115130267|gb|ABI83454.1| methionine adenosyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|118424037|gb|ABK90427.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. novicida U112] >gi|134254071|gb|EBA53165.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica 257] >gi|151571208|gb|EDN36862.1| hypothetical protein FTCG_01077 [Francisella tularensis subsp. novicida GA99-3549] >gi|151572661|gb|EDN38315.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. novicida GA99-3548] >gi|156253811|gb|ABU62317.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122817|gb|EDO66946.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. holarctica FSC022] >gi|187711997|gb|ACD30294.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. mediasiatica FSC147] >gi|194322722|gb|EDX20202.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. novicida FTE] (386 aa)
Score = 807, Expect = 3.9e-84, Identities = 171/368 (46%), Positives = 249/368 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNS----DFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LDE LKQD N++VACE      + ++ GEITT+ +VD+ ++  NV+   GYD +         ++I+ +  QS +I   V++ +   +GAGDQG+++G+AT+E    MP  I  +H L++   ++  + K+ +++ D K+QVT+ Y + +   ID I++S QH+++ +++ +    +A+I+ +VKK   N     D K  IN +G F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRSGAY  RYIAKNIVAA LA KCEVQ+++AIG +KP++  V+TFGT K +D QI +++   FD  +   IE  ++  PIY   S YGHFGR      WE++DK +
  S:     1 MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACETLVKTGMALVAGEITTSAWVDIEELVRNVITETGYDNASKGIDGRTCSVINAIGKQSRDIAQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLRPDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELH---DAVIEEIVKKVIPNELITKDTKYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGRYIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVGKIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKAD 378
>gi|161353738|ref|NP_488164.2| S-adenosylmethionine synthetase [Nostoc sp. PCC 7120] (420 aa)
Score = 807, Expect = 3.9e-84, Identities = 170/368 (46%), Positives = 246/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAV-------EKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESI-ESFCNAIIDFVVKKYNLNSD--FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISD +LD  L QDP S+VA EV     L++I GEITT   V+   +A   +  +GY  +D        ++I  ++ QS +I   V       E+D     ++IGAGDQG+++G+A +E    MPLPI +AH + +    V    ++ +++ D K+QVT+ Y D +   ID +++S QH+        + A +  I +    A+++ V     +  D   + ++N +GKF IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKN+VAA LA+KCEVQLS+AIG ++P++  +DTFGT K  DE + E++ + F+      I  FN+R+         Y   + YGH GR +L+  WE+ DK +
  S:     1 MSRRYLFTSESVTEGHPDKICDQISDTILDTLLAQDPTSRVAAEVVVNTGLVLITGEITTKANVNYANIARQKIAEIGYTNADNGFSANSTSVIVALDEQSPDIAQGVNTAQETREQDSEELFDKIGAGDQGIMFGFACNETPELMPLPICLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTVLISTQHTATIGDITDEAAVQAKIKQDLWTAVVEPVFGDLEIKPDQETRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLAEKCEVQLSYAIGVARPVSIFLDTFGTGKVDDEILLELVKDNFELRPAGIIHSFNLRNLPSERGGRFYQDVAAYGHLGRNDLDLPWERTDKAD 405
>gi|160894990|ref|ZP_02075764.1| hypothetical protein CLOL250_02540 [Clostridium sp. L2-50] >gi|156863421|gb|EDO56852.1| hypothetical protein CLOL250_02540 [Clostridium sp. L2-50] (467 aa)
Score = 807, Expect = 4.0e-84, Identities = 162/368 (44%), Positives = 236/368 (64%)
  Q:     3 LRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAVEKDNQ-------------IGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIE-SFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKY-SDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +++  T+ESV +GHPDK+CD I+D++LD CLK+D NS+VACEV A  R I++ GEIT+     V ++   VL   GY+  +  + + ++ QS +I  AVE+  +              G GDQG++ GYA DE    MP+P+ +A+ +V+       +  I  I  D K+QVT++Y D +  ++D +I+S QH +  +   +E      ++   ++    + D K +IN SG+F  GG   DTGLTGRKLMVDTYGSL  HGGGAFSGKDC+KVDRSGAY ARYIAKN+VAA LA +C+V L++AIG ++P+   VDTFGT K  +D+ +   I   F  +     +  +++ PIY   + +GHFGR E    WE+ DK E++
  S:    82 MKRFYTAESVTEGHPDKLCDLIADSILDACLKEDENSRVACEVLATKRNIIVAGEITSRFEPQVFEIIKKVLESAGYEAEEIHMDALIHKQSPDIAGAVERSRERRAGTVFVQSGLASGTGDQGIMIGYACDETPQLMPMPVVLANRIVRELSASRRSGYITGILPDGKAQVTVEYEDDRPARLDTVIVSCQHEKEKSLRKLEHEIREKVLRPALRMLPPDEDTKILINPSGRFVCGGLDADTGLTGRKLMVDTYGSLVPHGGGAFSGKDCSKVDRSGAYMARYIAKNMVAAGLASRCQVSLAYAIGVAQPVMVQVDTFGTGKICADDCLAAAIPLVFGLTPSQICDTLHLKRPIYRQSAVFGHFGRKEFP--WEKTDKAEQL 462
>gi|33860869|ref|NP_892430.1| S-adenosylmethionine synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|44888143|sp|Q7V2Y8|METK_PROMP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33633811|emb|CAE18770.1| S-adenosylmethionine synthetase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (413 aa)
Score = 807, Expect = 4.1e-84, Identities = 175/370 (47%), Positives = 251/370 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEK--------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESIES--FCNAII----DFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQL-DKVEEILEFTK 375
           I TSESV +GHPDKICDQISDAVLD  L +DP S+VACE      L ++ GEIT+   +D +K+   V+  +GY        D +   ++  ++ QS +I   V +        +N  GAGDQG+++GYA DE    MPLPI++AH L     +V     +D++  D K+QV+IDY       I+ I++S QH+        +   ++ I+   + N ++    D  +K  N  + F  ++N +GKF +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AK+IV AKLAKK EVQLS+AIG +KPI+  V+TFGT   S + + E+I N FD    + I++F++R+         +   ++YGHFGR +LN  WE++ +K  +++E +K
