>gi|26553548|ref|NP_757482.1| hypothetical protein MYPE950 [Mycoplasma penetrans HF-2] >gi|26453554|dbj|BAC43886.1| hypothetical protein [Mycoplasma penetrans HF-2] (199 aa)
Score = 826, Expect = 7.0e-87, Identities = 199/199 (100%), Positives = 199/199 (100%)
  Q:     1 MIKKIIFWFNSFMFWLVNIDNKLYLENESLHSQKRNAFYYFSKELENPKIFKKFNKRLKSTNRLAWTYIILYSLATALMFVCVTIFYTLAIKIQIFSKIPNWELSMYEANLGITVLFLIADDIIVFYILINAILMIALTIKVSLLKKYCRLYCKCFWLALTGIFFSPFSIASSVKLVKLIKKDLIKLQNYKIEIENKNQ 199
           MIKKIIFWFNSFMFWLVNIDNKLYLENESLHSQKRNAFYYFSKELENPKIFKKFNKRLKSTNRLAWTYIILYSLATALMFVCVTIFYTLAIKIQIFSKIPNWELSMYEANLGITVLFLIADDIIVFYILINAILMIALTIKVSLLKKYCRLYCKCFWLALTGIFFSPFSIASSVKLVKLIKKDLIKLQNYKIEIENKNQ
  S:     1 MIKKIIFWFNSFMFWLVNIDNKLYLENESLHSQKRNAFYYFSKELENPKIFKKFNKRLKSTNRLAWTYIILYSLATALMFVCVTIFYTLAIKIQIFSKIPNWELSMYEANLGITVLFLIADDIIVFYILINAILMIALTIKVSLLKKYCRLYCKCFWLALTGIFFSPFSIASSVKLVKLIKKDLIKLQNYKIEIENKNQ 199
>gi|26554360|ref|NP_758294.1| hypothetical protein MYPE9070 [Mycoplasma penetrans HF-2] >gi|26454370|dbj|BAC44698.1| hypothetical protein [Mycoplasma penetrans HF-2] (174 aa)
Score = 292, Expect = 6.7e-25, Identities = 83/152 (54%), Positives = 105/152 (69%)
  Q:    39 YYFSKELENPKIFKKFNKRLKSTNRLAWTYIILYSLATALMFVCVTIFYTLAIKIQIFSKIPNWELSMYEANLGITVLFLIADDIIVFYILINAILMIALTIKVSLLKKYCRLYCKCFWLALTGIFFSPFSIASSVKLVKLIKKDLIKLQNY 190
           + + +   N K+FKK NK LKSTN LAW YI+LYSLA+ LM V   IF  LA+K     K  N E ++ EAN+ +T L ++ DDII+FYI+ NAILMI LTIK+S LKKY   Y K F  +L GIFFSP+SI  +VK+V LIKKDL  L+N+
  S:    23 HQYQEIFNNQKLFKKINKILKSTNALAWVYIVLYSLASGLMLVSTAIFIILALKAGFLYKYWNLEPTLLEANIAMTSLIIMIDDIILFYIIPNAILMIVLTIKISRLKKYFPHYDKYFKWSLIGIFFSPYSIICTVKIVVLIKKDLANLRNF 174
>gi|26554361|ref|NP_758295.1| hypothetical protein MYPE9080 [Mycoplasma penetrans HF-2] >gi|26454371|dbj|BAC44699.1| hypothetical protein [Mycoplasma penetrans HF-2] (155 aa)
Score = 171, Expect = 7.6e-11, Identities = 55/151 (36%), Positives = 88/151 (58%)
  Q:    38 FYYFSKELENPKIFKKFNKRLKSTNRLAWTYIILYSLATALMFVCVTIFYTLAIKIQIFSKIPNWELSMYEANLGITVLFLIADDIIVFYILINAILMIALTIKVSLLKKYCRLYCKCFWLALTGIFFSPFSIASSVKLVKLIKKDLIKLQ 188
           F   +K+ EN  I K F K++KS   ++W Y++L SLAT ++F        L +K+ I       E++ +E  L IT+L +  DD+++F+++ N I  + L  K+  LKK+   Y KC+ LAL GIFF+P  ++S + L   IK+DL  L+
  S:     2 FLLRAKKDENSSI-KTFIKKIKSVRLVSWIYLVLVSLATFILFFTWIPLIVLQLKLYITYINYGIEITPFEYRLLITLLLIWFDDLVIFFLITNMIFGLILFFKIRWLKKFSPKYEKCYKLALMGIFFAPRLVSSILNLRINIKEDLKLLK 151
>gi|109502009|ref|XP_224520.4| PREDICTED: similar to ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [Rattus norvegicus] (518 aa)
Score = 83, Expect = 9.7e-01, Identities = 15/32 (46%), Positives = 22/32 (68%)
  Q:   101 NWELSMYEANLGITVLFLIADDIIVFYILINA 132
           +W L +Y     +TVLF IA  ++VFY+L+NA
  S:   450 SWYLGIYTGLTAVTVLFGIARSLLVFYVLVNA 481