>gi|26553549|ref|NP_757483.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] >gi|26453555|dbj|BAC43887.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] (370 aa)
Score = 1717, Expect = 0.0e+00, Identities = 370/370 (100%), Positives = 370/370 (100%)
  Q:     1 MKFPFTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDLYKKYVIYGSVDTKETGNLDKERKNPQTFF 370
           MKFPFTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDLYKKYVIYGSVDTKETGNLDKERKNPQTFF
  S:     1 MKFPFTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDLYKKYVIYGSVDTKETGNLDKERKNPQTFF 370
>gi|26553757|ref|NP_757691.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] >gi|26453764|dbj|BAC44095.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] (678 aa)
Score = 720, Expect = 4.1e-74, Identities = 188/337 (55%), Positives = 239/337 (70%)
  Q:    17 KSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN-ENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNE----------LAELIDKLISKEILVKFEKYYLSIEDLYKKYVIYGSVDT 353
           + K+ +K   +Y+   N  + Y       +  DID+   LL+V NL KQY  K  P ID ++F+V  GEFHAFVGANGAGKTTTIKSI+G+Y +FDG I I G++NK+  S+ K+GYIPE   FPSRIS+++YL   A LN++  +EA  F + ILK F M +L+  SPN FSSGQKKKILLAQALSNNPD+LIMDEPTANLDPK+RI+FFDIL +LQ   KSIFISSHILSELD+Y++A+TILD GKI ++ KR    E+ +  YRI L E  EGD  GK  + SN  I+ + ++K E          L   I  L  ++ LVK E+Y LSIE++YKKYVI GSV T
  S:   343 EDKKSDKPVSDYRPTPNVINSY-------DPADIDV---LLDVCNLTKQYNRKAKPAIDQISFQVRRGEFHAFVGANGAGKTTTIKSIVGAYASFDGKIKIGGVNNKSKYSKIKLGYIPELARFPSRISAYNYLVDMAMLNRLTKEEAVKFVDDILKTFNMENLKKVSPNKFSSGQKKKILLAQALSNNPDLLIMDEPTANLDPKSRIEFFDILKKLQLQGKSIFISSHILSELDIYADAITILDGGKIAFSGKRELALEDKKDTYRIVLKE--EGD-FGKANL-SNLNIVQDLENKKEYLVSSSNQELLNNFIFNLFKEKKLVKSEEYKLSIEEMYKKYVIKGSVHT 676
>gi|31544580|ref|NP_853158.1| hypothetical protein MGA_1303 [Mycoplasma gallisepticum R] >gi|31541425|gb|AAP56726.1| CcmA [Mycoplasma gallisepticum R] (321 aa)
Score = 556, Expect = 4.5e-55, Identities = 126/298 (42%), Positives = 205/298 (68%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYR--IKLVEDFEG-----DKVG-KYEVNSNNEIIYEFKDKNELAE--LIDKLISKEILVKFEKYYLSIEDLYKKYVIYGSVDT 353
           +LEV+NL K++   + P I+NLNF V   ++H F+GANGAGKTTTIK+IIG+++   G I I+G+D+ N ++R  +GY+PE + F + +++F+YL +  +L+ +    A+   +S L++F M  L   +PN FSSGQKKKI+L Q+L N+P++LI+DEPTANLDPKARI+F D + +LQK  + SIFISSH+L+E+D Y++++TILD G++V++   N+       Y+  I  V+D +      +K G  +    + +I Y +  +    +  L D ++ K  +++F ++  SI ++Y++Y+  GSV T
  S:    11 ILEVINLTKKFKRNQPPVINNLNFVVKKNQYHVFIGANGAGKTTTIKTIIGAFKKTSGMILINGVDSNNPQARKALGYVPEVSRFANTLNTFEYLVWMGRLSGLNKLAAQTKVKSKLEEFNMIKLAKTNPNKFSSGQKKKIILIQSLLNDPELLILDEPTANLDPKARIEFMDFIKQLQKQSQTSIFISSHVLTEVDQYADSITILDGGRVVFSGDLNEINQSNNHYKKYILKVKDQKAAIKLLNKAGFNWIFKPDQQIFYLYSSEQTKIDRLLHDLILEKNQIIEFREHQFSINEIYEQYIKIGSVQT 319
>gi|31544307|ref|NP_852885.1| hypothetical protein MGA_0806 [Mycoplasma gallisepticum R] >gi|31541151|gb|AAP56453.1| CcmA [Mycoplasma gallisepticum R] (237 aa)
Score = 531, Expect = 3.5e-52, Identities = 114/219 (52%), Positives = 155/219 (70%)
  Q:    56 LLEVVNLRKQYYGKKHPT-IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN 274
           +LEV  L K Y  KK    + +LNF V  G FHAF+G NGAGKTTTIKSIIGSYR ++G I I+GI ++   S+ K+GY+PENT FP  +++++YL+  AKL+ + S +AK     +LKKF + DL N  P +FSSGQKKK+LL QAL N+P+I+I+DEP ANLDP AR   F +L +L    K+IFISSH LSE+D Y ++ T++  GKI+ + K+ K+
  S:     6 ILEVKRLNKIYQDKKSSRGVFDLNFSVEKGAFHAFIGENGAGKTTTIKSIIGSYRQYEGEILINGISSREAASKAKLGYVPENTIFPKELTTWEYLFSLAKLSGLSSTQAKTKINELLKKFDIVDLVNLKPYSFSSGQKKKVLLMQALINDPEIIILDEPAANLDPTARYQLFKLLSQLHNEGKTIFISSHNLSEIDKYVDSYTLIHKGKIISSSKKEKS 225
>gi|26553809|ref|NP_757743.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] >gi|26453816|dbj|BAC44147.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] (317 aa)
Score = 524, Expect = 2.3e-51, Identities = 113/226 (50%), Positives = 163/226 (72%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCY 281
           +LEV+NL K Y  ++ P I +LNFK+   +FH F+GANGAGKTTTIK+++G+Y  ++G I I+G +N    S+  +GYIPE + FP  +S+  YL   A ++ IK + A  FA   L +  M ++ N++PN FSSGQ+KKILL+QAL +NPDILIMDEPTANLDP +R +F+ +  +LQ+  K+IF+SSHILSE++ Y++ VTILD G+IVY+   ++N++ E  Y
  S:    75 VLEVINLTKHYPRREKPAIKDLNFKLRKNQFHVFIGANGAGKTTTIKALVGAYAKWEGLILINGKENTKTVSKLNVGYIPEKSVFPKNMSTKQYLVSMAMMSGIKKELATEFANKTLLELNMQNMANKNPNTFSSGQQKKILLSQALVHNPDILIMDEPTANLDPISRNEFYTLTKKLQEQGKTIFVSSHILSEVEKYADYVTILDGGRIVYSGPLDQNKDLEKLY 300
>gi|167970997|ref|ZP_02553274.1| ABC transporter [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701093|gb|EDU19375.1| ABC transporter [Ureaplasma parvum serovar 6 str. ATCC 27818] (236 aa)
Score = 520, Expect = 6.5e-51, Identities = 112/213 (52%), Positives = 156/213 (73%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +LEV NL K  Y K +  + +L+F V  GE HAF+G NG+GKTTTIKSII +Y N+ GSI I G DNK  ES  K+GY+PE   FPS +++F YLY  A+L+ +  K+A     + L+KFR+ DL+N+ P NFSSGQKKK++L QAL ++P+++I+DEPTANLDP AR +F +IL EL + +K+IFI SHIL E+D Y +++T++  GK+VY+
  S:     6 ILEVRNLTK-IYKKSNQGVFDLSFNVKRGEIHAFIGENGSGKTTTIKSIINAYTNYKGSILIDGFDNKTPESHEKIGYVPEIALFPSELTTFQYLYSFARLSNLNKKQAIERIHNFLEKFRISDLKNKKPINFSSGQKKKVILIQALLHDPELIILDEPTANLDPSARHEFNNILKELHEQNKTIFICSHILKEMDTYVDSLTLIHKGKLVYS 217
>gi|15828667|ref|NP_326027.1| ABC transporter ATP-binding protein [Mycoplasma pulmonis UAB CTIP] >gi|14089609|emb|CAC13369.1| ABC TRANSPORTER ATP-BINDING PROTEIN [Mycoplasma pulmonis] (235 aa)
Score = 515, Expect = 2.4e-50, Identities = 113/219 (51%), Positives = 152/219 (69%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN 274
           +LEV NL K Y  K +  I NLNF V  G FHAF+G NGAGKTTTIKSII S+ N+ G I I   DNK  ES+ K+GY+PEN  FP  I + DYL   A L+ +   +AK   + +L +  + DL N+ P +FSSGQKKK+LL QAL + PD++I+DEP ANLDP AR + F IL +L+   K+IFISSHILSE+D Y +++T++ +G+IV+  ++N+N
  S:     4 ILEVKNLSKIYNKKDNRGIQNLNFSVPRGSFHAFIGENGAGKTTTIKSIINSFSNWTGQILIDNKDNKTAESKEKIGYVPENALFPKEIKTIDYLLSFALLSGMDKAKAKEKIKDMLTRLDIIDLINKKPYSFSSGQKKKVLLIQALIHEPDLIILDEPAANLDPSARYELFKILEDLKNQGKTIFISSHILSEIDKYIDSLTLIHDGQIVFNGEKNQN 222
>gi|13357650|ref|NP_077924.1| ABC transporter [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168282172|ref|ZP_02689839.1| ABC transporter [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308330|ref|ZP_02691005.1| ABC transporter [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762104|ref|YP_001752174.1| ABC transporter [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11346317|pir||F82934 ABC transporter UU093 [imported] - Ureaplasma urealyticum >gi|6899047|gb|AAF30499.1|AE002109_2 ABC transporter [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827681|gb|ACA32943.1| ABC transporter [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902984|gb|EDT49273.1| ABC transporter [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675860|gb|EDT87765.1| ABC transporter [Ureaplasma parvum serovar 14 str. ATCC 33697] (236 aa)
Score = 514, Expect = 3.7e-50, Identities = 111/213 (52%), Positives = 156/213 (73%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +LEV NL K  Y K +  + +L+F V  GE HAF+G NG+GKTTTIKSII +Y N+ GSI I G DNK  +S  K+GY+PE   FPS +++F YLY  A+L+ +  K+A     + L+KFR+ DL+N+ P NFSSGQKKK++L QAL ++P+++I+DEPTANLDP AR +F +IL EL + +K+IFI SHIL E+D Y +++T++  GK+VY+
  S:     6 ILEVKNLTK-IYKKSNQGVFDLSFNVKRGEIHAFIGENGSGKTTTIKSIINAYTNYKGSILIDGFDNKTPKSHEKIGYVPEIALFPSELTTFQYLYSFARLSNLNKKQAIERIHNFLEKFRISDLKNKKPINFSSGQKKKVILIQALLHDPELIILDEPTANLDPSARHEFNNILKELHEQNKTIFICSHILKEMDTYVDSLTLIHKGKLVYS 217
>gi|71894154|ref|YP_278262.1| ABC transporter ATP-binding protein [Mycoplasma synoviae 53] >gi|71850942|gb|AAZ43551.1| ABC transporter ATP-binding protein [Mycoplasma synoviae 53] (233 aa)
Score = 509, Expect = 1.2e-49, Identities = 110/220 (50%), Positives = 156/220 (70%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           K +LEV +L+K Y    +  I ++NF V  G FH+F+G NGAGKTTTIKSIIG+Y ++ G I I G ++KN E++  +GY+PE   FP  +++F YL + A LN +    AK    ++L+KF + DL+N+ P NFSSGQKKKILL QAL ++P ++I+DEPTANLDP AR + F IL +L+   K+IFISSH+LSE+D Y+++ T++  G+IVY  K+ K
  S:     2 KNILEVKSLQKVY--SPNTGIFDINFSVEAGHFHSFIGENGAGKTTTIKSIIGAYNSYSGEILIDGKNSKNPETKNIIGYVPEYAKFPKELTTFTYLQFLAMLNGVSKSVAKEKITALLEKFNISDLKNKKPVNFSSGQKKKILLIQALIHDPQLIILDEPTANLDPTARFELFTILNQLKSQGKTIFISSHVLSEIDKYTDSFTLIHKGQIVYNGKKYK 219
>gi|167941093|ref|ZP_02528168.1| ABC transporter [Ureaplasma urealyticum serovar 8] >gi|167960172|ref|ZP_02547240.1| ABC transporter [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972428|ref|ZP_02554705.1| ABC transporter [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974911|ref|ZP_02557188.1| ABC transporter [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975154|ref|ZP_02557431.1| ABC transporter [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167989115|ref|ZP_02570786.1| ABC transporter [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337553|ref|ZP_02694168.1| ABC transporter [Ureaplasma urealyticum serovar 10] >gi|168362227|ref|ZP_02695406.1| ABC transporter [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807775|ref|ZP_02828834.1| ABC transporter [Ureaplasma urealyticum serovar 2] >gi|195867450|ref|ZP_03079454.1| ABC transporter [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903258|gb|EDT49547.1| ABC transporter [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209360|gb|EDU06403.1| ABC transporter [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018676|gb|EDU56716.1| ABC transporter [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997692|gb|EDU66789.1| ABC transporter [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660045|gb|EDX53425.1| ABC transporter [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660926|gb|EDX54179.1| ABC transporter [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (236 aa)
Score = 506, Expect = 2.8e-49, Identities = 110/213 (51%), Positives = 156/213 (73%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +LEV NL K  Y K +  + +L+F V  GE HAF+G NG+GKTTTIKSII +Y N+ GSI I+G DNK  +S  K+GY+PE   FPS +++F YLY  A+L+ +  K+A    +  L+KF + DL+N+ P NFSSGQKKK++L QAL ++P+++I+DEPTANLDP AR +F  IL EL + +K+IFI SHIL E+D Y +++T+++ GK+VY+