  S:     5 IFTSESVTEGHPDKICDQISDAVLDALLSEDPESRVACETVVNTGLCLLTGEITSRAKLDYIKLVRKVIKEIGYEGSKAGGFDSNSCAVLVALDEQSPDISQGVNEADDINEDLENNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLAKVRHEKVLDYLLPDGKTQVSIDYKKGVPVSINTILISTQHTAEIDGITNEEEIRQKIKEDLWINVVLPATEDLEIKPSNQKTRF--LVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVETFGTGIISQDNLKELIKNNFDLRPAAIIKEFDLRNLPKKMGGEFFRKTASYGHFGRNDLNLPWERVEEKSAQLVEASK 410
>gi|21230235|ref|NP_636152.1| S-adenosylmethionine synthetase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|24211978|sp|Q8PCH3|METK_XANCP S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|21111778|gb|AAM40076.1| methionine adenosyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] (403 aa)
Score = 807, Expect = 4.2e-84, Identities = 165/365 (45%), Positives = 245/365 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR---------------TELNPGWEQLDKVEEI 370
           + TSESV +GHPDKI DQISDAVLD  L QD  ++VACE      + ++ GE+TT+ ++D+  +   V++ +GY+ SD         +++ +  QS +I   V++ N  Q GAGDQG+++GYAT+E +++MP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y D     ID +++S  H      K+ IE+    I+  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K +DE I ++I   FD      I+  ++  P+Y   ++YGHFGR               +  +  WE+ D+ E +
  S:     5 LFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTHHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADELIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRAEAL 396
>gi|134301358|ref|YP_001121326.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis WY96-3418] >gi|158513848|sp|A4IWA4|METK_FRATW S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|134049135|gb|ABO46206.1| S-adenosylmethionine synthetase [Francisella tularensis subsp. tularensis WY96-3418] (386 aa)
Score = 807, Expect = 4.3e-84, Identities = 171/368 (46%), Positives = 250/368 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNS----DFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LDE LKQD N++VACE      + ++ GEITT+ +VD+ ++  NV+   GYD +         ++I+ ++ QS +I   V++ +   +GAGDQG+++G+AT+E    MP  I  +H L++   ++  + K+ +++ D K+QVT+ Y + +   ID I++S QH+++ +++ +    +A+I+ +VKK   N     D K  IN +G F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRSGAY  RYIAKNIVAA LA KCEVQ+++AIG +KP++  V+TFGT K +D QI +++   FD  +   IE  ++  PIY   S YGHFGR      WE++DK +
  S:     1 MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACETLVKTGMALVAGEITTSAWVDIKELVRNVITETGYDNASKGIDGRTCSVINAIDKQSRDITQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLRPDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELH---DAVIEEIVKKVIPNELITKDTKYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGRYIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVGKIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKAD 378
>gi|169796186|ref|YP_001713979.1| methionine adenosyltransferase [Acinetobacter baumannii AYE] >gi|169149113|emb|CAM86990.1| methionine adenosyltransferase [Acinetobacter baumannii] (388 aa)
Score = 806, Expect = 4.5e-84, Identities = 165/370 (44%), Positives = 237/370 (64%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV--EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPG--WEQLDKVEEI 370
           M    + TSESV +GHPDK+ DQISDA+LD  LK+DP ++VACE       +V+ GEITT   +DV  +    +  +GY  SD         +I+ +  QS EI   V  +K    GAGDQG+++GYA+ E +  MP PI+ AH L++   ++  +  + +++ D KSQVT  Y + +  ++D +++S QH    T+  + E+    II  ++     ++  K  IN +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +++TFGT+K SDE I +++   FD          N+  P+Y   + YGHFGR   N    WE+ DKVE +
  S:     1 MREYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVDRQKPEDQGAGDQGLMFGYASRETDVLMPAPISYAHRLMERQAELRRSGALPWLRPDAKSQVTFAYENGKPVRLDAVVLSTQHDPEITQTQLKEAVIEEIIKPIIPAEMFHAATKFHINPTGMFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSISINTFGTAKVSDELIIQLVREHFDLRPFGITRMLNLIQPMYKQTAAYGHFGREGSNTAFTWEKTDKVEAL 382
>gi|118468007|ref|YP_887371.1| S-adenosylmethionine synthetase [Mycobacterium smegmatis str. MC2 155] >gi|158512468|sp|A0QWT3|METK_MYCS2 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|48428371|sp|Q7WYN1|METK_MYCSM S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|32330659|gb|AAP79876.1| methionine adenosyltransferase [Mycobacterium smegmatis] >gi|118169294|gb|ABK70190.1| S-adenosylmethionine synthetase [Mycobacterium smegmatis str. MC2 155] (399 aa)
Score = 806, Expect = 4.5e-84, Identities = 157/370 (42%), Positives = 239/370 (64%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVEKDNQI------------GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI------ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           M   ++ TSESV +GHPDKICD ISD+VLD  L+QDP S+VA E       + + GE+TT  Y D+ K+  + ++ +GYD S          +   + +QS +I   V+  ++             GAGDQG+++GYA  +    MPLPI +AH L +   +V  N  +D+++ D K+QVTI Y  +   ++D +++S QH+     E        E   N ++  +  +    SD++ ++N +GKF +GGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA++ EVQ+++AIG + P+   V+TFG+      +I + I   FD    + +   ++  PIY+P + YGHFGRT++   WEQ +KV+++
  S:     1 MSKGRLFTSESVTEGHPDKICDAISDSVLDALLEQDPKSRVAVETLVTTGQVHVAGEVTTTAYADIPKIVRDRILDIGYDSSTKGFDGASCGVNVAIGAQSPDIAQGVDTAHETRVEGKADPLDLQGAGDQGLMFGYAIGDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTIQYDGTTPVRLDTVVLSTQHADGIDLEGTLTPDIREKVVNTVLADLGHETLDTSDYRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSETVDPAKIEKAIGEVFDLRPAAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQTNKVDDL 395
>gi|59711046|ref|YP_203822.1| S-adenosylmethionine synthetase [Vibrio fischeri ES114] >gi|163730591|ref|ZP_02138064.1| S-adenosylmethionine synthetase [Vibrio fischeri MJ11] >gi|75507092|sp|Q5E7R2|METK_VIBF1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|59479147|gb|AAW84934.1| methionine adenosyltransferase 1 [Vibrio fischeri ES114] >gi|161396225|gb|EDQ20521.1| S-adenosylmethionine synthetase [Vibrio fischeri MJ11] (384 aa)
Score = 806, Expect = 4.8e-84, Identities = 173/370 (46%), Positives = 240/370 (64%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +  + GAGDQG+++GYAT+E    MP PI  +H LV+   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    LN D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K S + I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGVDKADPKEQGAGDQGIMFGYATNETPILMPAPITYSHLLVQKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPAEWLNKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQNFDLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFP--WEATDKAAILRDF 380
>gi|56477671|ref|YP_159260.1| S-adenosylmethionine synthetase [Azoarcus sp. EbN1] >gi|60389895|sp|Q5P2V5|METK_AZOSE S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56313714|emb|CAI08359.1| S-Adenosylmethionine synthase; Methionine adenosyltransferase (EC 2.5.1.6), MetK [Azoarcus sp. EbN1] (388 aa)
Score = 806, Expect = 4.9e-84, Identities = 164/366 (44%), Positives = 241/366 (65%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK----DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           M    + TSESV +GHPDK+ DQ+SD VLD  L  DP ++VACE   +  L+VI GEITT  + +  ++A  V+  +GYD SD         +++ +N QS +I   V +    D   GAGDQG+++GYA +E  + +PLPI  AH +++   ++  + ++++++ D KSQ+T+ Y D +   ID +++S QHS   +   I E     II  V+    +  + + +IN +G+F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY  R++AKNIVAA LA +CEVQ+++AIG ++P++  ++TFGT + +DE+I E++   FD   K+ I++ N+  PIY   + YGHFGR E    WE  DK
  S:     1 MSKEYLFTSESVSEGHPDKVADQVSDGVLDAILATDPQARVACETLVSTGLVVISGEITTTAHPNYREIAQEVIRRIGYDNSDIGFDYKSCAVLAAINRQSADIAQGVNEGEGLDLDQGAGDQGLMFGYACNETPSLIPLPIYYAHRIMQRQSELRKDGRLNWLRPDAKSQLTVRYVDGKPVAIDTVVVSTQHSPEVSHAQITELVIEEIIKPVLPSALMQGEVRYLINPTGRFVIGGPHGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAGRWVAKNIVAAGLADRCEVQVAYAIGVARPVSMMIETFGTGRITDEKIVELVQRHFDLRPKAIIQELNLLRPIYGKTAAYGHFGRDEPEFTWEATDK 378
>gi|33519717|ref|NP_878549.1| S-adenosylmethionine synthetase [Candidatus Blochmannia floridanus] >gi|44888148|sp|Q7VRG5|METK_BLOFL S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33504062|emb|CAD83323.1| S-adenosylmethionine synthetase [Candidatus Blochmannia floridanus] (385 aa)
Score = 806, Expect = 4.9e-84, Identities = 177/365 (48%), Positives = 245/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY-------DESDFTIISNVNSQSNEIFNAVEKDN---QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP--KIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R + TSESV  GHPDKI DQISD++LD  L+QDP ++VACE +    +++IGGEITT   V++ K+A N +  +GY       D +   I+S +N QS EI  ++  D+   Q GAGDQG ++GYAT+E +  MP PI  AH L++   ++  N  + ++  D KSQ+T  Y D  N    I  +++SVQH++N   E++ E+    II  V+ +  L+   K  IN+ G FTIG PI D GLTGRK++VDTYG +A+HGGG+FSGKD +KVDRS AY ARY AKNIVAA LA++CE+QL++AIG + PIA  ++TFGT K     +  +I N FDFS    I+  N+  PIY   + YGHFGR +    WE++DKV+
  S:     3 RFLFTSESVSAGHPDKIADQISDSILDSILEQDPKARVACETYIKTGIVLIGGEITTTASVNIEKIARNTIQEIGYTHPKMGLDANSCVILSVINQQSPEIQYSINHDSDRTQQGAGDQGSMFGYATNETDVLMPAPITYAHRLIQRKSKLRKNGTLPWLGLDAKSQITFAY-DENNKIIHITAVVLSVQHNKNIPLEALREATMEEIIKPVLPQKWLSKQTKFFINSGGTFTIGSPISDCGLTGRKIIVDTYGGMARHGGGSFSGKDPSKVDRSAAYAARYAAKNIVAAGLAERCEIQLAYAIGIANPIAVNIETFGTEKVLHSTLVTLINNFFDFSPHGVIKMLNLARPIYKDTAVYGHFGREQFP--WEKIDKVD 377
>gi|60389892|sp|Q5N1I9|METK_SYNP6 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|56686609|dbj|BAD79831.1| S-adenosylmethionine synthetase [Synechococcus elongatus PCC 6301] (406 aa)
Score = 806, Expect = 5.5e-84, Identities = 170/357 (47%), Positives = 243/357 (68%)
  Q:    14 KGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--DESDF-----TIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESIES------FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNM-RSP------IYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           +GHPDKICDQISD +LD  L +DP+S+VA EV     L++I GE++T    +++ +A   +   GY  ++S F     T++  ++ QS +I   V            E+ + IGAGDQG+++GYA +E    MPLPI+++H L +    V  N ++D+++ D K+QVTI Y D +   ID I++S QH          NA +E I+S            D V++    +S  + ++N +GKF IGGP GD GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY  RY+AKNIVAA LA+KCEVQLS+AIG ++P++  V+TFGT K +DE + +++   F+      IE FN+ R P       Y   + YGHFGR +L+  WEQ DK + +