  S:     6 ILEVKNLTK-IYKKSNQGVFDLSFNVKRGEIHAFIGENGSGKTTTIKSIINAYTNYKGSILIAGFDNKTPKSHEKIGYVPEIALFPSELTTFQYLYSFARLSNLNKKQAIERIDYFLEKFHISDLKNKKPINFSSGQKKKVILIQALLHDPELIILDEPTANLDPSARHEFNTILKELHEQNKTIFICSHILKEMDSYVDSLTLINKGKLVYS 217
>gi|13508073|ref|NP_110022.1| ABC transporter ATP-binding protein [Mycoplasma pneumoniae M129] >gi|2492587|sp|P75444|Y334_MYCPN Putative ABC transporter ATP-binding protein MPN_334 >gi|1674195|gb|AAB96150.1| ABC transporter ATP-binding protein [Mycoplasma pneumoniae M129] (326 aa)
Score = 494, Expect = 7.1e-48, Identities = 106/231 (45%), Positives = 157/231 (67%)
  Q:    55 PLLEVVNLRKQY-YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKL 285
           P++EV +L K++ + +K+  + ++NF + PGEFHAF+G NGAGKTTTIK +I SY+ F   I I GI NKN +S+  + YIPE   FP  +++ +YLY   KL+    +  K   +  L +F++  LR + PN+FSSGQKKK+LL QAL N+P +LIMDEPTANLDPK R +F D+  EL   +K ++F+SSHIL+EL+ Y +++T++  G+I++  K          YR+K+
  S:     5 PIVEVKHLEKEFGFWRKNRILKDVNFAIMPGEFHAFIGQNGAGKTTTIKCLISSYQRFKDEINIDGISNKNAKSKGVISYIPEYAVFPKHLNTHEYLYTLGKLSGCSLQTIKEKVDYWLARFQIEHLRFKKPNDFSSGQKKKVLLIQALFNDPKLLIMDEPTANLDPKTRNEFMDVCYELNVRNKMAVFVSSHILAELENYCDSLTVIHEGEILFNGKTKNIAKDNFGYRLKV 237
>gi|42560870|ref|NP_975321.1| ABC transporter, ATP-binding component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492367|emb|CAE76963.1| ABC transporter, ATP-binding component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] (234 aa)
Score = 483, Expect = 1.2e-46, Identities = 109/221 (49%), Positives = 154/221 (69%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN 274
           K +LE+ NL K  Y K +  + N++  ++ G+FHAF+G NGAGKTTTIK+IIG++  + G I I+ I+ K  E+++ +GY+PE   FP  ++SF+YLY  A L+ I  KEAK      LK F + +L N+ P NFSSGQKKKILL QAL ++P +LI+DEP ANLDP AR + F+ L ++ K    +I ISSHILSE+D Y N+VT++ +G I+Y+  +NKN
  S:     2 KKILEIRNLTK-IYSKTNRGVFNISMNLFDGDFHAFIGENGAGKTTTIKTIIGAHTEYKGHILINNINIKKAEAKSFVGYVPEIALFPKELTSFEYLYNLAILSNISKKEAKQKIYDFLKMFNILNLMNEKPYNFSSGQKKKILLIQALLHDPKVLILDEPAANLDPTARFELFNFLQKINKEKNITILISSHILSEIDKYVNSVTLIHHGNILYSGIKNKN 222
>gi|148377724|ref|YP_001256600.1| ABC transporter, ATP-binding protein [Mycoplasma agalactiae PG2] >gi|148291770|emb|CAL59159.1| ABC transporter, ATP-binding protein [Mycoplasma agalactiae PG2] (234 aa)
Score = 482, Expect = 2.0e-46, Identities = 107/213 (50%), Positives = 145/213 (68%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +LEV++L K  + K    I N+N  V  G+FHAF+G NGAGKTTTIKSIIG+Y N+ G I I G + K+   ++ +GY+PEN  FP  +S + YLY  + L+ I  K+A L  +  LK F + DL N  P NFSSGQKKK+LL QAL ++P +LI+DEP ANLDP AR + F +L  L +    +I ISSH+LSE+D Y N+VT++ NG I+Y+
  S:     4 VLEVIDLTK-VFSKTKRGIKNVNITVNSGDFHAFIGENGAGKTTTIKSIIGAYPNYSGQILIYGKNIKDASVKSIIGYVPENAIFPKELSVYQYLYNFSILSNIPKKQADLKIKKFLKLFNIEDLENDKPYNFSSGQKKKVLLIQALLHDPKLLILDEPAANLDPTARYELFSLLKNLNENDGIAILISSHVLSEIDKYVNSVTLIHNGNIIYS 216
>gi|193216838|ref|YP_002000080.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] >gi|193002161|gb|ACF07376.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] (321 aa)
Score = 469, Expect = 5.3e-45, Identities = 117/269 (43%), Positives = 170/269 (63%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRM-WDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRI--------KLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEI-LVKFEKYYLSIEDLY 342
           +D +NF V  GEFH F+G+NGAGKTTTI++++G Y +  G I+I+GI +   E++ K+G+IPE   FP  +SS ++LYY A ++ +  K AK+  E  LKKF M  D    SP  FSSGQKKKI+L QAL N+P+ILI+DEPTANLD  +RIDF++ L  L K  K+IFISSH L+EL+ Y ++ TI++ G ++ +Q   K+      + I        K     +  K+  +   SNN  I  F+D       ++K+ +  I    F +Y  S++ LY
  S:    34 LDKINFSVKAGEFHGFIGSNGAGKTTTIRALLGYYNDIAGEIFINGILSTKKEAKAKIGFIPEIANFPKALSSREFLYYFACMSGLDKKIAKVKVEEALKKFNMDGDEFKGSPYFFSSGQKKKIMLIQALINDPEILILDEPTANLDVASRIDFYEKLAGLHKQGKTIFISSHNLAELEKYVDSFTIIERGNVIMSQSLKKDNQQNFNWTISVKAQDITKCQNLLKNLKIKYFLNQSNNSFILFFEDDQIKKTFVNKITANNIEFSNFSEYRPSLQQLY 312
>gi|193216870|ref|YP_002000112.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] >gi|193002193|gb|ACF07408.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] (353 aa)
Score = 437, Expect = 3.0e-41, Identities = 110/281 (39%), Positives = 174/281 (61%)
  Q:     7 KKDNNFISSLKSKQLEKKEKE-YQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK-RNKNENGEMCYRIKLVE 287
           +  NN  SS+      K  KE + +     +E  E+   +   + D+      +  + +   G     +++++F+V  GEFH F+G NGAGKTTTI++++  ++ + G I+I+GID+++++S+ K+GYIPE + FP  ++ F+YLYY A+++KI  K A      +L+K+       N+S    SSGQKKKI L QAL N+P+ILIMDEP ANLDP ARI+F++ + EL    K+I ISSHIL+EL+ Y ++VT+L+ G +  + K   K +N    Y+IK  +
  S:     3 QDQNNAKSSIFKLSFIKNTKENFALAKQFHNEAIEKSKEITIPNEDIALSFQHITKIFRTISGMPIRILNDVSFEVKKGEFHGFIGNNGAGKTTTIRTLLDYHQAWYGKIFINGIDSRDVKSKEKIGYIPEISIFPKNLTIFEYLYYFARMSKIPKKAAIDKVNKMLEKYGFNKKEFNKSAEKLSSGQKKKINLIQALINDPEILIMDEPAANLDPSARIEFYEAIKELHNEGKTILISSHILAELEKYIDSVTVLEKGTVKDSGKVEEKLKNKVYNYKIKCTD 286
>gi|167924904|ref|ZP_02511995.1| ABC transporter, ATP-binding protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (234 aa)
Score = 434, Expect = 6.4e-41, Identities = 92/201 (45%), Positives = 139/201 (69%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN 274
           ++++N  V  G FHAF+G NGAGKTTTIK+IIG++  ++G + I+ I+ K  ++++ +GY+PE   FP  +++  YL Y   L+K+  KE +   +  L+ F + +L N+ P NFSSGQKKKILL QAL +NP +LI+DEP ANLDP AR + F  L ++ +  K SI ISSH LSE+D + +++T++  GKI+Y+  + KN
  S:    21 VNDINMSVKSGSFHAFIGENGAGKTTTIKTIIGAFSKYEGEVLINNINIKKAQAKSYIGYVPEVAIFPKELTTIQYLTYLGFLSKLDKKEVEHKIKEFLEMFNISNLINEKPYNFSSGQKKKILLIQALLHNPKLLILDEPAANLDPTARYELFSFLKKINEKEKISILISSHNLSEIDKHVDSLTLIHKGKILYSGVKTKN 222
>gi|83319478|ref|YP_424745.1| ABC transporter, ATP-binding protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283364|gb|ABC01296.1| ABC transporter, ATP-binding protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (234 aa)
Score = 432, Expect = 1.1e-40, Identities = 92/201 (45%), Positives = 139/201 (69%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN 274
           ++++N  V  G FHAF+G NGAGKTTTIK+IIG++  ++G + I+ I+ K  ++++ +GY+PE   FP  +++  YL Y   L+ +  KE +   +  L+ F + +L N+ P NFSSGQKKKILL QAL +NP +LI+DEP ANLDP AR + F  L ++ +K + SI ISSH LSE+D Y +++T++  GKI+Y+  + KN
  S:    21 VNDINMSVKSGSFHAFIGENGAGKTTTIKTIIGAFSKYEGEVLINNINIKKAQAKSYIGYVPEVAIFPKELTTIQYLTYLGFLSMLDKKEVEHKIKEFLEMFNISNLINEKPYNFSSGQKKKILLIQALLHNPKLLILDEPAANLDPTARYELFSFLKKINEKENISILISSHNLSEIDKYVDSLTLIHKGKILYSGVKTKN 222
>gi|193216539|ref|YP_001999781.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] >gi|193001862|gb|ACF07077.1| ABC transporter ATP-binding protein [Mycoplasma arthritidis 158L3-1] (323 aa)
Score = 432, Expect = 1.2e-40, Identities = 116/274 (42%), Positives = 172/274 (62%)
  Q:    69 KKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV-YTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELA---------ELIDKLISKEILVK-FEKYYLSIEDLY 342
           KK   +DN++F++  G+FH FVG+NGAGK+T+I+ ++G Y +  G + I+GI + + +S+ K+GYIPE   FP  +   DYLY+ A L++I  KEAK   E  L K+ M      +SP   SSGQKKK++L QAL N+PD+LI+DEP ANLDP AR + F  L E   L K+IFISSHILSEL+ Y ++ T+++ GK++  T   N  +  E  + I L      ++    E+ S N+I Y+  +K  L           LI ++    I  K F +Y  S++++Y
  S:    31 KKFVALDNVSFEIKKGQFHGFVGSNGAGKSTSIRCLLGFYPDTKGKMIINGIASTDPKSKLKIGYIPEEANFPKVLKMRDYLYHFACLSQIDPKEAKEKIEKYLIKYNMTGKEFEKSPYKMSSGQKKKVMLIQALINDPDLLILDEPAANLDPIARNELFSFLKEQNDLGKTIFISSHILSELEEYVDSFTVMEKGKVIESTTISNVEKKLEFNWLIVLSNQKNQERF--LELLSKNKIAYQINEKAILVAIHNDEVKNNLITQMAQNNISFKSFAEYKASLKEIY 314
>gi|144575473|gb|AAZ53836.2| putative ABC transporter atp-binding protein [Mycoplasma hyopneumoniae 7448] (238 aa)
Score = 413, Expect = 1.6e-38, Identities = 93/216 (43%), Positives = 144/216 (66%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           +LEV NL K  Y K    + N++FKV   + HAF+G NGAGKTT IK I+ +Y+ F G I I+   NK  E++  +GY+PEN+FFP  ++S+++LY    L+K++ +  K   +   K  ++ +L    P NFSSGQK+KI++ Q+L ++P+++I DEP +NLDP AR +F  I+  LQK  K+IF+SSH L E+D   +++T++D GKI Y+ ++
  S:     5 ILEVENLTK-IYSKSEAGVKNVSFKVKKNQIHAFIGKNGAGKTTVIKCIVDAYQKFSGKILINNFLNKLPEAKKFIGYVPENSFFPRELNSYEFLYEFGLLSKMEPEMVKKKIDYYFKFLKIENLAKLKPFNFSSGQKRKIMIVQSLIHDPELIIFDEPFSNLDPSARNEFRAIIKILQKQGKTIFLSSHNLYEIDTLIDSLTLIDKGKIYYSGQK 219
>gi|54020527|ref|YP_115977.1| ABC transporter ATP binding protein [Mycoplasma hyopneumoniae 232] >gi|53987700|gb|AAV27901.1| ABC transporter ATP binding protein [Mycoplasma hyopneumoniae 232] (238 aa)
Score = 413, Expect = 1.9e-38, Identities = 93/216 (43%), Positives = 144/216 (66%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           +LEV NL K  Y K    + N++FKV   + HAF+G NGAGKTT IK I+ +Y+ F G I I+   NK  E++  +GY+PEN+FFP  ++S+++LY    L+K++ +  K   +   K  ++ +L    P NFSSGQK+KI++ Q+L ++P+++I DEP +NLDP AR +F  I+  LQK  K+IF+SSH L E+D   +++T++D GKI Y+ ++
  S:     5 ILEVENLTK-IYSKSEAGVKNVSFKVKKNQIHAFIGKNGAGKTTVIKCIVDAYQKFSGKILINNFLNKLPEAKKFIGYVPENSFFPRELNSYEFLYEFGLLSKMEPELVKKKIDYYFKFLKIENLAKLKPFNFSSGQKRKIMIVQSLIHDPELIIFDEPFSNLDPSARNEFRAIIKILQKQGKTIFLSSHNLYEIDTLIDSLTLIDKGKIYYSGQK 219
>gi|72080801|ref|YP_287859.1| ABC transporter atp-binding protein [Mycoplasma hyopneumoniae 7448] (225 aa)
Score = 402, Expect = 3.8e-37, Identities = 87/205 (42%), Positives = 137/205 (66%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           Y K    + N++FKV   + HAF+G NGAGKTT IK I+ +Y+ F G I I+   NK  E++  +GY+PEN+FFP  ++S+++LY    L+K++ +  K   +   K  ++ +L    P NFSSGQK+KI++ Q+L ++P+++I DEP +NLDP AR +F  I+  LQK  K+IF+SSH L E+D   +++T++D GKI Y+ ++
  S:     2 YSKSEAGVKNVSFKVKKNQIHAFIGKNGAGKTTVIKCIVDAYQKFSGKILINNFLNKLPEAKKFIGYVPENSFFPRELNSYEFLYEFGLLSKMEPEMVKKKIDYYFKFLKIENLAKLKPFNFSSGQKRKIMIVQSLIHDPELIIFDEPFSNLDPSARNEFRAIIKILQKQGKTIFLSSHNLYEIDTLIDSLTLIDKGKIYYSGQK 206
>gi|110004391|emb|CAK98729.1| hypothetical abc transporter atp binding component abc transporter protein [Spiroplasma citri] (212 aa)
Score = 398, Expect = 1.1e-36, Identities = 82/196 (41%), Positives = 129/196 (65%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDL 252