  S:     3 EGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAETGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQP---DSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELHPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTL 396
>gi|84394075|ref|ZP_00992811.1| S-adenosylmethionine synthetase [Vibrio splendidus 12B01] >gi|84375317|gb|EAP92228.1| S-adenosylmethionine synthetase [Vibrio splendidus 12B01] (384 aa)
Score = 805, Expect = 5.9e-84, Identities = 173/370 (46%), Positives = 239/370 (64%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  L+QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +    GAGDQG+++GYAT+E    MP PI  +H LVK   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    +N D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K + E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDADSCAVLNTIGKQSPDINQGVDKADPKDQGAGDQGIMFGYATNETPILMPAPITYSHLLVKKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPAEWINKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVAHEIIIEAVRQNFDLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFP--WEATDKAAILADF 380
>gi|190572825|ref|YP_001970670.1| putative S-adenosylmethionine synthetase [Stenotrophomonas maltophilia K279a] >gi|190010747|emb|CAQ44356.1| putative S-adenosylmethionine synthetase [Stenotrophomonas maltophilia K279a] (403 aa)
Score = 805, Expect = 6.0e-84, Identities = 162/349 (46%), Positives = 236/349 (67%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAVE--KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQV--IWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN-ATKESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR 354
           + TSESV +GHPDK+ DQISDAVLD  L QD  ++VACE      + ++ GEITT+ ++D+  +   V+  +GYD SD         +++ +  QS  I   V+  K  ++GAGDQG+++GYAT+E +++MP  I+++H LV+   ++    N+ + +++ D KSQVT+ Y +     ID +++S QH+     K+ IE+    II  V+    L+   K  IN +GKF IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKN+VAA LA +CEVQ+S+AIG ++P + +V TFGT K SD++I ++I   FD      I+  ++  P+Y   + YGHFGR
  S:     5 LFTSESVSEGHPDKVADQISDAVLDAILTQDQRARVACETMVKTGVAIVAGEITTSAWIDLEALTRKVITDIGYDSSDVGFDGATCGVLNLIGKQSPHIAQGVDRKKPEEMGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSPLSWLRPDAKSQVTLRYENGVVSAIDAVVLSTQHAPGIKQKDLIEAVREEIIKPVLPAKWLHKGTKFHINPTGKFEIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKISDDKIEKLIRKHFDLRPYGIIKMLDLIHPMYQQTAAYGHFGR 365
>gi|124025113|ref|YP_001014229.1| S-adenosylmethionine synthetase [Prochlorococcus marinus str. NATL1A] >gi|158512741|sp|A2C0F4|METK_PROM1 S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|123960181|gb|ABM74964.1| S-adenosylmethionine synthetase [Prochlorococcus marinus str. NATL1A] (409 aa)
Score = 805, Expect = 6.1e-84, Identities = 171/372 (45%), Positives = 242/372 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEKD--------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-----FCNAIIDFVVKKYNLNSDFKR-------IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           R + TSESV +GHPDKICDQ+SDAVLD CL +DP S+VACE      L +I GEIT+   VD  K+   V+  +GY        D +   ++  ++ QS++I   V +         +Q+GAGDQG+++G+A DE    MPLPI++AH L +    V     ID++  D K+QV++ Y +     ID I++S QH       ++E          +  FVV+    +   K        ++N +GKF IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY AR++AK +VAA LAKK EVQLS+AIG +KPI+  VD+FGT K SD ++ +++ + FD    + I+ F++++         Y   + YGHFGRT++   WE + +  + L   K
  S:     3 RYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKSIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQLIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFVVEPATEDLPLKPAKESTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVSDSELTQLVQDQFDLRPGAIIKAFDLQNLPSVRGGRFYRDTAAYGHFGRTDILLPWEDVSQKAKELSLLK 409
>gi|118594101|ref|ZP_01551448.1| S-adenosylmethionine synthetase [Methylophilales bacterium HTCC2181] >gi|118439879|gb|EAV46506.1| S-adenosylmethionine synthetase [Methylophilales bacterium HTCC2181] (385 aa)
Score = 805, Expect = 6.6e-84, Identities = 175/359 (48%), Positives = 241/359 (67%)
  Q:     8 TSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTI-------ISNVNSQSNEIFNAVE------KDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNAT-KESIESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDK 366
           TSESV +GHPDK+ DQISDA+LD  L+QDPN++VA E  AA  LIV+ GEIT+   VD   +A N L  +GYD  ++ I       +     QS +I   V+      KD   GAGDQG+++GYA +E  + MPLPI ++H LV+    +  + ++ +++ D KSQVTI Y +++   ID +++S QH+ +   K+  E+    II  ++    +  D K +IN +G+F +GGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRS AY ARY+AKNIVAA LA+KC VQLS+AIG +KP +  VDT GT   + E+I  ++++TFD   K  +E  ++  PIY   + YGHFGR E +  WE LDK
  S:     8 TSESVSEGHPDKVADQISDAILDAILEQDPNARVAAETMAATNLIVLAGEITSNSNVDYEHIARNTLKTIGYDNPEYGIDFKSCDVMVRYGEQSRDIGQGVDGAMDDPKDQ--GAGDQGIMFGYACNETIDLMPLPIWLSHRLVERQAMLRKDGRLPWLRPDAKSQVTIRYENNKPHSIDTVVLSTQHAPDIDLKDLREAVVEEIIKPILPSDLIKGDIKYLINPTGRFVVGGPEGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLAEKCLVQLSYAIGVAKPTSVMVDTLGTGTLAGEEISNLVLSTFDLRPKGIVEMLDLLRPIYKKTAAYGHFGRDEPDFTWESLDK 378
>gi|7387884|sp|Q9X4Q2|METK_STRST S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|4545257|gb|AAD22464.1|AF117274_2 S-adenosylmethionine synthetase [Streptomyces spectabilis] (411 aa)
Score = 805, Expect = 6.7e-84, Identities = 160/365 (43%), Positives = 243/365 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKK---------YNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y  + ++    ++ +GYD S          +  ++ +QS +I   V             E D Q GAGDQG+++GYA DE    MPLPI++AH L +   +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   ES+      I +FVV+            L ++ ++ ++N +G+F IGGP+GD GLTGRK+++DTYG +++HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+    ++I + I   FD    + I   ++  PIYS  + YGHFGR+     WE+ D+V+
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYAPIAQLVREKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYESRVEGDEDELDRQ-GAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLESL--LAPDIREFVVEPELKALVEDGIKLETEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMSRHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTNTIDTDKIEQAISEVFDLRPAAIIRDLDLLRPIYSQTAAYGHFGRSLPEFTWEKTDRVD 394
>gi|54025583|ref|YP_119825.1| S-adenosylmethionine synthetase [Nocardia farcinica IFM 10152] >gi|60389915|sp|Q5YTN0|METK_NOCFA S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|54017091|dbj|BAD58461.1| putative S-adenosylmethionine synthetase [Nocardia farcinica IFM 10152] (404 aa)
Score = 804, Expect = 8.1e-84, Identities = 155/366 (42%), Positives = 242/366 (66%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISN-------VNSQSNEIFNAVEK---------DNQI---GAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI--ESFCNAIIDFVVKKYNL-----NSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           ++ TSESV +GHPDKICD ISD++LD  L +DP S+VA E       + + GE+TT+ Y D+ ++    ++ +GYD S      N       + +QS +I   V+          D++I   GAGDQG+++GYAT +    MPLPI +AH L +   +V     + +++ D K+QVTI+Y   +  ++D +++S QH+ +   +++        ++D V+   +L      SD + ++N +GKF +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA L+++ EVQ+++AIG + P+   V+TFGT K    +I   I   FD    + I   ++  PIY+P + YGHFGRT+++  WE  D+ +++
  S:     7 RLFTSESVTEGHPDKICDAISDSILDALLAEDPRSRVAVETLVTTGQVHVAGEVTTSAYADIPRIVREKVLEIGYDSSAKGFDGNSCGVNIAIGAQSPDIAQGVDTSHEARVGGTDDEIAKQGAGDQGLMFGYATTDTPELMPLPIALAHRLSRKLTEVRKTGVLPYLRPDGKTQVTIEYDGDRPVRLDTVVISTQHAADIDLDNLLAPDIREKVVDAVLADLDLPSPLDTSDIRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLSERVEVQVAYAIGKAAPVGLFVETFGTEKVDPARIAAAITEVFDLRPGAIIRDLDLLRPIYAPTAAYGHFGRTDIDLPWEHTDRADKL 398
>gi|72383523|ref|YP_292878.1| S-adenosylmethionine synthetase [Prochlorococcus marinus str. NATL2A] >gi|109892650|sp|Q46H57|METK_PROMT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|72003373|gb|AAZ59175.1| methionine adenosyltransferase [Prochlorococcus marinus str. NATL2A] (409 aa)
Score = 804, Expect = 9.5e-84, Identities = 171/372 (45%), Positives = 242/372 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEKD--------NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-----FCNAIIDFVVKKYNLNSDFKR-------IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTK 375
           R + TSESV +GHPDKICDQ+SDAVLD CL +DP S+VACE      L +I GEIT+   VD  K+   V+  +GY        D +   ++  ++ QS++I   V +         +Q+GAGDQG+++G+A DE    MPLPI++AH L +    V     ID++  D K+QV++ Y +     ID I++S QH       ++E          +  FVV+    +   K        ++N +GKF IGGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY AR++AK +VAA LAKK EVQLS+AIG +KPI+  VD+FGT K SD ++ +++ + FD    + I+ F++++         Y   + YGHFGRT++   WE + +  + L   K
  S:     3 RYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKNIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQLIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFVVEPATEDLPLKPAKGSTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVSDSELTQLVQDQFDLRPGAIIKAFDLQNLPSIRGGRFYRDTAAYGHFGRTDILLPWEDVSQKAKELSLLK 409
>gi|194342462|gb|EDX23428.1| S-adenosylmethionine synthetase [Streptomyces sp. Mg1] (402 aa)
Score = 803, Expect = 1.0e-83, Identities = 163/367 (44%), Positives = 244/367 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKY--NLNSD--------FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISD +LD  L +DP S+VA E      L+ I GE+TT  Y  + ++  + ++ +GYD S          +  ++ +QS +I   V             E D Q GAGDQG+++GYA DE    MPLPI+IAH L +   +V  N  I +++ D K+QVTI+Y   +  ++D +++S QH+ +   +S+      I +FVV+     L  D        ++ ++N +G+F IGGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+K   ++I + I   FD    + I   ++  PIY+  + YGHFGR   +  WE+ D+V+ +
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLTEDPTSRVAVETLITTGLVHIAGEVTTKAYAPIAQLVRDKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYETRVEGDEDELDKQ-GAGDQGLMFGYACDETPELMPLPIHIAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHAADIDLDSL--LAPDIREFVVEHVLAQLVEDGIKLETEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTAKVEVQKIEDAIGQVFDLRPAAIIRDLDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDAL 396
>gi|116010464|emb|CAJ43278.1| SAM synthetase [Streptomyces peucetius ATCC 27952] (402 aa)
Score = 803, Expect = 1.1e-83, Identities = 158/367 (43%), Positives = 242/367 (65%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAV-------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNA--TKESIESFCNAIIDFVVKKY-----NLNSDFKRI-INNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEI 370