           +E+    K++  KK   +D+++  V  G+ H F+G NG+GKTTTIKS++G+     G+  I+G+ + +  ++  +GYIPEN +FP  ++ + YL   + L  +K KEAK+ A+ IL+   +W  R ++PN FSSG KKK+LLAQ L  +P +LI+DEP ANL+P AR + F+ L +++   K+I I SHIL+EL +
  S:    19 IEIHGFTKKF--KKFVAVDDIDMNVAKGKIHGFIGPNGSGKTTTIKSLVGAIIPTSGNFSINGLKSISPAAKKLIGYIPENAWFPKHLNVYKYLIEISYLRDVKYKEAKVKAKEILENLNLWKFRTKNPNTFSSGMKKKVLLAQVLIADPKVLILDEPAANLEPAARQELFNDLIKVKNQGKTILICSHILTELQI 212
>gi|148377297|ref|YP_001256173.1| ABC transporter ATP-binding protein [Mycoplasma agalactiae PG2] >gi|148291343|emb|CAL58726.1| Hypothetical ABC transporter, ATP-bindingprotein [Mycoplasma agalactiae PG2] (280 aa)
Score = 396, Expect = 1.8e-36, Identities = 94/209 (44%), Positives = 135/209 (64%)
  Q:    77 LNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKK--FRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKL 285
           ++F V  G+FH FVG NG+GKTTTI+SI+G Y    G I+I+G++  N  ++ K+GYIPE T FP  +S+ +YLY  A ++ +  K  K     I+    F + D+ ++SP    SGQKK I+L QAL N+P+ILI+DEP ANLDP +RI  F+ L +L    K+IFISSHIL EL+ Y ++ T+L  GK++Y+   N  E     +  K+
  S:     1 MSFNVKKGQFHGFVGNNGSGKTTTIRSILGFYPGLFGKIFINGLEFTNSSAKKKIGYIPEVTIFPKNLSATEYLYSLALMSGVDKKIIKDRINYIMDTYGFHVPDM-SKSPAYMFSGQKKSIMLIQALINDPEILILDEPAANLDPSSRIRLFNTLKQLHLEGKTIFISSHILDELEKYIDSFTLLFEGKLLYSGSINDLEKDNNHFNTKI 210
>gi|144227649|gb|AAZ44552.2| putative ABC transporter atp-binding protein [Mycoplasma hyopneumoniae J] (215 aa)
Score = 379, Expect = 1.6e-34, Identities = 82/195 (42%), Positives = 131/195 (67%)
  Q:    77 LNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           L  ++   + HAF+G NGAGKTT IK I+ +Y+ F G I I+   NK  E++  +GY+PEN+FFP  ++S+++LY    L+K++ +  K   +   K  ++ +L    P NFSSGQK+KI++ Q+L ++P+++I DEP +NLDP AR +F  I+  LQK  K+IF+SSH L E+D   +++T++D GKI Y+ ++
  S:     2 LVLRLKKNQIHAFIGKNGAGKTTVIKCIVDAYQKFSGKILINNFLNKLPEAKKFIGYVPENSFFPRELNSYEFLYEFGLLSKMEPELVKKKIDYYFKFLKIENLAKLKPFNFSSGQKRKIMIVQSLIHDPELIIFDEPFSNLDPSARNEFRAIIKILQKQGKTIFLSSHNLYEIDTLIDSLTLIDKGKIYYSGQK 196
>gi|71893817|ref|YP_279263.1| putative ABC transporter atp-binding protein [Mycoplasma hyopneumoniae J] (224 aa)
Score = 378, Expect = 1.9e-34, Identities = 82/195 (42%), Positives = 131/195 (67%)
  Q:    77 LNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           L  ++   + HAF+G NGAGKTT IK I+ +Y+ F G I I+   NK  E++  +GY+PEN+FFP  ++S+++LY    L+K++ +  K   +   K  ++ +L    P NFSSGQK+KI++ Q+L ++P+++I DEP +NLDP AR +F  I+  LQK  K+IF+SSH L E+D   +++T++D GKI Y+ ++
  S:    11 LVLRLKKNQIHAFIGKNGAGKTTVIKCIVDAYQKFSGKILINNFLNKLPEAKKFIGYVPENSFFPRELNSYEFLYEFGLLSKMEPELVKKKIDYYFKFLKIENLAKLKPFNFSSGQKRKIMIVQSLIHDPELIIFDEPFSNLDPSARNEFRAIIKILQKQGKTIFLSSHNLYEIDTLIDSLTLIDKGKIYYSGQK 205
>gi|196233151|ref|ZP_03131998.1| ABC transporter-related protein [Chthoniobacter flavus Ellin428] >gi|196222795|gb|EDY17318.1| ABC transporter-related protein [Chthoniobacter flavus Ellin428] (318 aa)
Score = 367, Expect = 4.0e-33, Identities = 81/213 (38%), Positives = 126/213 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++++ NLR +Y  K H  +  + F V     H FVG NGAGKTTT+K +    R   GS+ + G D        R ++G++P++     +++ F+YL +      I  KE       +L    M   ++   N  S G ++++ LA+ L ++PD+L++DEP + LDP+ARI+  +ILGEL++L K+IFISSHILSEL    + VTILD G++ YT
  S:     6 VIDIQNLRHRY--KTHQALGGVTFSVQRQSIHGFVGPNGAGKTTTLKILATLLRPQMGSVGVFGHDIFADRKAVRRRIGFMPDHFSMYRQMTVFEYLDFFGAAYGIGLKERDKIIGDVLALTDMAGRKDDLINGLSRGMQQRVSLARVLVHDPDLLLLDEPASGLDPRARIELMEILGELRRLGKTIFISSHILSELATLCDHVTILDRGEVKYT 218
>gi|78043083|ref|YP_361221.1| ABC transporter, ATP-binding protein [Carboxydothermus hydrogenoformans Z-2901] >gi|77995198|gb|ABB14097.1| ABC transporter, ATP-binding protein [Carboxydothermus hydrogenoformans Z-2901] (301 aa)
Score = 364, Expect = 9.2e-33, Identities = 73/210 (34%), Positives = 134/210 (63%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LE V+L K YYG++     N++  V PGE  AF+G NGAGK+T +K+ +G  +   G+I + G   ++L  R K+GY+PEN   P  +++ + L +  KL  +  K+ K   E +L + ++W+ ++     +S G ++++ LA AL   P++L +DEPT+ LDP  RI+  +I+ +L++   ++F++SH+LSE+++ +++V I++ G+I
  S:     2 VLESVDLTK-YYGRE-IGCRNISLGVSPGEIFAFLGPNGAGKSTFVKTALGLLKPTSGTIRLFGKSPEDLHVRRKVGYLPENIRLPEWMTAEELLRFHGKLLYLPEKKLKRRIEEVLTRTKLWERKDSRIKTYSQGMRQRLALAVALLGEPELLFLDEPTSALDPVGRIEVREIITDLKRQGVAVFLNSHLLSEVEMVADSVAIINRGEI 209
>gi|147919093|ref|YP_687176.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110622572|emb|CAJ37850.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (313 aa)
Score = 362, Expect = 1.4e-32, Identities = 94/271 (34%), Positives = 157/271 (57%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRIKLVEDFEGDK--------VGKYEVNSNNEIIYEFKDKNELA-ELIDKLISKEI-LVKFEKYYLSIEDLYKK 344
           I N+N  +  G    F+GANGAGKTTTIK ++G  +   G+  +SG D +    + +  +GY+P+       +S +D + YTA+L+   ++E K   E +LKK  +++ RNQ    +S G ++K+ LA+AL N+PD+L +DEPT+ LDP A  +  D++  L +  K+IFI+SH+L E++     + I+ +G IV     +  + +      RIK+     G          +GK E+   ++ IY   D++ LA E+  +L S  I +++      S+ED+Y K
  S:    27 IKNINLNIRSGTCFGFIGANGAGKTTTIKILVGLLKPETGTAIVSGYDVRAEPEKVRKIVGYLPDTYGLYDYMSGYDIVDYTARLHGFNTRERKEIVEYLLKKLDLFEARNQKVGRYSKGMRQKVALARALVNDPDVLFLDEPTSGLDPVAARNIEDLIKSLTREGKTIFITSHVLPEVEKVCGHLAIIKSGTIVAAGSMDDMRRKFYAPAIRIKVSGLAAGANKALAVLGGLGKVEL--ADDYIYIHGDRDALAPEINRRLASAGISIMEMSSNIQSLEDVYFK 309
>gi|146295738|ref|YP_001179509.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409314|gb|ABP66318.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] (310 aa)
Score = 352, Expect = 1.9e-31, Identities = 96/271 (35%), Positives = 156/271 (57%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT---QKRNKNENGEMCYRIKLVEDFEG--------DKVGKYEVNSNNEIIYEFKDKNELAELIDKLISK 325
           PLLE+  L K +YGKK   +DNL+F V  G+   FVG NGAGKTTT+K + G  R   G + I+G+D +KNL   +  +GY+P+       +   +YL + A   +IK  +A+   + +L+  R+ D +    ++ S G K+++ LA+ L +NP +L++DEP + +DP++RI+  +IL  L+ + K+I ISSHIL EL      V I++ G++V      +     +G    +++  EDFE           V   +V  N  I+    + N++  LI  LI +
  S:     2 PLLEIEGLTK-FYGKKK-AVDNLSFSVEEGQIFGFVGPNGAGKTTTMKIMCGLLRADGGCVKINGMDISKNLSKIKALVGYMPDFFGVYDNLKVNEYLEFFAHAYRIKGTKAQKMIDDLLELVRLTDKKYDFVDSLSRGMKQRLCLARCLIHNPLLLVLDEPASGMDPQSRIEMKEILKNLKDMGKTIIISSHILPELSELCTHVGIINQGRMVAQGDIAQITMLAHGTKRIKVRFAEDFEEALTVFKEFPAVSNVQVIENGYILSFDGNDNDIFLLIKGLIDR 283
>gi|163816839|ref|ZP_02208202.1| hypothetical protein COPEUT_03029 [Coprococcus eutactus ATCC 27759] >gi|158448096|gb|EDP25091.1| hypothetical protein COPEUT_03029 [Coprococcus eutactus ATCC 27759] (321 aa)
Score = 351, Expect = 2.6e-31, Identities = 75/215 (34%), Positives = 131/215 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           ++++VNL K Y G     +DNLN  +  GE   FVG NGAGKTTT+K + G  +   G + I G++   K+ + R K+GY+P+           +Y+ +   +  +  + +   A+ +L+   + D R +  +  S G K+++ +A+AL ++P++LI+DEP + LDP+AR++  DI+ +L++L K++ ISSHIL EL     ++ I+D+G+IV + K
  S:     1 MVDIVNLTKYYDG--FAALDNLNLHIDKGEIFGFVGPNGAGKTTTMKIMCGLIKATSGELLIDGVNVLKKSADVRRKIGYVPDFFGVYDNFKVIEYMEFYGSMYGMSRQASDEMADRLLELVDLSDKREEFVDVLSRGMKQRLCVARALIHDPELLILDEPNSGLDPRARVEMKDIMKKLRELGKTVVISSHILPELSEMCTSIGIIDHGRIVSSGK 215
>gi|149173305|ref|ZP_01851936.1| ABC transporter, ATP-binding protein [Planctomyces maris DSM 8797] >gi|148848111|gb|EDL62443.1| ABC transporter, ATP-binding protein [Planctomyces maris DSM 8797] (319 aa)
Score = 350, Expect = 3.4e-31, Identities = 74/216 (34%), Positives = 131/216 (60%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++P++++ N+   + G  H  +  ++F+V P   H FVG NGAGKTTT+K I    R   G + + G D ++   E R ++G++P++     +++ F+YL +      +  ++       +L    M   ++   +  S G ++++ LA+ L N+PD+L++DEP + LDP+ARI+  +IL EL+++ K+IFISSHILSEL    ++VTI+D G + Y+
  S:     7 SQPVIDIQNVSHSFKG--HRALQGISFQVQPQSLHGFVGPNGAGKTTTLKIICTLLRPQGGKVEVFGHDVRSSVKEIRKRIGFMPDHFSTYRQMTVFEYLDFFGAAYGLGLEQRNQVINDVLTLTDMDGRKDSLISGLSRGMQQRVSLARVLVNDPDLLLLDEPASGLDPRARIELMEILQELKRMGKTIFISSHILSELAELCDSVTIIDRGLVKYS 222
>gi|18976651|ref|NP_578008.1| putative ABC transporter [Pyrococcus furiosus DSM 3638] >gi|18892223|gb|AAL80403.1| putative ABC transporter [Pyrococcus furiosus DSM 3638] (312 aa)
Score = 347, Expect = 8.0e-31, Identities = 83/215 (38%), Positives = 134/215 (62%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           ++E  +L K ++GK++  + +LN KV  G  + F+G NGAGKTTTIK + G+ R   G I I G+D   K ++   K+GY+PE       ++ F++L Y  +L+ +K +EA+  A+ ++K   +  +        SSGQK+++  A AL  NP++LI+DEPTANLDP  RI+F   +  L K  K+IF+SSHI+SE++   N V +++ G+++   K
  S:     4 VIETKDLTK-FFGKRN-IVYHLNLKVPKGVVYGFLGPNGAGKTTTIKMLTGALRPTYGEIKIFGLDMPQKRVDIMKKVGYMPEVPIAYEDMTIFEFLIYMGRLSGLKKEEAREQAKMLMKYVGVGRVALNKIKELSSGQKQRVSFASALIGNPELLILDEPTANLDPLGRIEFIGKIISLAKEGKTIFVSSHIVSEVEKMCNYVGLINQGRLIAQGK 218
>gi|118580083|ref|YP_901333.1| ABC transporter related [Pelobacter propionicus DSM 2379] >gi|118502793|gb|ABK99275.1| ABC transporter related [Pelobacter propionicus DSM 2379] (304 aa)
Score = 346, Expect = 9.5e-31, Identities = 72/210 (34%), Positives = 120/210 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTID---NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +E+  L KQ+ GK+   +D   NL+ +V  GE   F+G NGAGK+TTIK ++G  R   G   I G+D     +R ++GY+PEN  F   + + +YL +      +     K  +E ILK+  +WD R +    +S G  +++ LAQ L ++PD+ I+DEP + LDP  R    +I+ EL++  + +F S+HI  +++   + V ++  G +V
  S:     4 IEIKGLCKQFRGKRMTRVDALKNLDLQVAAGEVFGFLGPNGAGKSTTIKLVMGLLRPSSGRTSIYGVDFAQAMARRRVGYLPENPAFYDYLGAEEYLAFVGSQFGMDRSLLKERSEEILKRLELWDARKRPMRGYSKGMVQRVGLAQTLVHDPDVYILDEPMSGLDPIGRALVKEIILELKQRGRCVFFSTHITDDVEKVCDRVGVIVKGSLV 216
>gi|57641514|ref|YP_183992.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] >gi|57159838|dbj|BAD85768.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] (307 aa)
Score = 346, Expect = 1.1e-30, Identities = 88/269 (32%), Positives = 157/269 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIP-ENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLV-EDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDLY 342