           R++ TSESV +GHPDKI DQISD +LD  L++DP S+VA E      L+ + GE+TT  Y DV  +  N ++ +GYD S          +  ++ +QS +I   V             E D Q GAGDQG+++GYATDE  + MPLPI +AH L +   +V  +    +++ D K+QVTI+Y  S+  ++D +++S QH+ +   T          +++ V+         L +D  R+ +N +G+F +GGP+GD GLTGRK+++DTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CEVQ+++AIG ++P+   V+TFGT+  + ++I + I   FD    + I   ++  P+Y+  + YGHFGR   +  WE+ D+ + +
  S:     3 RRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADVPTLVRNKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYEKRVEGDEDELDRQ-GAGDQGLMFGYATDETPSLMPLPIELAHRLSRRLTEVRKDGTFPYLRPDGKTQVTIEYRGSRPVRLDTVVVSSQHAADIDLTSRLTPDIREHVVEHVLAALAEDGIELETDKHRLLVNPTGRFEVGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAAVAQDRIEKAITQVFDLRPAAIIRDLDLLRPVYAATAAYGHFGRELPDFTWERTDRADAL 396
>gi|57340126|gb|AAW50050.1| hypothetical protein FTT0149 [synthetic construct] (421 aa)
Score = 803, Expect = 1.1e-83, Identities = 171/368 (46%), Positives = 249/368 (67%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIESFCNAIIDFVVKKYNLNS----DFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M    + TSESV +GHPDK+ DQISDA+LDE LKQD N++VACE      + ++ GEITT+ +VD+ ++  NV+   GYD +         ++I+ +  QS +I   V++ +   +GAGDQG+++G+AT+E    MP  I  +H L++   ++  + K+ +++ D K+QVT+ Y + +   ID I++S QH+++ +++ +    +A+I+ +VKK   N     D K  IN +G F IGGP GD GLTGRK++VDTYG  A HGGGAFSGKD +KVDRSGAY  RYIAKNIVAA LA KCEVQ+++AIG +KP++  V+TFGT K +D QI +++   FD  +   IE  ++  PIY   S YGHFGR      WE++DK +
  S:    27 MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACETLVKTGMALVAGEITTSAWVDIEELVRNVITETGYDNASKGIDGRTCSVINAIGKQSRDITQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLRPDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELH---DAVIEEIVKKVIPNELITKDTKYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGRYIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVGKIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKAD 404
>gi|33866519|ref|NP_898078.1| S-adenosylmethionine synthetase [Synechococcus sp. WH 8102] >gi|44888141|sp|Q7U4S6|METK_SYNPX S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|33633297|emb|CAE08502.1| S-adenosylmethionine synthetase [Synechococcus sp. WH 8102] (419 aa)
Score = 803, Expect = 1.2e-83, Identities = 168/373 (45%), Positives = 247/373 (66%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGY--------DESDFTIISNVNSQSNEIFNAVEKDN--------QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESI-ESFCNAIIDFVVKKYNLNSD---FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQL-DKVEEILEFTKK 376
           R + TSESV +GHPDKICDQ+SDAVLD  L QDP+S+VACE      L +I GE+T+   VD + +  NV+  +GY        D +   ++  ++ QS +I   V++ +        ++GAGDQG+++GYA +E    MPLPI++AH L K   +V  N  ++++  D K+QV++ Y + +   ID I++S QH+        +   +E I E     +++       L       K ++N +GKF +GGP GD GLTGRK++VDTYG  A+HGGGAFSGKD TKVDRS AY ARY+AK +VA+ LA++ EVQLS+AIG +KP++  V++FGT K S+ ++ E++   FD    + IE F +R+         Y   + YGHFGR +L   WE +  K EE+++   K
  S:     3 RYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVDEADDHEGDPLDRVGAGDQGIMFGYACNETPELMPLPISLAHRLAKRLAEVRHNGSLEYLLPDGKTQVSVVYENDKPVAIDTILISTQHTAEVAGISDEQGIRERITEDLWTHVVEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVASGLAERAEVQLSYAIGVAKPVSILVESFGTGKVSNAELTELVQEHFDLRPGAIIETFGLRNLPQQRGGRFYQDTAAYGHFGRNDLKAPWEDVAAKSEELVKAEAK 411
>gi|86146388|ref|ZP_01064712.1| S-adenosylmethionine synthetase [Vibrio sp. MED222] >gi|85835867|gb|EAQ54001.1| S-adenosylmethionine synthetase [Vibrio sp. MED222] (383 aa)
Score = 803, Expect = 1.2e-83, Identities = 172/370 (46%), Positives = 239/370 (64%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDN--QIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEF 373
           + + TSESV +GHPDKI DQISDAVLD  ++QDP ++VACE +    ++++GGE+TT+ +VD+ ++    +  +GY  SD         +++ +  QS +I   V+K +    GAGDQG+++GYAT+E    MP PI  +H LVK   +V  + K+DF++ D KSQVT  Y   +   ID +++S QH  + T   + E+    II  V+    +N D    IN +G+F IGGP+GD GLTGRK++VDTYG  A+HGGGAFSGKD +KVDRS AY ARY+AKNIVAA +A +CE+QLS+AIG + P +  V+TFGT K + E I E +   FD       E  N+  PIY   + YGHFGR E    WE  DK   + +F
  S:     3 KHLFTSESVSEGHPDKIADQISDAVLDAIIEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDADSCAVLNTIGKQSPDINQGVDKADPKDQGAGDQGIMFGYATNETPILMPAPITYSHLLVKKQAEVRKSGKLDFLRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPAEWINKDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVAHEIIIEAVRQNFDLRPYGLQEMLNLLQPIYKQTAAYGHFGREEFP--WEATDKAAILADF 380
>gi|118727417|ref|ZP_01576018.1| Methionine adenosyltransferase [Clostridium cellulolyticum H10] >gi|118663176|gb|EAV69836.1| Methionine adenosyltransferase [Clostridium cellulolyticum H10] (394 aa)
Score = 802, Expect = 1.4e-83, Identities = 170/374 (45%), Positives = 238/374 (63%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFTIISNVNSQSNEIFNAV-----------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESIES-FCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKKY 377
           ++ +T+ESV  GHPDK+CD I+D++L+ CL++D  S+VACEV A    I++ GEI  +  V++  +  NVL  +GY+   F I   V++QS +I   V           E+   IGAGDQG +YGYAT E    +PLP+ ++H +VK  +       I  I  D K+QVT++Y D    +I  I++SVQH +N T E +++   N ++    + +  + + + +IN SG+F +GGP  DTGLTGRK+MVDTYG LA HGGGA  GKD TKVDRSGAY ARYIAK+IV    AKKCEV +S+AIG + P+AF V+T GT   SDE +      TF+    + IEK  +R+ IYS  + YGHF    L P WE ++K  E  +  +KY