           +D LN  V  G    F+G NGAGKTTTI   +G  +   G  Y++GI+ +   +E +   GY+P E + +P+ +S+ D L Y AK  ++   EA+  A  +L+   + D+ ++   +FS+G K+++LLAQAL N+P +L +DEPT  LDP+  ++  D+L +L+K  K+I  SSHILSE+++ S+ + I+  GK++ +  +++ +   +  R  +V E  E   VG  ++++ +      + +N L    ++ I  E+L   E    ++ D++
  S:    19 VDGLNLAVKKGTIFGFLGPNGAGKTTTILMFLGLIQPTKGEAYVNGINVQENPVEVKRISGYMPGEGSLYPN-MSALDNLLYFAKFYRMPKSEAEKRARELLELVGLKDVADKKVGSFSTGMKQRLLLAQALINDPLVLFLDEPTNGLDPRGVVELRDVLRDLKKDGKTILFSSHILSEVEIISDEIGIISKGKLLISGSQDEIKRKFIEGRYMIVAETVEPIDVGSLDLDAAD---LRLEGQNRLVVYSERDIRVELLRMLESAGYTVLDVH 287
>gi|110005092|emb|CAK99422.1| hypothetical abc transporter atp-binding component abc transporter protein [Spiroplasma citri] (329 aa)
Score = 345, Expect = 1.3e-30, Identities = 73/199 (36%), Positives = 117/199 (58%)
  Q:    70 KHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           K+  +   NF    G+ HA +GA+G+GKT  IKS+IG  + F G I I G     +  +  +GY+PE   FP  ISS+++L Y  K N ++ +  +   E ++K   +W+ R++  N+FSSG KK++++ Q + ++P+ILI+DEP A LD   R      L +L    K++F SSH+L E+  Y +  T++ NG  +YT
  S:    23 KNSIVGPFNFNASRGKLHAILGASGSGKTVFIKSLIGGLKGFKGDITIFGKKATKISMKKMIGYVPEFVTFPENISSYNFLKYLGKTNGLRGRYLRDRIEYLMKSLEIWEHRDKDVNSFSSGMKKRVMIIQGIIHDPEILILDEPEAGLDINNRKKIIFYLKQLTLRGKTVFFSSHLLDEIKDYIDEFTMVMNGTQIYT 221
>gi|119484396|ref|ZP_01619013.1| ATP-binding protein of ABC transporter [Lyngbya sp. PCC 8106] >gi|119457870|gb|EAW38993.1| ATP-binding protein of ABC transporter [Lyngbya sp. PCC 8106] (357 aa)
Score = 343, Expect = 2.6e-30, Identities = 72/213 (33%), Positives = 128/213 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV NL K Y     P + +++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   +++  R ++GY+PEN      +S   +LY+ A++ ++ + + +   E+ LKK  +W+ R       S G ++++ +AQAL ++P ++++DEPT  LDP+  I+  +++  L   H +I +S+HIL E+ +  N VTI++ G++V T
  S:     1 MIEVENLCKIY--GSTPALQDVSFSVEAGEILGFLGPNGAGKTTTLRILSGYLPATSGTAKIAGYDVHEQSIAVRQRIGYLPENPPLYPEMSVESFLYFVARIKRVVAGDRRQNVEAALKKCGLWERRKSLIRKLSKGYRQRVGIAQALVHDPPVIVLDEPTVGLDPRQIIEVRNLIKSLAGDH-TIVLSTHILPEVSMTCNRVTIINRGQVVAT 212
>gi|14520988|ref|NP_126463.1| hypothetical protein PAB1845 [Pyrococcus abyssi GE5] >gi|5458205|emb|CAB49694.1| ABC-type multidrug transport system, ATPase component [Pyrococcus abyssi GE5] (305 aa)
Score = 342, Expect = 2.9e-30, Identities = 100/291 (34%), Positives = 175/291 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEM-CYRIKL-----VEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKE--ILVKFEKYYLSIEDLYKKYV 346
           ++E+ NL K Y   K   +DNL+ +V  G    F+G NGAGKTTTI S++G      GS+ + G D   + ++++ ++G++PEN      ++++  L + A    I  +E +   E +LK   +WD+R +   +FS G K+++LLAQAL N+P++LI+DEPT+ LDP+      DI+ E +K  K++F SSHILSE++  ++ V I+  GK+  V T +  K +  E+  Y IK+       + E   V + E  ++N+++     K+++ E++ + +SK    ++  E    S+ED++ K +
  S:     3 VIEIENLTKSY--GKFKAVDNLSLEVEKGIIFGFLGPNGAGKTTTILSMLGIIIPDSGSVRLLGYDIFKEPIKAKERLGFLPENATIYEELTAWRNLDFFASFYNIPKQEKEKRIEELLKLVGLWDVRYRKVKSFSKGMKQRLLLAQALINDPELLILDEPTSGLDPQGARLVKDIILEQKKQGKTVFFSSHILSEVEELADKVGIIVKGKLRTVGTLEEIKKQYMELEGYEIKVETKQPFPEIELPDVIRIEKIADNKVL--IFAKSDIREILSEELSKRGITVLSLEIEEPSLEDVFLKTI 301
>gi|14591171|ref|NP_143247.1| ATP-binding transport protein [Pyrococcus horikoshii OT3] >gi|3257789|dbj|BAA30472.1| 308aa long hypothetical ATP-binding transport protein [Pyrococcus horikoshii OT3] (308 aa)
Score = 341, Expect = 4.4e-30, Identities = 101/290 (34%), Positives = 171/290 (58%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEM-CYRIKL-----VEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKE--ILVKFEKYYLSIEDLYKKYV 346
           +EV  L K Y   K   IDNL+F V  G    F+G NGAGKTTTI S++G      G + I G D   + L+++ ++G++PEN      ++++  L + A   ++  +E +   E +LK   +WD+R +    FS G ++++LLAQAL N+P++LI+DEPT+ LDP+      DI+ E +K  K++F SSHILSE++  ++ V I+  GK+  V T +  K +  E+  Y IK+     + + E   + + E  + N+ I     K+++ E I + ++K+   ++  E    S+ED++ K +
  S:     4 IEVEKLTKSY--GKFKAIDNLSFVVDEGIVFGFLGPNGAGKTTTILSMLGIIIPDSGDVRILGYDIFKEPLKAKERLGFLPENATIYEELTAWRNLDFFASFYRMSKQEKEKRIEELLKLVGLWDVRYRKAKTFSKGMRQRLLLAQALINDPELLILDEPTSGLDPEGARLVKDIIREQRKQGKTVFFSSHILSEVEELADKVGIIVKGKLRTVGTLEEIKKQYMELEGYEIKIETKQPLPELEIPDIIRIEKTTENKAI--IFAKSDIRESISEELAKKGITIISLEIEEPSLEDVFLKTI 301
>gi|153811974|ref|ZP_01964642.1| hypothetical protein RUMOBE_02367 [Ruminococcus obeum ATCC 29174] >gi|149831873|gb|EDM86959.1| hypothetical protein RUMOBE_02367 [Ruminococcus obeum ATCC 29174] (363 aa)
Score = 340, Expect = 5.7e-30, Identities = 74/211 (35%), Positives = 132/211 (62%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K+Y    H  +D+L+FK+  G+ + F+G NGAGK+TT+  I G   + +G++ I G D  ++  +++  +GY+PE       ++  +Y+ + A L KI   + K   E +++  ++ D++N+   N S G ++++ LAQA+   P+++I+DEPT  LDPK  I+  D++  L+K H ++ +SSHILSE+    + V I+ +GK+V
  S:    36 VIEVNNLVKRY--GDHTAVDHLSFKIEKGKIYGFLGPNGAGKSTTMNMITGYIASTEGTVTIDGHDILDEPEQAKKCIGYLPEMPPLYFDMTVGEYMNFVADLKKIPKDQKKSMVEEVMEMVKITDMKNRLIKNLSKGYRQRVGLAQAILGYPEVIILDEPTVGLDPKQIIEIRDLIKSLKKKH-TVILSSHILSEVSAVCDYVLIISHGKLV 245
>gi|18977621|ref|NP_578978.1| putative ABC transporter [Pyrococcus furiosus DSM 3638] >gi|18893342|gb|AAL81373.1| putative ABC transporter (ATP-binding protein) [Pyrococcus furiosus DSM 3638] (308 aa)
Score = 337, Expect = 1.3e-29, Identities = 81/210 (38%), Positives = 128/210 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++E+ NL K Y   K   +D+L   V  G    F+G NGAGKTTTI S++G      GSI I G D   + ++++ ++G++PEN      ++++  L + A   K+  +E +   E +LK   +WD+R +    FS G K+++LLAQAL N+PD+LI+DEPT+ LDP+       I+ E +K  K+IF SSH+LSE++  ++ V I+  GK+
  S:     3 VIEIENLTKSY--GKFKAVDSLTLNVKEGIAFGFLGPNGAGKTTTILSMLGLIVPNSGSIKIFGYDIFKEPIKAKERLGFLPENATLYEELTAWRNLEFFANFYKMSRQEKEKRIEELLKLVGLWDVRFRRVKTFSKGMKQRLLLAQALINDPDLLILDEPTSGLDPEGAYLVKSIIREQKKAGKTIFFSSHVLSEVEELADEVGIIVKGKL 212
>gi|57640290|ref|YP_182768.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] >gi|57158614|dbj|BAD84544.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] (309 aa)
Score = 337, Expect = 1.3e-29, Identities = 99/291 (34%), Positives = 165/291 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEM-CYRIKL-----VEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEI-LVKFEKYYLSIEDLYKKYVIYG 349
           + NL K Y       +D L F V  GE   F+G NGAGKTTTI S++G     DG I I G+D   + ++ + ++GY+PEN      ++++  L + A   ++ + E +     +LK+  +WD R +    FS G K+++LLAQAL N+P++LI+DEPT+ LDP+      +++ E +   +++F SSHILSE++  S+ V I+  G++  V   +  K +  E+  Y IK+     + +   +++ + E  + N II  F   +    L   L SK + ++  E    S+ED++ K  IYG
  S:     8 IENLTKSY--GTFRAVDGLTFDVKVGEVFGFLGPNGAGKTTTILSMLGIIIPDDGRIEILGMDMSREPIKIKERIGYLPENATIYGELTAWKNLEFFANFYRMSNSEREKRITELLKRVGLWDARYRKAKTFSKGMKQRLLLAQALINDPELLILDEPTSGLDPEGAHLVKEVIREAKAEGRTVFFSSHILSEVEELSDRVGIIVRGRLKAVGPIREIKRQFMELEGYEIKVETKEPIPELRHEEITRVERLAPNRIIL-FARSDIREWLSQYLTSKGVTILSLEVEEPSLEDVFMK-TIYG 305
>gi|57641087|ref|YP_183565.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] >gi|57159411|dbj|BAD85341.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] (312 aa)
Score = 336, Expect = 1.7e-29, Identities = 78/206 (37%), Positives = 125/206 (60%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI--DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           N   +++GK++  + +LN KV  G  + F+G NGAGKTTTIK + G+ R   G I I G+   N  +E   ++GY+PE       ++ F++L Y  +L  +K ++A   A+ +++   +  L        SSGQK++   A AL  NP++LI+DEPTANLDP  R++F   + +L K  K+IFISSHI+SE++   N V +++ G ++
  S:     9 NKLTKFFGKRN-VVYHLNLKVPKGVVYGFLGPNGAGKTTTIKMLTGALRPTYGEIRIFGLRMPNDRVEIMKRVGYMPEVPIAYEDMTIFEFLVYMGRLAGMKKEDAMEQAKELMEYAGIGKLAMNRIGELSSGQKQRASFAAALMGNPELLILDEPTANLDPLGRMEFIGKVIQLAKAGKTIFISSHIVSEVEKMCNYVGLINRGTML 215
>gi|167039307|ref|YP_001662292.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166853547|gb|ABY91956.1| ABC transporter related [Thermoanaerobacter sp. X514] (308 aa)
Score = 334, Expect = 2.7e-29, Identities = 76/215 (35%), Positives = 135/215 (62%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +++  NL K+Y   K+  +  +NF+V  G  +  +G NGAGKTTT+  + G     +G IYI+G  ++  N +   ++GY+PEN  F + ++  +YLY+ +K+  I  ++ +   E +L   ++ +  N+    +S G K+K+ LA AL +NP+I+ +DEPT+ LDP++R D  + + E++K  K+IF+S+HILS+ +   + V ILD GKI+++ +
  S:     1 MIKAFNLTKKY--GKYEVLKGINFEVEKGNIYGLLGRNGAGKTTTMNILTGLIDYDEGEIYINGKMLNRNNRKLINEIGYLPENPTFYNYMTGSEYLYFISKIRGIPHQKVRTEVEELLNTVKLKEAANKKIQGYSRGMKQKLGLAVALLDNPEIIFLDEPTSALDPESRYDILNQILEMKKNGKTIFLSTHILSDAERVCDYVGILDKGKIIFSGR 215
>gi|145619414|ref|ZP_01775464.1| ABC transporter related [Geobacter bemidjiensis Bem] >gi|144944326|gb|EDJ79401.1| ABC transporter related [Geobacter bemidjiensis Bem] >gi|197088323|gb|ACH39594.1| ABC transporter related protein [Geobacter bemidjiensis Bem] (287 aa)
Score = 333, Expect = 3.6e-29, Identities = 69/210 (32%), Positives = 124/210 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTID---NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LE+  L K + GKK  +++    L+  +  GE   F+G NGAGK+TTIK ++G  R   GS  I G D  + ++R  +GY+PEN  F   +S+ +YL +  +++++ +         +LK   +WD R +   ++S G  +++ LAQ L ++P++ I+DEP + LDP  R    DI+ +L++  K +F S+HI  +++   + V ++D G+++
  S:     4 LEINGLAKTFKGKKFKSVEALKGLHLSIERGEVLGFLGPNGAGKSTTIKCLMGLIRPSAGSAKILGRDTASADARKVVGYLPENPAFYDYLSAEEYLRFVGRVHQVPAPLLAQRVAEMLKLLELWDARKRLIRSYSKGMVQRVGLAQVLVHDPEVYILDEPMSGLDPIGRALVKDIILDLKRRGKCVFFSTHITDDVEKVCDRVAVIDKGELL 216
>gi|167761373|ref|ZP_02433500.1| hypothetical protein CLOSCI_03781 [Clostridium scindens ATCC 35704] >gi|167661039|gb|EDS05169.1| hypothetical protein CLOSCI_03781 [Clostridium scindens ATCC 35704] (341 aa)
Score = 333, Expect = 3.8e-29, Identities = 81/221 (36%), Positives = 133/221 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           L+EV NL K+Y   KH  +DNL+F V  G+ + F+G NGAGK+TT+  + G      G + I+G D   +  E++  +GY+PE       ++ ++YL + A+L KI   E K   E ++K  R+ +++++  +N S G K+++ LAQA+   P+I+I+DEPT  LDPK  I+  +++  L K H ++ +SSHIL+E+    + V I+  GK+V +      EN
  S:     7 LIEVKNLTKRY--GKHLAVDNLSFTVEKGQIYGFLGPNGAGKSTTMNIMTGYLGATSGEVLINGHDILREPQEAKKCIGYLPEQPPLYMEMTVWEYLNFAAELKKIPKDEVKKQIEKVVKLTRLEEVQDRLIHNLSKGYKQRVGLAQAILGFPEIIILDEPTVGLDPKQIIEIRELIRTLAKNH-TVILSSHILAEVREVCDYVMIIAKGKLVASDTPENLEN 226
>gi|167036930|ref|YP_001664508.1| ABC transporter related [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039633|ref|YP_001662618.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166853873|gb|ABY92282.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166855764|gb|ABY94172.1| ABC transporter related [Thermoanaerobacter pseudethanolicus ATCC 33223] (325 aa)
Score = 332, Expect = 4.9e-29, Identities = 98/286 (34%), Positives = 160/286 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY---TQKRNKNENGEMCYRIKL----------VEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDL 341
           ++E+ N+ K Y  +K   +DN++F V  GE   F+G NGAGKTTT+K I G      G+I I+G D   + +E++  +GY+PE       ++   YL++   +  +  K+ +   E I+ +  + D+R +   N S G K+++ LAQA+  +PD+L++DEPT  LDPK   +  DI+ EL K H +I +S+HIL E+ +  + V I++ GKIV    T+  +        Y IK+          V++ EG    + EV+S+N I      K  +    DK + K++   F K    I +L
  S:     2 MIELKNVTKVYGTRK--AVDNISFSVDKGEIVGFLGPNGAGKTTTMKMITGYMPPTSGTIKIAGYDIVEQPIEAKKHIGYLPEVPPLYLDMTVEAYLHFVGGIKGVPPKKRREDVERIIHEVGLTDVRKRLIKNLSKGYKQRVGLAQAIIGDPDVLVLDEPTVGLDPKQIKEIRDIIKELGKKH-TIILSTHILPEVSMVCDRVIIINKGKIVAIDKTENLSTALQNSRRYFIKVEGPYEEVVNSVKEIEGVTNVEAEVDSDNTI------KLTVESSADKDVRKDMFFAFAKKGFPILEL 293
>gi|191162283|ref|ZP_03024163.1| ABC transporter related [Geobacter sp. M21] >gi|190996393|gb|EDV71841.1| ABC transporter related [Geobacter sp. M21] (287 aa)
Score = 330, Expect = 6.8e-29, Identities = 75/230 (32%), Positives = 127/230 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNL---NFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK-RNKNENGEMCYRIKLV 286
           LE+  L KQ+ GKK  T++ L      V  GE   F+G NGAGK+TTIK ++G  R   GS  I G D  + ++R  +GY+PEN  F   +S+ +YL +      +  +      E++L+   +W  R +    +S G  +++ LAQ L ++PD+ I+DEP + LDP  R    +I+ +L+K  K +F S+HI  +++   + V +++ G+++   +  N    G   Y + +V
  S:     4 LEITGLGKQFKGKKLGTVEALKGVTLAVEQGEVFGFLGPNGAGKSTTIKCLMGLIRPTTGSATILGKDIGSADARKSVGYLPENPAFYDYLSAEEYLLFVGSCFNMGGELLSRRTEAVLQLLDLWKPRRRLMRTYSKGMVQRVGLAQVLLHDPDVYILDEPMSGLDPIGRALVKEIVLDLKKRGKCVFFSTHITDDVEKVCDRVAVINKGELLVVDRVENIVRRGTEGYAVTVV 237
>gi|20807330|ref|NP_622501.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] >gi|20515844|gb|AAM24105.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] (245 aa)
Score = 330, Expect = 7.5e-29, Identities = 75/213 (35%), Positives = 123/213 (57%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKN-LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           K L+E+ N+ K Y   K   +D LN  V PGE   F+G NGAGKTTTIK I+G  +  +G I + GID  KN +E++ K+GY+P+  +   +++  +YL + A +  I  KE +   E  L+ F + +       ++S G K+K+L+  AL ++P + I+DEP   LDP++     +++    K   ++F S+HIL   +   + + I++ GKIV
  S:     4 KDLIELKNVSKSYNNGKIKAVDGLNLVVNPGEIFGFLGPNGAGKTTTIKMIVGILKPDEGEILVDGIDIQKNPIEAKKKIGYVPDEPYIYDKLTGLEYLNFIADVYGISEKERREKLEYFLEIFELKNAIGDLIQSYSHGMKQKLLITAALLHSPSVWILDEPMTGLDPRSSFLLKELMANHTKAGFTVFFSTHILEVAERLCDRIAIINKGKIV 218
>gi|125975188|ref|YP_001039098.1| ABC transporter related protein [Clostridium thermocellum ATCC 27405] >gi|125715413|gb|ABN53905.1| ABC transporter related protein [Clostridium thermocellum ATCC 27405] (369 aa)
Score = 330, Expect = 7.6e-29, Identities = 74/211 (35%), Positives = 129/211 (61%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ NL K+Y   +   +DNLNF V  GE   F+G NGAGK+TT+  I G   + +G++ ++G D   +  E + ++GY+PEN    + ++  +YL + ++L K++  + K     I++  ++ D+R +   N S G K+++  AQAL  NP++LI+DEPT  LDP   ++  +++ EL+K H  IF S+HI+ E+      + I++ G+IV
  S:     1 MIEIQNLTKRY--GQIVAVDNLNFTVEKGEIVGFLGPNGAGKSTTMNIITGYLPSTEGTVKVAGYDIAEQPNEVKRRIGYLPENPPLYTDMTVDEYLNFVSELKKVEKSKRKQQISDIMEMLKITDVRKRLIRNLSKGYKQRVGFAQALIGNPEVLILDEPTVGLDPNQILEVRNVIKELRKDHTIIF-STHIMQEVSAVCERIVIINKGRIV 210
>gi|89894278|ref|YP_517765.1| hypothetical protein DSY1532 [Desulfitobacterium hafniense Y51] >gi|109649295|ref|ZP_01373183.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] >gi|89333726|dbj|BAE83321.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109639471|gb|EAT49029.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] (296 aa)
Score = 330, Expect = 8.4e-29, Identities = 74/210 (35%), Positives = 119/210 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L +  L K+Y  K    ++N+N  + PG +   +GANGAGKTT ++ + G      G +   GI  K L    R   GY+P+   F    +  DYL+Y A L  +  K+     + +L +  + D+RN+     S G ++++ +AQAL N+PDILI+DEPT+ LDP  RI F +IL E  +  + + IS+HI+S+++  +N   I+ +G I+
  S:     3 LTIQGLTKRY--KDKTAVNNINLTLTPGVW-GLLGANGAGKTTLMRMVAGILTPTSGKVQYDGIAIKTLGEAYRDVFGYLPQTFGFYPEFTVADYLHYMAALKGLPQKKTNQKIDELLHRLTLADVRNKHIRKLSGGMQRRVGIAQALLNDPDILILDEPTSGLDPGERIRFRNILSEFAQ-QRIVLISTHIVSDVEYIANRNAIMKDGHII 210
>gi|78222615|ref|YP_384362.1| ABC transporter-related protein [Geobacter metallireducens GS-15] >gi|78193870|gb|ABB31637.1| ABC transporter-related protein [Geobacter metallireducens GS-15] (296 aa)
Score = 328, Expect = 1.3e-28, Identities = 70/209 (33%), Positives = 118/209 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTID---NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++ NL K Y GKKH  +     LN  +  GE   F+G NGAGK+TTIK + G  +  +GS  I G+  ++  SR K+GY+PEN  F   +++ +YL        +           +L K  +    ++    +S G  +++ LAQA+  +P++LI+DEP + LDP  R    D++ EL++  K+IF S+HI +++++  + V IL  G++
  S:     7 IDIANLGKTYRGKKHTIVQALKGLNIAIRKGEVFGFLGPNGAGKSTTIKILTGQIKGSEGSATIQGVPVEDPTSRKKLGYLPENPSFYDFLTAREYLRLVGNAYGMSPNAISCSTGEVLAKLELEHAADRPIRGYSKGMVQRLGLAQAMLADPELLILDEPMSGLDPLGRALVKDLIKELKQAGKTIFFSTHITADVEIVCDRVGILVGGEL 218
>gi|39996601|ref|NP_952552.1| ABC transporter, ATP-binding protein [Geobacter sulfurreducens PCA] >gi|39983482|gb|AAR34875.1| ABC transporter, ATP-binding protein [Geobacter sulfurreducens PCA] (303 aa)
Score = 327, Expect = 1.5e-28, Identities = 68/207 (32%), Positives = 120/207 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNL---NFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           + + ++ K Y GKK   ++ L   +  V  GE   F+G NGAGK+TTIK ++G  R   G+  I G    ++ SR  +GY+PEN  F   +S+ +Y+ +     ++ + E    +E +LK   +WD R +   ++S G  +++ LAQ L ++PD+ I+DEP + LDP  R    +I+ +L++  K++F S+HI+ +++   + V I+  G
  S:    15 IAIDSISKTYIGKKRVRVEALKDVSLTVGLGEVFGFLGPNGAGKSTTIKCLVGLMRPTKGTATIMGESIPSIASRRNIGYLPENPSFYDYLSAEEYIRFVGSAFQMPADELTRKSEEVLKLLELWDARKRPIRSYSKGMVQRVGLAQVLVHDPDVYILDEPMSGLDPLGRSLVKEIISDLKRRGKTVFFSTHIIDDVEKICDRVGIISGG 224
>gi|118727026|ref|ZP_01575638.1| ABC transporter related [Clostridium cellulolyticum H10] >gi|118663591|gb|EAV70240.1| ABC transporter related [Clostridium cellulolyticum H10] (337 aa)
Score = 327, Expect = 1.6e-28, Identities = 77/212 (36%), Positives = 123/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K ++E+ NL K Y   K   +D+++F V  GE   F+G NGAGK+TT+  I G   + +G++ ++G D      E + ++GY+PE       ++  +YL + A L  +  K+ K     I++  ++ D+R +   N S G K+++ LAQAL  NP++LI+DEPT  LDPK  I+   ++  L K H +I +SSHIL E+      V I++ GKI
  S:    21 KKMIEIQNLTKSYGQIK--AVDDISFTVEKGEVLGFLGPNGAGKSTTMNIITGFIPSTEGTVKVNGFDIMESPAEVKRRIGYLPELPPLYMDMTVSEYLGFAADLKNVSKKQKKSQMADIMELVKLTDVRGRLVKNLSKGYKQRVGLAQALMGNPEVLILDEPTVGLDPKQIIEIRKLIKALGKQH-TIILSSHILPEVSAVCERVVIINKGKI 231
>gi|82523933|emb|CAI78655.1| cytochrome c biogenesis ATP-binding export protein ccmA [uncultured delta proteobacterium] (241 aa)
Score = 327, Expect = 1.9e-28, Identities = 71/234 (30%), Positives = 132/234 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDF 289
           +++++NL K Y       + NLN  V  GE + F+G NGAGKTTTI+ + G      GSI I GID K   + ++  +G +P+  F   +++  ++L + A + ++ ++  +  ++++L++F +WD  N+    +S G K+++++A AL ++P IL++DEP   LDP A     DI  +L   + +IF+S+H LS  +   + + ++  G +V     ++  +     + KL E F
  S:     1 MIDLINLTKDY--GTTIAVKNLNLHVASGEIYGFIGPNGAGKTTTIRMMGGIIEPSSGSIIIDGIDMKENPVAAKKIIGVVPDRPFLYEKLTGAEFLKFIADIYEVDAQSVRQRSDNLLRQFALWDWANEIIEAYSHGMKQRLIIAAALMHDPKILVVDEPMVGLDPFAVRMVKDIFKDLAAKNVAIFVSTHTLSIAEDLCDRIGVIHKGNLVAHGTMDELNSAAQTQKAKLEEVF 234
>gi|15893560|ref|NP_346909.1| ABC transporter ATP-binding protein [Clostridium acetobutylicum ATCC 824] >gi|15023106|gb|AAK78249.1|AE007540_2 ABC transporter ATP-binding protein [Clostridium acetobutylicum ATCC 824] (258 aa)
Score = 325, Expect = 2.6e-28, Identities = 81/235 (34%), Positives = 138/235 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYR--IKLVEDFE 290
           ++E++N+ K Y GK +  +DNLNF +  GE   F+G NGAGK+TTIK I G  +   G I + G++ K   +E++ K+GY+P++     R+   +YL + A +  + + + K   ES+ K F M    +    ++S G ++KI++  AL ++PD+ I+DEP   LDPKA  +  +++ +     K++F S+H+L   +   + + I+  GKIV+    N+      E G    R  ++LVED E
  S:    15 VIELLNVNKSYNGK-NKAVDNLNFTINSGEIFGFLGPNGAGKSTTIKMITGIIKADSGEIKVDGLNIKENPIEAKRKIGYVPDSPDMFLRLKGIEYLNFMADIYDVTTSDRKERIESLSKYFDMESALDDKIQSYSHGMRQKIVVMGALIHDPDVWILDEPMTGLDPKASYNLKEMMRKHADSGKTVFFSTHVLEVAEKLCDRIGIVSKGKIVFCGTMNEMKQKLQEEGSSLERMFLELVEDGE 257
>gi|189425148|ref|YP_001952325.1| ABC transporter related [Geobacter lovleyi SZ] >gi|189421407|gb|ACD95805.1| ABC transporter related [Geobacter lovleyi SZ] (288 aa)
Score = 325, Expect = 2.7e-28, Identities = 82/275 (29%), Positives = 143/275 (52%)
  Q:    57 LEVVNLRKQYYGKKHPTID---NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKF 331
           L++  L K + GKK  T++    L   +  GE   F+G NGAGK+TTIK ++G  R   G+  I G    +  SR  +GY+PEN  F   +++ +YL +  K  K+        +  +LK+  +W+ R +    +S G  +++ LAQ L ++PD+ I+DEP + LDP  R    +I+ +L+K  KS+F S+HI  +++   + V IL +G+                  +KLV+  +        + S   + Y+ + K+    ++D+ + KE+L +F
  S:     4 LDMQGLSKSFKGKKRQTVEALKGLTLSIEQGEVFGFLGPNGAGKSTTIKCLMGLIRPTSGTASIMGEAIGSEASRRNVGYLPENPAFYDYLTAEEYLQFVGKTFKMPDALLTRRSAEVLKQLELWEARKRPIRGYSKGMVQRVGLAQVLIHDPDVYILDEPMSGLDPIGRALVKEIIVDLKKRGKSVFFSTHITDDVEKVCDRVGILLHGE------------------LKLVDRVDA-------IMSRGIVGYQVRLKDADGAVLDEEVPKELLDRF 256
>gi|146303840|ref|YP_001191156.1| ABC transporter related [Metallosphaera sedula DSM 5348] >gi|145702090|gb|ABP95232.1| ABC transporter related [Metallosphaera sedula DSM 5348] (281 aa)