  S:     9 KRYLTAESVCAGHPDKLCDIIADSILEACLRKDKASRVACEVMATKGKIIVAGEIFCSEKVNIRDIVKNVLKDVGYNPLKFLIYVYVHNQSVDIAAGVNTALEARNGINEQYGSIGAGDQGTMYGYATKETREMLPLPLVLSHRIVKRLDDCRKGKLIKGIFPDGKAQVTVEYEDDTPVRIKTIVISVQHDKNKTLEELKAGILNNVLWQCFEDFPFDDETELLINPSGQFVLGGPAADTGLTGRKIMVDTYGGLASHGGGALCGKDPTKVDRSGAYMARYIAKHIVWCGYAKKCEVSISYAIGKANPVAFTVNTLGTGTVSDEILTLAAQETFNLRPAAIIEKLRLRNVIYSDTAVYGHFNSC-LFP-WEDVNKYSEFRKAVEKY 392
>gi|119492681|ref|ZP_01623860.1| S-adenosylmethionine synthetase [Lyngbya sp. PCC 8106] >gi|119453019|gb|EAW34190.1| S-adenosylmethionine synthetase [Lyngbya sp. PCC 8106] (438 aa)
Score = 802, Expect = 1.5e-83, Identities = 167/365 (45%), Positives = 248/365 (67%)
  Q:     4 RKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAV------------EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQN--------ATKESI-ESFCNAIIDFVVKKYNLNSDFKR--IINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           R + +SESV +GHPDKICDQISDA+LD  L QDP S+VA EV     L++I GEIT+   V+ + +A   +  +GY  ++        +++  ++ QS +I   V            E+ + IGAGDQG+++GYA +E    MPLPI++AH + +    V  N  + +++ D K+QVTI Y D +   ID I++S QH+          A +  I +   + +++ V +  ++  D K   ++N +GKF IGGP GD+GLTGRK++VDTYG  A+HGGGAFSGKD TKVDR+ AY  RYIAKNIVAA LA KCEVQ+S+AIG ++P++  ++TFGT K  ++++ E+I   F+      I+ F++++         +   + YGHFGRT+L   WE+ DKV+
  S:    24 RYLFSSESVTEGHPDKICDQISDAILDALLAQDPKSRVAAEVVVNTGLVLITGEITSKAQVNYIDVARKKIAQIGYTHAENGFSADSCSVLVALDEQSVDIAQGVDMAQETREHLSEEQLDAIGAGDQGLMFGYACNETPELMPLPISLAHRISRQLTAVRKNGTLPYLRPDGKTQVTIVYEDGRPVGIDTILVSTQHTATIAGISDPVAIQARIKQDLWSEVVEPVFEDISIKPDAKTRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRTAAYACRYIAKNIVAAGLADKCEVQVSYAIGVARPVSLFIETFGTGKVDEDKLIEVIQQNFELRPAGMIQAFDLQNLPGKRGGHFFQEVAAYGHFGRTDLGLPWERTDKVQ 425
>gi|169633689|ref|YP_001707425.1| methionine adenosyltransferase [Acinetobacter baumannii SDF] >gi|184157884|ref|YP_001846223.1| S-adenosylmethionine synthetase [Acinetobacter baumannii ACICU] >gi|169152481|emb|CAP01449.1| methionine adenosyltransferase [Acinetobacter baumannii] >gi|183209478|gb|ACC56876.1| S-adenosylmethionine synthetase [Acinetobacter baumannii ACICU] >gi|193077162|gb|ABO11946.2| methionine adenosyltransferase [Acinetobacter baumannii ATCC 17978] (388 aa)
Score = 802, Expect = 1.5e-83, Identities = 164/370 (44%), Positives = 238/370 (64%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAV--EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR--TELNPGWEQLDKVEEI 370
           M    + TSESV +GHPDK+ DQISDA+LD  LK+DP ++VACE       +V+ GEITT   +DV  +    +  +GY  SD         +I+ +  QS EI   V  +K    GAGDQG+++GYA+ E +  MP PI+ AH L++   ++  +  + +++ D KSQVT  Y + +  ++D +++S QH    T+  + E+    II  ++     ++  K  IN +G F IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA KCE+Q+S+AIG ++P + +++TFGT+K SDE I +++   FD          N+  P+Y   + YGHFGR  ++    WE+ DKVE +
  S:     1 MREYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVDRQKPEDQGAGDQGLMFGYASRETDVLMPAPISYAHRLMERQAELRRSGALPWLRPDAKSQVTFAYENGKPVRLDAVVLSTQHDPEITQTQLKEAVIEEIIKPIIPAEMFHAATKFHINPTGMFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSISINTFGTAKVSDELIIQLVREHFDLRPFGITRMLNLIQPMYKQTAAYGHFGREGSDTAFTWEKTDKVEAL 382
>gi|187251651|ref|YP_001876133.1| methionine adenosyltransferase [Elusimicrobium minutum Pei191] >gi|186971811|gb|ACC98796.1| Methionine adenosyltransferase [Elusimicrobium minutum Pei191] (386 aa)
Score = 802, Expect = 1.6e-83, Identities = 172/371 (46%), Positives = 242/371 (65%)
  Q:     2 ELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKES----IESFCNAIIDF----VVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILE 372
           E R   TSESVG+GHPDK+CDQISDAVLD  L +D  ++VACE +    L+VIGGEITT  +VDV  +A   +  +GY +  +        I++ +  QS +I   V+     GAGDQG + GYA +E + +MP+ I +A+++VK       N K+ F   D KSQ+T +Y + +  +ID +++S QH+ +   +S     E+    IID     V+KK+  + + K +IN +GKF IGGP  DTG+TGRK++VDTYG    HGGGAFSGKD TKVDRS AY ARYIAKNIVAAKLA++C +Q+++AIG ++P+   V T GT K SDE++       F  + K  IE F +R P+Y   + +GHFGR      WE+ DK + +++
  S:     4 EGRYYFTSESVGEGHPDKMCDQISDAVLDAILAKDSTARVACETYVTRGLVVIGGEITTKTWVDVDSIAREEIKRIGYTDPKYGFNYETCAILNVIGKQSPDISQGVDVG---GAGDQGFMVGYAVNETKEYMPITIVLANEIVKNLAVCRKNGKLKFTGPDCKSQITFEYINGKPARIDTVVVSTQHTSDVLDKSGQFITEAAQKKIIDAAVMPVIKKW-CDKNTKILINPTGKFVIGGPQSDTGMTGRKIIVDTYGGRCPHGGGAFSGKDPTKVDRSAAYMARYIAKNIVAAKLAEECTIQIAYAIGKAEPVGVYVYTHGTGKVSDEKLTLAAKKVFPLTPKGIIEHFKLRRPVYKQTAAFGHFGRAGFP--WEKTDKTKALID 383
>gi|75907003|ref|YP_321299.1| S-adenosylmethionine synthetase [Anabaena variabilis ATCC 29413] >gi|109892620|sp|Q3MF32|METK_ANAVT S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|75700728|gb|ABA20404.1| methionine adenosyltransferase [Anabaena variabilis ATCC 29413] (420 aa)
Score = 802, Expect = 1.6e-83, Identities = 170/368 (46%), Positives = 245/368 (66%)
  Q:     1 MELRKIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESD-------FTIISNVNSQSNEIFNAV-------EKD-----NQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHS--------QNATKESI-ESFCNAIIDFVVKKYNLNSD--FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRS-------PIYSPFSTYGHFGRTELNPGWEQLDKVE 368