Score = 325, Expect = 2.9e-28, Identities = 75/219 (34%), Positives = 126/219 (57%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN-KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN---KNENGEM 279
           NL K Y   K P +D+L+F+V  G    F+G NGAGKTTTIK + G  +   G + + G+D   N     K+  I  + + P  +   +YL+   ++ +   ++       ++++F +    ++  +  SSG  +++ L  AL  +PD+++ DEPTANLDPKAR++F+D++G L +   + FISSHILSEL+     V  ++ G++ ++   N   K E GE+
  S:     6 NLTKVY--GKRPVLDSLSFRVEKGSITGFIGPNGAGKTTTIKIVTGLLKRTSGKVEVMGMDPWNNPRIYEKVAIIFTSIYHPQEVKVKEYLHDVGRVYERDPRD-------LIEEFGLTPHLDKRLSQLSSGLAQRVQLVSALIRDPDLIVADEPTANLDPKARLEFYDVVGRLHRKGVTFFISSHILSELEKVITHVVFINRGRVTFSGTINQALKVEEGEI 219
>gi|163724968|ref|ZP_02132495.1| ABC transporter related [Desulfatibacillum alkenivorans AK-01] >gi|161401884|gb|EDQ26125.1| ABC transporter related [Desulfatibacillum alkenivorans AK-01] (242 aa)
Score = 325, Expect = 2.9e-28, Identities = 75/233 (32%), Positives = 135/233 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT--------QKRNKNENGEMCYRIKLVED 288
           ++E+  L K+Y   +   +DNLN KV  GE   F+G NGAGKTTTI+ + G      GS+ I+GID      + +  +G+IP+  +   +++  ++L +TA L  + +      AESIL+ F +WD   +  +++S G +++++++ AL ++P +LI+DEP   LDP+A     D++  L +   ++F+S+H L       + V ++  GK++ T        Q R   E+ E  + ++L E+
  S:     1 MIELSGLTKRY--GRIMAVDNLNLKVEEGEVFGFIGPNGAGKTTTIRMMGGLIAPTSGSVVINGIDMLKDPEQGKQDIGFIPDRPYLYGKLTGMEFLRFTADLYGMNNNGFFDKAESILRTFSLWDWAGELIDSYSHGMRQRLIMSAALIHDPKVLIVDEPMVGLDPRAIRLVKDMIKRLAREGMTVFVSTHTLEVAQDICHRVGVIHKGKVIATGTTKDLVEQARVDREDLEAVF-LRLTEE 240
>gi|154497725|ref|ZP_02036103.1| hypothetical protein BACCAP_01701 [Bacteroides capillosus ATCC 29799] >gi|150273223|gb|EDN00368.1| hypothetical protein BACCAP_01701 [Bacteroides capillosus ATCC 29799] (341 aa)
Score = 323, Expect = 4.9e-28, Identities = 69/211 (32%), Positives = 130/211 (61%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV +L K+Y   +H  +D+L+F V  G+ + F+G NGAGK+TT+  + G   + +G + + G  + ++  ++R ++GY+PE       ++  +YL + A+L K+ +K      + +++   + D+  +   N S G K+++ +AQAL  NP+I+I+DEPT  LDPK  I+   ++ +L K H ++ +SSHIL+E+    + + I+ +GK+V
  S:     1 MIEVRDLVKRY--GRHTAVDHLSFTVERGQVYGFLGPNGAGKSTTMNIMTGYLGHTEGEVLVDGHSMLSEPEKARRQIGYLPEQPPLYVDMTVKEYLSFAAQLKKVPAKARSGEVKRVMEHTMLTDVSGRLIRNLSKGYKQRVGIAQALLGNPEIVILDEPTVGLDPKQIIEIRTLIRDLAKEH-TVILSSHILAEVQAVCDRILIIHHGKMV 210
>gi|17229111|ref|NP_485659.1| ATP-binding protein of ABC transporter [Nostoc sp. PCC 7120] >gi|17135439|dbj|BAB77985.1| ATP-binding protein of ABC transporter [Nostoc sp. PCC 7120] (331 aa)
Score = 322, Expect = 5.9e-28, Identities = 69/213 (32%), Positives = 122/213 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y     P I ++ F V PGE   F+G NGAGKTTT++ + G      G+  I+G D  + +L  R ++GY+PE     + ++   +L++ A++  + + +  L   + +K+  + D R       S G ++++ +AQA+ ++P  +I+DEPT  LDP+  ID  +++  L   H ++ +S+HIL E  +  N V I++ GK+V T
  S:     1 MIEVEHLSKTY--GSTPAITDVTFSVEPGEILGFLGPNGAGKTTTMRILAGYLPASSGTAKIAGFDVHDNSLAVRQRIGYLPETPPLYTDMTVEGFLHFVARIKGVSAGDRSLKVNAAIKRCNLEDRRKVIIRKLSKGYRQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIDVRNLIKSLAGTH-TVILSTHILPEASMTCNRVAIINRGKVVAT 212
>gi|167403833|ref|ZP_02308653.1| hypothetical protein LmonocytFSL_05583 [Listeria monocytogenes FSL J2-003] (301 aa)
Score = 322, Expect = 6.1e-28, Identities = 99/301 (32%), Positives = 169/301 (56%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLYKKYVIYGSVD 352
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F S ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T +     +   ++ +R+  +E  +       EV  + E +    ++ E AE  ++L++K I V + +K   S+EDL+ +     S+D
  S:     1 MTERALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYSFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVAHLLSSRAQLRWRVTPIEQAKAFLESVTEVEVDGEYLVTAMNE-ESAEWNEQLVAKGIKVHEIDKRKPSLEDLFLELTGGQSID 301
>gi|51891356|ref|YP_074047.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] >gi|51855045|dbj|BAD39203.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] (240 aa)
Score = 322, Expect = 6.8e-28, Identities = 61/211 (28%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E++N+ K Y G     +DNL+  + PGE   F+G NGAGKTTTIK I+G  R   G++ + G D   + LE++ ++ Y+P+      +++  +YL + A +  I  +E +         F +        +++S G ++K++L  AL  +P + ++DEP   LDP++     +++ E  + ++++F S+H+L   +   + V I++ G+I+
  S:     1 MIELLNVSKSYSGGTKKAVDNLSLTIRPGEVFGFLGPNGAGKTTTIKMIVGLLRPDSGTVRVGGYDVVRQPLEAKRQLAYVPDTPEVYDKLTGLEYLNFIADVYGISPRERQERIAQFADAFDLTHALLDRVDSYSHGMQQKLVLISALMRDPPVWVLDEPMVGLDPRSSYQLKELMAEHARRNRTLFFSTHVLEVAERLCDRVAIINKGRII 213
>gi|149919371|ref|ZP_01907853.1| ABC transporter, ATPase subunit [Plesiocystis pacifica SIR-1] >gi|149819871|gb|EDM79295.1| ABC transporter, ATPase subunit [Plesiocystis pacifica SIR-1] (339 aa)
Score = 321, Expect = 8.0e-28, Identities = 68/228 (29%), Positives = 135/228 (59%)
  Q:    52 LTKPLLEVVNLRKQY----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEM 279
           +   +L + NLRK++      K+   +D ++F+V  GE   F+G NGAGKTTT+K ++G      G++ I G    +L ++ ++GY+PEN +F   +++ ++L+    L  +        A  +L++  +   +N+S  ++S G  +++ LAQAL  +P+++++DEP + LDP  R +  +++ EL++  K++F S+HIL++ ++  + V I+  G +     R+  + GE+
  S:     9 MASSVLTIENLRKEFVRGLLRKRTVAVDGISFEVEAGEVFGFLGPNGAGKTTTMKMLMGLILPTSGAVSILGAPVGDLAAKRRIGYLPENPYFYDYLTATEFLHMVGSLYGLDRSLRARRAGELLERVGLSMAKNRSMRSYSKGMLQRVGLAQALMGDPELVVLDEPMSGLDPIGRREVRELMLELRERGKTVFFSTHILADANMLCDRVGIIVKGTL-----RDVGQLGEL 235
>gi|160936858|ref|ZP_02084223.1| hypothetical protein CLOBOL_01747 [Clostridium bolteae ATCC BAA-613] >gi|158440239|gb|EDP17985.1| hypothetical protein CLOBOL_01747 [Clostridium bolteae ATCC BAA-613] (320 aa)
Score = 321, Expect = 8.1e-28, Identities = 78/211 (36%), Positives = 125/211 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE+  L K  YGK H  +  L+  V  G  + FVG NGAGKTTTIK + G     +G I I+G++ +    + K  +GY+P+       ++  +Y+ + A  + I    A+    ++L++  + D  +   +  S G K+++ LA+AL ++P ILI+DEPT+ LDP+ R +F +IL ELQ+  K+I ISSH+LSEL      + I+D G++V
  S:     1 MLEIRGLHK-IYGKYH-ALSGLDMTVETGALYGFVGPNGAGKTTTIKIMTGLLEAEEGRITINGMNARFDLGKLKSMIGYVPDFFGVYDNLTVSEYMEFFAACHHINGLVARKRYTALLEQVGLEDKLDFFVDGLSRGMKQRLCLARALIHDPAILILDEPTSGLDPRTRFEFREILKELQESGKTIVISSHVLSELSELCTDIGIIDQGRMV 211
>gi|167036720|ref|YP_001664298.1| ABC transporter related [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039440|ref|YP_001662425.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166853680|gb|ABY92089.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166855554|gb|ABY93962.1| ABC transporter related [Thermoanaerobacter pseudethanolicus ATCC 33223] (300 aa)
Score = 321, Expect = 8.8e-28, Identities = 74/215 (34%), Positives = 130/215 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +LE  NL KQ+ GK       +   V  G+   F+G NGAGK+T +K+++G      G  +I G      +SR K+G++PEN  +   ++  + L + A+L+KIK+   K+  +S+ +  ++    N+   N+S G +++I LA AL N+P+I+ +DEPT+ LDP  RID  +I+ EL+   K++F++SH+L E+++  + V I+++G+I+   K
  S:     2 VLETRNLTKQFNGKG--GFKEVTLSVEKGQVFGFLGPNGAGKSTFVKTMVGLLHPASGFAWILGKPIGTPKSREKIGFLPENFRYHDWMTGRELLTFHAELHKIKNPNKKI--DSLFELVKLKGHENKKIKNYSKGMQQRIGLAIALLNDPEIVFLDEPTSALDPVGRIDVREIIKELKSQGKTVFLNSHLLGEVEMVCDEVAIINHGRIIAEGK 212
>gi|167039013|ref|YP_001661998.1| ABC transporter related [Thermoanaerobacter sp. X514] >gi|166853253|gb|ABY91662.1| ABC transporter related [Thermoanaerobacter sp. X514] (237 aa)
Score = 321, Expect = 9.5e-28, Identities = 73/212 (34%), Positives = 126/212 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           +L V NL+K YYGK    +D + F++YPGE    +G NGAGK+TT+K+I+G  R  +G I + G D K+ E+R K+ YIPE       ++ ++++ + A    + + E +  A   L+ + + D +++   N S G ++K+++   L + P++++ DEP   LDPKA  +  D + EL+K  KS+ +S+H+L  +    + V IL  GK++Y
  S:     4 VLSVKNLKK-YYGKIK-AVDGITFELYPGEVVGLIGPNGAGKSTTLKTIVGLLRKTEGEIKVCGYDYKDKEARKKLSYIPEIPDIYPMLTVWEHMKFIALAYNLDNWEKE--ALRYLEAYDLLDKKDELGANLSKGMRQKVMVICGLLHKPEVMLFDEPFVGLDPKAIRELKDTIRELKKEGKSVLLSTHMLDSVQNLGDRVLILKAGKLIY 211
>gi|16802798|ref|NP_464283.1| hypothetical protein lmo0756 [Listeria monocytogenes EGD-e] >gi|153195390|ref|ZP_01940188.1| hypothetical protein LMRG_00444 [Listeria monocytogenes 10403S] >gi|16410145|emb|CAC98834.1| lmo0756 [Listeria monocytogenes] >gi|127634993|gb|EBA24373.1| hypothetical protein LMRG_00444 [Listeria monocytogenes 10403S] (301 aa)
Score = 320, Expect = 1.1e-27, Identities = 98/301 (32%), Positives = 169/301 (56%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLYKKYVIYGSVD 352
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T +     +   ++ +R+  +E  +       EV  + E +    ++ E AE  ++L++K I V + +K   S+EDL+ +     S+D
  S:     1 MTERALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVAHLLSSRAQLRWRVTPIEQAKAFLESVTEVEVDGEYLVTAMNE-ESAEWNEQLVAKGIKVHEIDKRKPSLEDLFLELTGGQSID 301
>gi|125625036|ref|YP_001033519.1| ABC-type transporter ATP-binding protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124493844|emb|CAL98837.1| ABC-type transporter ATP-binding protein [Lactococcus lactis subsp. cremoris MG1363] (256 aa)
Score = 320, Expect = 1.1e-27, Identities = 76/211 (36%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L+V NL   Y G  HP +  LNF++  GE    +G NGAGK+TTI+ IIG    + G I + G+   ++LE  R K+G+IPE       ++  +++  TA    I    A   AE +L+ FR+ D  +  P NFS G K+K+++  A    P + I+DEP   LDP A  D  D++ E++K   SI +S+HIL+  + + +   +L  G++V
  S:     1 MLKVTNLTGGYLG--HPVLKELNFEIKEGELVGLIGLNGAGKSTTIQEIIGLLTPYSGQIELDGLTLQQDLEGYRRKIGFIPETPSLYEELTLREHIEVTALAYGISVDLAFKRAEKLLETFRLSDKLDWFPVNFSKGMKQKVMIICAFLVEPSLYIVDEPFMGLDPLAIQDLIDLMMEMKKTGSSILMSTHILATAEKFCDKFIVLHEGQVV 211
>gi|167758458|ref|ZP_02430585.1| hypothetical protein CLOSCI_00798 [Clostridium scindens ATCC 35704] >gi|167664355|gb|EDS08485.1| hypothetical protein CLOSCI_00798 [Clostridium scindens ATCC 35704] (296 aa)
Score = 319, Expect = 1.3e-27, Identities = 71/217 (32%), Positives = 126/217 (58%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           LE+ ++ KQY  K+   +D+++  + PG +   +GANGAGKTT ++ I G  +   G +   GI+   L+   R   GY+P+   F      ++YL Y A L  +   E K   E++L+   + ++R +  +  S G K+++ +AQA+ N+P++LI+DEPT+ LDP  R+ F ++L E  +  + + IS+HI+S+++  +    I+  G+I+ T K  K
  S:     4 LEICDITKQYKDKR--AVDHVSLTLTPGIW-GLLGANGAGKTTLMRMIAGIQKPTSGCVRYDGIEIGTLKESYRDVFGYLPQEFGFYPGFHVWEYLEYIAALKGLGKAETKKKIEALLEMLSLQEVRKKQISKLSGGMKRRVGIAQAMLNDPEVLILDEPTSGLDPGERVRFRNLLSEFAR-GRIVLISTHIVSDVEYIATCNAIMKEGRIIATGKTEK 218
>gi|52082392|ref|YP_081183.1| ABC transporter [Bacillus licheniformis ATCC 14580] >gi|52787782|ref|YP_093611.1| YxlF [Bacillus licheniformis ATCC 14580] >gi|52005603|gb|AAU25545.1| ABC transporter [Bacillus licheniformis ATCC 14580] >gi|52350284|gb|AAU42918.1| YxlF [Bacillus licheniformis DSM 13] (295 aa)
Score = 319, Expect = 1.3e-27, Identities = 84/289 (29%), Positives = 163/289 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQ--KRNKNENGEMCYRIKLVEDFEG-----DKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEI-LVKFEKYYLSIEDLYKK 344
           +L V  L K Y  ++H  + N++F +   +  A +G NGAGKTTT++ + G      G I   G ++ N   R ++GY+P++  F S +++ +Y  + A+L+K+K +EA   + + L+   +    ++    FS G K+++ LAQAL +   +LI+DEP + LDP  R +  D++ +L+K   +I  S+H+L + +   + V +L  G + ++    R KN + +  Y +   E  EG       V K   +  ++  +   D+++   L+ + +++++ +V+FE+  +S+ED+Y K
  S:     1 MLSVNGLTKMY--QQHQAVQNVSFDLEYQQCVALLGPNGAGKTTTLQMLSGLLAPTSGRIRFLGRESIN---RLEIGYLPQHPAFFSWMTALEYTVFAARLSKMKRREALEKSRTALRYVGLEKEEDRKIGGFSGGMKQRLGLAQALVHEQRLLILDEPVSALDPAGRREVLDMMKDLKK-KMTILFSTHVLHDAEEVCDQVIMLKEGAVKWSGPLHRLKNRHLKPSYMLTAEESLEGWLEHLPYVSKVVYHKPSQAEFYLTDRSDSRRLLAECLNRQVSIVRFEQKTMSLEDMYLK 291
>gi|20808535|ref|NP_623706.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] >gi|20517158|gb|AAM25310.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] (325 aa)
Score = 319, Expect = 1.5e-27, Identities = 93/286 (32%), Positives = 154/286 (53%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-------------NENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDL 341
           ++E+ N+ K Y  +K   +DN++F V  GE   F+G NGAGKTTT+K I G      G+I I+G D   + +E++  +GY+PE       ++   YL++   +  +  K+ K   E I+ +  + ++R +   N S G K+++ LAQA+  +P++L++DEPT  LDPK   +  DI+ +L   H +I +S+HIL E+ +  + V I++ GKIV   K                   G     +K VE+ +G       +N   EI  +   K  +    D+ I K++   F K  L I +L
  S:     2 MVELKNVTKVYGTRK--AVDNISFSVDKGEIVGFLGPNGAGKTTTMKMITGYIPPTSGTIKIAGYDIVEQPIEAKKHIGYLPETPPLYLDMTVEAYLHFVGGIKGVPPKKRKEDVEKIMYEMGLMEVRKRLIKNLSRGYKQRVGLAQAIIGDPEVLVLDEPTVGLDPKQIKEIRDIIKKLGGKH-TIILSTHILPEVSMVCDRVIIINKGKIVAMDKTENLSIALQNVLRYFIKAEGPYDKVVKTVENIDG------VINVEAEIEEDMMVKLTVESSNDRDIRKDVFFAFAKEGLPILEL 293
>gi|157133283|ref|XP_001662815.1| ATP-binding cassette sub-family A member 3, putative [Aedes aegypti] >gi|108870889|gb|EAT35114.1| ATP-binding cassette sub-family A member 3, putative [Aedes aegypti] (1622 aa)
Score = 319, Expect = 1.6e-27, Identities = 75/263 (28%), Positives = 135/263 (51%)
  Q:     3 FPFTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           FPFTK   +F S   S  ++       +E     +YFE       E+       +++ NLRK  YG     +D L+  +Y G+    +G NGAGKTTT+  + G +    G+  I+G D +    E R  MG+ P++      ++  ++L + A+L  I+S E +   +  + +  + +      +  S G K+K+ +  A+  NP ++++DEP+  +DP AR   +D L E +K  K++ +S+H ++E D+  + + IL +GK+
  S:   448 FPFTK---DFWSRQSSADVD-----LLLEPTERSKYFE-------EETQFRASGVQIRNLRK-VYGSGKVAVDGLSLNLYEGQITVLLGHNGAGKTTTMSMLTGMFSPSSGTALINGYDIRRRMDEVRGSMGFCPQHNVLFDELTVHEHLQFAARLKGIRSDEVRSQVDRYINRLGLMEKARAEASTLSGGMKRKLSVGMAMCGNPKVVLLDEPSTGVDPTARHALWDFLHE-EKRDKTVLLSTHYMNEADVLGDRIAILADGKL 695
Score = 215, Expect = 1.6e-15, Identities = 64/244 (26%), Positives = 119/244 (48%)
  Q:    44 RVNQ-EDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK-NL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK---IVYTQKRNKNENGEMCYRIKLVE 287
           R++Q  D D+    L + NL K Y       +  L+    P E    +G NGAGKTTT + + G      G ++I+G++ K NL ++   +GY P+       ++  + L   A L  I          S  ++  +    ++    +S G K+K+  A AL  NP ++ +DEPT+ +DP A+   ++++  L+   ++I +++H + E +     + I+ NG+   +  TQ      +G     IK+++
  S:  1290 RISQMTDTDIAAHSLVLRNLTKNY--GPISAVKWLSLGTQPSECFGLLGVNGAGKTTTFRMMTGDESISFGDVWINGVNVKSNLAQAYQHVGYCPQFDGLLDELTGLETLRIFAMLRGIPGIYIDSVVRSHAEELGLTMHLDKPIREYSGGTKRKLSTALALIGNPSVIFLDEPTSGMDPGAKRQLWNVINRLRDAGRTIILTTHSMDECEALCTRLAIMVNGEFKCLGSTQHLKNKFSGGFLLHIKMLQ 1537
>gi|57233926|ref|YP_182050.1| ABC transporter, ATP-binding protein [Dehalococcoides ethenogenes 195] >gi|57224374|gb|AAW39431.1| ABC transporter, ATP-binding protein [Dehalococcoides ethenogenes 195] (306 aa)
Score = 318, Expect = 1.7e-27, Identities = 76/211 (36%), Positives = 130/211 (61%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKL-HKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K + GK    +DN++F V PGE   F+G NGAGKTTT++ I+G      G   ++G +  K+  +R+K+G + E      R+S+++ L Y A + +I ++EA++    +L+ F +   RN     FS G K+K+ LA+A+ + P++L +DEP + LDP+A+ +F D++  L +  + +IF++SH L E+    N V I+  GK++
  S:     1 MIEVNNLSKTFKGKT--VLDNISFSVAPGEIFGFLGPNGAGKTTTMRIILGLLNPSSGQATLNGKNLAKDDAARSKVGVLLEVDGIYDRLSAYENLRYFADIYRIPNREARI--NELLEFFDLNGRRNDPAGKFSKGMKRKLALAKAIMHKPEVLFLDEPASGLDPEAQKNFRDLILSLSREGNMTIFLNSHDLDEVQRICNKVAIIKGGKLL 209
>gi|20808765|ref|NP_623936.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] >gi|20517410|gb|AAM25540.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] (300 aa)
Score = 318, Expect = 1.7e-27, Identities = 73/215 (33%), Positives = 131/215 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +LE  NL KQ+ GK       +   V  G+   F+G NGAGK+T +K+++G      G  +I G     +ESR K+G++PEN  +   ++  + L + A+L KIK+   K+  + +L+  ++    N+   N+S G +++I +A AL N+P+I+ +DEPT+ LDP  RID  +I+ +L+   K++F++SH+LSE+++  + V I+++G+++   K
  S:     2 VLETQNLTKQFNGKG--GFKEVTLSVEKGQVFGFLGPNGAGKSTFVKTMVGLLHPTSGFAWILGKPIGTVESREKVGFLPENFRYHDWMTGKELLTFHAELYKIKNPGKKI--DELLELVKLKGHENKLIKNYSKGMQQRIGIAIALLNDPEIVFLDEPTSALDPVGRIDVREIIKQLKSQGKTVFLNSHLLSEVEMVCDEVAIINHGRVIAQGK 212
>gi|14521260|ref|NP_126735.1| atp-binding transport protein [Pyrococcus abyssi GE5] >gi|5458478|emb|CAB49966.1| ATP-binding transport protein [Pyrococcus abyssi GE5] (315 aa)
Score = 318, Expect = 1.8e-27, Identities = 73/206 (35%), Positives = 124/206 (60%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +++GK++  + NLN KV  G  + F+G NGAGKTTTIK + G+ +   G I I G++   + ++    +GY+PE       ++ F++L Y  +L  +   +A   A  ++    +  L        SSGQ++++L A AL  +P++LI+DEPT+NLDP  R++F   + EL K  K++FISSHI+SE++   N V ++ +G+++   K
  S:    13 KFFGKRN-VVYNLNLKVPKGAVYGFLGPNGAGKTTTIKMLTGALKPTYGEIKIIGMEMPRERVKIMRNVGYMPERPLAYDDMTIFEFLVYMGRLLGLPKDKAVNQARELMAYTGVGRLAFNKIEELSSGQRQRVLFASALMGDPELLILDEPTSNLDPLGRMEFIGKILELAKSGKTVFISSHIVSEIERMCNYVGLIKDGQLIEQGK 219
>gi|157109703|ref|XP_001650791.1| ATP-binding cassette sub-family A member 3, putative [Aedes aegypti] >gi|108868422|gb|EAT32647.1| ATP-binding cassette sub-family A member 3, putative [Aedes aegypti] (1549 aa)
Score = 318, Expect = 1.8e-27, Identities = 75/263 (28%), Positives = 135/263 (51%)
  Q:     3 FPFTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           FPFTK   +F S   S  ++       +E     +YFE       E+       +++ NLRK  YG     +D L+  +Y G+    +G NGAGKTTT+  + G +    G+  I+G D +    E R  MG+ P++      ++  ++L + A+L  I+S E +   +  + +  + +      +  S G K+K+ +  A+  NP ++++DEP+  +DP AR   +D L E +K  K++ +S+H ++E D+  + + IL +GK+
  S:   374 FPFTK---DFWSRQSSADVD-----LLLEPTERSKYFE-------EETQFRASGVQIRNLRK-VYGSGKVAVDGLSLNLYEGQITVLLGHNGAGKTTTMSMLTGMFSPSSGTALINGYDIRRRMDEVRGSMGFCPQHNVLFDELTVHEHLQFAARLKGIRSDEVRSQVDRYINRLGLMEKARAEASTLSGGMKRKLSVGMAMCGNPKVVLLDEPSTGVDPTARHALWDFLHE-EKRDKTVLLSTHYMNEADVLGDRIAILADGKL 621
Score = 211, Expect = 5.3e-15, Identities = 64/244 (26%), Positives = 119/244 (48%)
  Q:    44 RVNQ-EDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK-NL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK---IVYTQKRNKNENGEMCYRIKLVE 287
           RV+Q  D D+    L + NL K Y       +  L+    P E    +G NGAGKTTT + + G      G ++I+G++ K NL ++   +GY P+       ++  + L   A L  I          S  ++  +    ++    +S G K+K+  A AL  NP ++ +DEPT+ +DP A+   ++++  L+   ++I +++H + E +     + I+ +G+   +  TQ      +G     IK+++
  S:  1217 RVSQMTDTDIAAHSLVLRNLTKNY--GPISAVKWLSLGTQPSECFGLLGVNGAGKTTTFRMMTGDESISFGDVWINGVNVKFNLAQAYQHVGYCPQFDGLLDELTGLETLRIFAMLRGIPGIYIDSVVRSHAEELGLTMHLDKPIREYSGGTKRKLSTALALIGNPSVIFLDEPTSGMDPGAKRQLWNVINRLRDAGRTIILTTHSMDECEALCTRLAIMVSGEFKCLGSTQHLKNKFSGGFLLHIKMLQ 1464
>gi|167461926|ref|ZP_02327015.1| ABC-type multidrug transport system, ATPase component [Paenibacillus larvae subsp. larvae BRL-230010] (365 aa)
Score = 318, Expect = 1.9e-27, Identities = 73/211 (34%), Positives = 124/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LEV  + K Y  ++   +  ++F +  GE   F+G NGAGKTTT++ I G      GSI++ G+   +   ++R K+GY+PE       +S   YL + AK+  + +++ K   E ++ K  +     Q   + S G K+++ LAQA+ + PD+LI+DEPT+ LDPK  I+   ++ EL + H ++ +S+HIL E++   N V I++ G+IV
  S:     1 MLEVKQVSKLYENQR--GVKEIDFSMQRGEIVGFLGPNGAGKTTTMRMITGYINPTRGSIHVDGLSMADHPKKARRKIGYLPETPPLYPEMSVLSYLKFIAKIKDVPARDQKKRIEEVVDKLGLAGRERQIIRHLSKGYKQRLGLAQAIIHKPDLLILDEPTSGLDPKQIIEIRQLIRELGENH-TVLLSTHILPEVNAICNRVLIINQGRIV 210
>gi|11498736|ref|NP_069965.1| ABC transporter, ATP-binding protein [Archaeoglobus fulgidus DSM 4304] >gi|2649451|gb|AAB90107.1| ABC transporter, ATP-binding protein [Archaeoglobus fulgidus DSM 4304] (294 aa)
Score = 318, Expect = 1.9e-27, Identities = 81/214 (37%), Positives = 123/214 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPEN-TFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +EV NL K + G +   +D ++  V  GE   F+G NGAGKTTTI   +G  +   GS+ I+G+D   K +E +   GY+PEN  F+P+  +  + LY++      K    +L A   L+     D  ++    FS G K+++ LAQAL N+P+++ +DEPT  LDP+   DF  I+ EL +  K+ F SSHILSE+    + V I++ G+IV   K
  S:     4 IEVENLTKVFNGFR--ALDGISLVVERGEIFGFLGPNGAGKTTTINCCLGLIKPTSGSVRIAGMDVEEKPVEVKEICGYLPENYGFYPNLTARQNLLYFSEFYANPKDNVDELLALVGLQ-----DSADKKVGEFSRGMKQRLALAQALINDPEVVFLDEPTNGLDPQGIADFRKIIRELNQKGKTFFFSSHILSEVREVCSVVGIINRGRIVKVGK 213
>gi|73662271|ref|YP_301052.1| ABC-type multidrug transport system ATPase component [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494786|dbj|BAE18107.1| ABC-type multidrug transport system ATPase component [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (245 aa)