           M  R + TSESV +GHPDKICDQISD +LD  L QDP S+VA EV     L++I GEITT   V+   +A   +  +GY  +D        ++I  ++ QS +I   V       E+D     ++IGAGDQG+++G+A +E    MPLPI +AH + +    V    ++ +++ D K+QVT+ Y D +   ID +++S QH+        + A +  I +    A+++ V     +  D   + ++N +GKF IGGP GD+GLTGRK++VDTYG  ++HGGGAFSGKD TKVDRS AY ARY+AKNIVAA LA+KCEVQLS+AIG ++P++  +DTFGT K  DE +  ++ + F+      I  FN+R+         Y   + YGH GR +L+  WE+ DK +
  S:     1 MSRRYLFTSESVTEGHPDKICDQISDTILDTLLTQDPTSRVAAEVVVNTGLVLITGEITTKANVNYANIARQKIAEIGYTNADNGFSASSTSVIVALDEQSPDIAQGVNTAQETREQDSEELFDKIGAGDQGIMFGFACNETPELMPLPICLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTVLISTQHTATIGDITDEAAVQAKIKQDLWTAVVEPVFGDLEIKPDQETRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKCEVQLSYAIGVARPVSIFLDTFGTGKVDDEILLGLVKDNFELRPAGIIHSFNLRNLPSERGGRFYQDVAAYGHLGRNDLDLPWERTDKAD 405
>gi|149378392|ref|ZP_01896092.1| S-adenosylmethionine synthetase [Marinobacter algicola DG893] >gi|149357328|gb|EDM45850.1| S-adenosylmethionine synthetase [Marinobacter algicola DG893] (396 aa)
Score = 802, Expect = 1.6e-83, Identities = 162/363 (44%), Positives = 241/363 (66%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDFT-------IISNVNSQSNEIFNAV--EKDNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGR--TELNPG--------WEQLDKVE 368
           + TSESV +GHPDK+ DQISDAVLD  L  DP+++VACE      + ++GGEITT+ +VD+  +   V+  +GY  S          II+ +  QS +I   V  +K    GAGDQG+++GYA++E +  MP PI  +H LV+   +   +  + +++ D KSQVT  Y + +   ID I++S QH ++ ++  + E+    I+   +    L+ D +  IN +GKF IGGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  RY+AKNIVAA LA+KCE+Q+S+AIG ++P + +++TFGT K SD++I +++   FD    +     ++  P+Y   + YGHFGR   E+  G        WE+ D+ +
  S:     6 VFTSESVSEGHPDKLADQISDAVLDAILVDDPHARVACETMVKTGVAIVGGEITTSAWVDLEDLVRGVIKDIGYTSSTVGYDGDTCGIINIIGKQSVDIAQGVDRQKPEDQGAGDQGLMFGYASNETDVLMPAPITFSHRLVQRQAEARKSGLLPWLRPDAKSQVTCRYENGKVTGIDAIVLSTQHDEDVSQADLKEAVMELIVKHALPAELLHKDTQFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAEKCEIQVSYAIGVAQPTSISLNTFGTGKISDDKIIKLVREHFDLRPYAITNMLDLLHPMYRATAAYGHFGREPVEMTVGGKTFTSFPWEKTDRAD 388
>gi|108562616|ref|YP_626932.1| S-adenosylmethionine synthetase [Helicobacter pylori HPAG1] >gi|123373849|sp|Q1CUW4|METK_HELPH S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|107836389|gb|ABF84258.1| S-adenosylmethionine synthetase [Helicobacter pylori HPAG1] (385 aa)
Score = 801, Expect = 1.7e-83, Identities = 165/371 (44%), Positives = 242/371 (65%)
  Q:     6 IMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDESDF-------TIISNVNSQSNEIFNAVEK-DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNPKIDQIIMSVQHSQNATKESI-ESFCNAIIDFVVKKYNLNSDFKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQLDKVEEILEFTKK 376
           + TSESV +GHPDK+ DQISDAVLD  +++D  +KVACE   +N   +I GE+ T+ Y  + ++A  V+  +GY ++ +        +++ +  QS +I   V++ D +IGAGDQG+++GYA  E E  MPLPI++AH L     Q   +  + F++ D KSQV++ Y +++   ID I++S QHS   +++ + E+    I+  V+ K  L+ + K  +N +GKF IGGP GD GLTGRK++VDTYG    HGGGAFSGKD +KVDRS AY ARY+AKN+VA+ +  K  VQL++AIG  +P++  V+T  TSKYS  ++ + +   F  + K  IE  ++  PIYS  S YGHFGR      WE+ +K EEI  F K+
  S:     6 LFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACETLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGIGEQSPDINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLAFALAQKRKDNTLPFLRPDGKSQVSVHYENNKPVSIDTIVISTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLHDNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAAYAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSIYVNTHNTSKYSSVELEKCVKAVFKLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKDEEIKAFFKR 385
>gi|119716666|ref|YP_923631.1| S-adenosylmethionine synthetase [Nocardioides sp. JS614] >gi|158513102|sp|A1SJF9|METK_NOCSJ S-adenosylmethionine synthetase (Methionine adenosyltransferase) (AdoMet synthetase) (MAT) >gi|119537327|gb|ABL81944.1| methionine adenosyltransferase [Nocardioides sp. JS614] (396 aa)
Score = 801, Expect = 1.7e-83, Identities = 159/359 (44%), Positives = 239/359 (66%)
  Q:     5 KIMTSESVGKGHPDKICDQISDAVLDECLKQDPNSKVACEVFAANRLIVIGGEITTAGYVDVVKMAWNVLIPLGYDES-------DFTIISNVNSQSNEIFNAVEK------------DNQIGAGDQGVVYGYATDECENFMPLPINIAHDLVKCAEQVIWNTKIDFIKHDMKSQVTIDYADSQNP-KIDQIIMSVQHSQNATKESIESFCNA-IIDFVVKKYNLNSD-FKRIINNSGKFTIGGPIGDTGLTGRKLMVDTYGSLAKHGGGAFSGKDCTKVDRSGAYFARYIAKNIVAAKLAKKCEVQLSFAIGASKPIAFAVDTFGTSKYSDEQIYEIIVNTFDFSIKSFIEKFNMRSPIYSPFSTYGHFGRTELNPGWEQ 363
           ++ TSESV +GHPDKI DQISD+VLD  L+ DP S+VA E      ++V+ GE+TT GYVDV  +    +I +GYD S          ++  +  QS +I   V+             D Q GAGDQG+++GYA D+ +  MPLPI IA  L +    V  +  + +++ D K+QVTI+Y     P ++D +++S QH ++   +++E+     +ID V+  + + S+ ++ ++N +G+F +GGP+GD GLTGRK++VDTYG +A+HGGGAFSGKD +KVDRS AY  R++AKN+VAA LA +CE Q+++AIG ++P+   V+TFGT    DE+I E ++  FD    + I   ++  PIY+  + YGHFGR      WE+
  S:     4 RLFTSESVTEGHPDKIADQISDSVLDAMLELDPTSRVAVETLLTTGVVVVAGEVTTTGYVDVKDVVRRRIIEIGYDSSVKGFDGHSCGVMVAIGGQSGDIAQGVDTGHESRTGSVDAMDKQ-GAGDQGLMFGYACDDTDVLMPLPIVIAQRLAEQLTAVRKDGTLPYLRPDGKTQVTIEYDAENRPVRVDTVVLSSQHDEDTELDTLEADVKKHVIDPVLATFPIPSEGYRLLVNPTGRFVVGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLATRCEAQVAYAIGKAQPVGVFVETFGTGVVDDERIQEAVLEVFDLRPAAIIRDLDLLRPIYAKTAAYGHFGRELPEFTWER 383
>gi|163797147|ref|ZP_02191102.1| S-adenosylmethionine synthetase [alpha proteobacterium BAL199] >