Score = 318, Expect = 2.0e-27, Identities = 73/200 (36%), Positives = 121/200 (60%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK-NLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I N+NF++  GE    +G NGAGK+TTIK ++G     +G++ IS I+ K ++E+ R K+ YIPE+      ++  +++Y TA    I  + A   A  +LK FR+ D  N  P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E ++  +++ +S+HIL+  + Y +   I+D G+IV
  S:    12 YGKR-PVIKNINFELTQGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGNLSISDINIKQDVETYRRKLSYIPESPVIYEELTLQEHIYMTAMAYNISREVAMERARPLLKTFRLEDELNIFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKQEGRTVLMSTHILATAERYCDRFLIMDEGEIV 212
>gi|109899449|ref|YP_662704.1| ABC transporter related [Pseudoalteromonas atlantica T6c] >gi|109701730|gb|ABG41650.1| ABC transporter related [Pseudoalteromonas atlantica T6c] (306 aa)
Score = 318, Expect = 2.1e-27, Identities = 72/212 (33%), Positives = 125/212 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYI--SGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++ V NL K +       +++LNF V PG+   F+G NGAGK+TT+K + G  +   GSI I    I     + + ++GY+PE     S ++++ +L + A++   + KE +    ++++K  + D+ N+   N S G K+++ LAQAL ++PDILI+DEPT  LDP  +    +++ +L +  K + IS+HIL E+    N V I+  GK+++
  S:     1 MISVKNLSKSF--GHFSAVEDLNFDVKPGDIVGFLGPNGAGKSTTMKMLTGFLQPTHGSIDIFDMSISQHTKDIQERIGYLPEGAPAYSDMTTYQFLKFIAEVRGFRGKEKEQRIRNVIEKIELQDVVNRPIENLSKGFKRRVGLAQALIHDPDILILDEPTDGLDPNQKHQVRELITQLAQ-DKIVIISTHILEEVTAVCNRVMIIAKGKLLF 211
>gi|186456947|ref|ZP_02967259.1| ABC transporter related [bacterium Ellin514] >gi|184206583|gb|EDU03630.1| ABC transporter related [bacterium Ellin514] (251 aa)
Score = 317, Expect = 2.4e-27, Identities = 72/210 (34%), Positives = 124/210 (59%)
  Q:    56 LLEVVNLRKQYYGK---KHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LE+ +LR +Y  +   + P +    LN  V  GE   F+G NGAGKTTT+  ++G      G+ Y+ G++     +R ++GY+PE T++   +S+ + L + A++  I   E     + ++K   +   R++    +S G ++++ LAQAL NNPD+LI+DEPT+ LDP  R+   +I+  L+   K++F SSH L E++   + V IL  G++
  S:     4 ILEIKDLRVEYRTRSIGQAPKVALKGLNLSVKQGEVFGFLGPNGAGKTTTMNVLLGFVNATAGAAYLFGVNVNEPIARQRIGYLPELTYYYKFLSADELLRFYARIFGIPRSETNRRIDELIKLVELEHARHRPIKTYSKGMQQRVGLAQALINNPDLLILDEPTSGLDPIGRMKVREIIQRLKNEGKTVFFSSHELGEVETVCDRVAILYQGEL 218
>gi|15673978|ref|NP_268153.1| ABC transporter ATP binding protein [Lactococcus lactis subsp. lactis Il1403] >gi|12725041|gb|AAK06094.1|AE006429_12 ABC transporter ATP binding protein [Lactococcus lactis subsp. lactis Il1403] (256 aa)
Score = 317, Expect = 2.4e-27, Identities = 76/211 (36%), Positives = 120/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L+V NL   Y G  HP + +LNF++  GE    +G NGAGK+TTI+ IIG    + G I + G+   ++LE  R K+G+IPE       ++  +++  TA    I    A   AE +L+ FR+ D  +  P NFS G K+K+++  A    P + I+DEP   LDP A  D  D++ +++K   SI +S+HILS  + + +   +L  G++V
  S:     1 MLKVTNLTGGYLG--HPVLKDLNFEIKEGELVGLIGLNGAGKSTTIQEIIGLLTPYSGQIELDGLTLQQDLEGYRRKIGFIPETPSLYEELTLREHIEVTALAYGISVDLAFERAEKLLETFRLSDKLDWFPVNFSKGMKQKVMIICAFLVEPSLYIVDEPFMGLDPLAIQDLIDLMIDMKKSGSSILMSTHILSTAEKFCDKFIVLHEGQVV 211
>gi|153895728|ref|ZP_02016309.1| ABC transporter related [Halorubrum lacusprofundi ATCC 49239] >gi|151585422|gb|EDN48848.1| ABC transporter related [Halorubrum lacusprofundi ATCC 49239] (332 aa)
Score = 317, Expect = 2.6e-27, Identities = 73/228 (32%), Positives = 122/228 (53%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRI 283
           ++EV  LRK Y G     +D+  F V  GE    VG NGAGKTTT+K + G     DG + ++G  + + E R ++G++PE +     ++   YL + A L  +  K A    E+ L +  + D R +   + S G K+K+ +A++L N+PD+L+ DEP + LDP       +   EL+   K++  S+H L  ++   + V ++D G+IV     +  +  +GE  YR+
  S:     1 MIEVEGLRKTY-GDFAAVVDS-TFSVAEGEVFGIVGPNGAGKTTTLKVLAGLVDPSDGEVEVAGFASDDPEMRRQLGFLPEESPLYEEMTPLSYLRFFADLYDVPRKAANERIEAALDRLEL-DHRERRLGDMSKGMKRKVAIARSLVNDPDVLVYDEPASGLDPVTTNSVLEFTRELRSTGKTVVFSAHNLYHVESVCDRVAVMDEGRIVARGSVDGIRERHGETTYRV 227
>gi|189218424|ref|YP_001939065.1| ABC-type transport system involved in gliding motility, ATPase component [Methylokorus infernorum V4] >gi|189185282|gb|ACD82467.1| ABC-type transport system involved in gliding motility, ATPase component [Methylacidiphilum infernorum V4] (312 aa)
Score = 316, Expect = 3.0e-27, Identities = 74/210 (35%), Positives = 125/210 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++V NL K Y G  +  ++ ++F+V  GE   F+G NGAGKTTT++ +        G + ++G D   K +E + ++GY+PEN    + +   +YL Y AKL  I+  + K   +S+LK   + ++ +    N S G ++++ LA AL ++PD+LI+DEPT  LDP       +++  L + H +I +SSHILSE++   + V I++ GKI
  S:     1 MIKVDNLVKTYSG--YTALNGISFEVKKGEIVGFLGPNGAGKTTTMRILSCYLPPTSGKVEVAGFDVLQKPIEIKKRVGYMPENVPLYTDLRVSEYLKYRAKLKGIRGGQVKERVQSVLKLCHIEEVSSSIIGNLSKGYRQRVGLADALIHDPDLLILDEPTIGLDPNQIRSVRELIRNLGQRH-TIILSSHILSEVEAVCSRVLIINKGKI 209
>gi|154503805|ref|ZP_02040865.1| hypothetical protein RUMGNA_01630 [Ruminococcus gnavus ATCC 29149] >gi|153795905|gb|EDN78325.1| hypothetical protein RUMGNA_01630 [Ruminococcus gnavus ATCC 29149] (323 aa)
Score = 316, Expect = 3.0e-27, Identities = 73/220 (33%), Positives = 131/220 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNE 275
           ++EV NL K+Y    H  ID+LNFK+  G+ + F+G NGAGK+TT+  + G     +G + I G D   +  E++  +GY+PE       +   +YL + A+L  I  ++ +   + +++  ++ D++ +   N S G ++++ LAQA+   P+I+I+DEPT  LDPK  I+  +++ EL K H ++ +SSHIL+E+    + + I+  GK+V +   ++ E
  S:     1 MIEVKNLVKKY--GNHMAIDHLNFKIEKGQVYGFLGPNGAGKSTTMNIMTGYLGATEGEVLIDGHDILKEPNEAKKHIGYLPEIPPLYVDMQVMEYLEFAAELKGIPKQQRESAIDEVIQMAKLEDVKLRLIRNLSKGYRQRVGLAQAILGFPEIIILDEPTVGLDPKQIIEIRELIRELAKKH-TVILSSHILAEIREVCDYILIISKGKLVASDTPDRLE 219
>gi|160936265|ref|ZP_02083638.1| hypothetical protein CLOBOL_01161 [Clostridium bolteae ATCC BAA-613] >gi|158441075|gb|EDP18799.1| hypothetical protein CLOBOL_01161 [Clostridium bolteae ATCC BAA-613] (365 aa)
Score = 316, Expect = 3.3e-27, Identities = 70/211 (33%), Positives = 125/211 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K Y G  H  +D+L+F+V  G+ + F+G NGAGK+TT+  + G     +G + I G D   +   ++ ++GY+PE       ++  +YL + A L K+     K   + +++  ++ D+R +   N S G ++++ +AQA+   P ++I+DEPT  LDPK  I+  D++  L K H ++ +SSHILSE+    + + I+ +GK++
  S:     1 MIEVKNLVKDYGG--HLAVDHLSFRVEDGQIYGFLGPNGAGKSTTMNIMTGYLGATEGQVIIDGHDILEEPEAAKKRIGYLPEIPPLYMDMTVDEYLEFAACLKKLPKAGQKDAIQEVMELVKITDVRKRLIRNLSKGYRQRVGMAQAILGKPSVIILDEPTVGLDPKQIIEIRDMIKGLGKQH-TVILSSHILSEVSAVCDHIMIIAHGKLI 210
>gi|75910428|ref|YP_324724.1| ABC transporter-like [Anabaena variabilis ATCC 29413] >gi|75704153|gb|ABA23829.1| ABC transporter-like [Anabaena variabilis ATCC 29413] (331 aa)
Score = 316, Expect = 3.4e-27, Identities = 71/221 (32%), Positives = 125/221 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           ++EV +L K Y     P I ++ F V PGE   F+G NGAGKTTT++ + G      G+  I+G D    +L  R ++GY+PE     + ++   +L++ A++  + + +  L   + +K+  + D R       S G ++++ +AQA+ ++P  +I+DEPT  LDP+  ID  +++  L   H ++ +S+HIL E+ +  + V I++ GK+V T   N  EN
  S:     1 MIEVEHLSKIY--GSTPAITDVTFSVEPGEIVGFLGPNGAGKTTTMRILAGYLPASSGTAKIAGFDVHENSLAVRQRIGYLPETPPLYTDMTVEGFLHFVARIKGVSAGDRSLKVNAAIKRCNLEDRRKVIIRKLSKGYRQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIDVRNLIKSLAGTH-TVILSTHILPEVSMTCSRVAIINRGKVVAT---NTPEN 217
>gi|153954146|ref|YP_001394911.1| ABC transporter ATPase [Clostridium kluyveri DSM 555] >gi|146347027|gb|EDK33563.1| Predicted ABC transporter, ATPase component [Clostridium kluyveri DSM 555] (262 aa)
Score = 316, Expect = 3.5e-27, Identities = 76/225 (33%), Positives = 135/225 (60%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV----YTQKRNKNENGEM 279
           PL+ + +L+ ++  K+   +  +N +VY GE   ++G NGAGK+TT+K ++G    ++G + I G  I N N+E + K+GY+PE       +++ +YL +  +L  +   E    AE ++K F + ++ N    ++S G K+K+L+  +L +NPDIL  DEP + LD  + I   +IL +L    K+IF SSHI+  ++  SN + +L+NG+I+    +   +NK+E   +
  S:     7 PLISIKDLKIRFGEKQ--VLKGVNLQVYKGEIIGYIGPNGAGKSTTVKIMLGLIGEYEGEVRILGQDISNGNIEYKRKIGYVPETAEIYDSLTAREYLTFIGELYGLNYNEVDKKAERLMKIFGIDEVYNSRITSYSKGMKQKVLIISSLLHNPDILFYDEPLSGLDANSVIVVKEILAKLALQGKTIFYSSHIMDVVEKISNRIVLLNNGEIIADGTFEDLKNKSEEKSL 235
>gi|78044210|ref|YP_361003.1| ABC transporter, ATP-binding protein [Carboxydothermus hydrogenoformans Z-2901] >gi|77996325|gb|ABB15224.1| ABC transporter, ATP-binding protein [Carboxydothermus hydrogenoformans Z-2901] (244 aa)
Score = 316, Expect = 3.6e-27, Identities = 70/213 (32%), Positives = 121/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++ + N+ K Y   K   +DNLN  V PGE   F+G NGAGKTTTIK + G      G + +SGID   + L+++ K GY+P+ +    R+S  ++L + A + ++ +K  +     +LK F +    N    ++S G K+K+L+  +L ++PDI I+DEP   LDP++  +   ++ +     K++F S+HIL   +     + I+  GK+++T
  S:     4 IIRLKNISKTYGEGKVLAVDNLNLTVPPGEIFGFLGPNGAGKTTTIKIMTGILAPDTGEVELSGIDLLKEPLKAKRKFGYVPDTSEIFPRLSGLEFLNFVADVYEVPAKLREERIPPLLKLFSLEGAINDRIGSYSHGMKQKLLVIASLVHDPDIWILDEPMIGLDPESSFNLKKLMQDYAARGKTVFFSTHILEVAERLCTTLGIIKKGKLIFT 218
>gi|113477799|ref|YP_723860.1| ABC transporter related [Trichodesmium erythraeum IMS101] >gi|110168847|gb|ABG53387.1| ABC transporter related [Trichodesmium erythraeum IMS101] (327 aa)
Score = 315, Expect = 3.8e-27, Identities = 74/212 (34%), Positives = 127/212 (59%)
  Q:    55 PLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAE--SILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P++E  NL K Y       +K  ++ N N  VY GE    +G NGAGKTT +K+++G  R   GS ++ G    +   + K+GY+PEN +F   ++ +++L + A L KI KS + +  +E   ++   R   +R Q    +S G  +++ +AQAL N+P+++ +DEP + LDP  R    +I+  L KL K+IF +SH+LS+++   + + IL  G+++
  S:    18 PVIETTNLSKLYRTGFWMNQKIESLKNCNLTVYQGETFGLLGQNGAGKTTLLKTLLGIVRPTSGSGFLLGQPIGDRSVKAKIGYLPENPYFYDYLTGWEFLEFVAGLFKISKSIQKQRISELLDLVGLSRSTAIRKQL-RQYSKGMLQRVGMAQALINDPELVFLDEPMSGLDPMGRYQIREIIVSLNKLGKTIFFNSHVLSDVEKICDRIAILAEGELI 236
>gi|162455653|ref|YP_001618020.1| ABC-2 type transport system ATP-binding protein [Sorangium cellulosum 'So ce 56'] >gi|161166235|emb|CAN97540.1| ABC-2 type transport system ATP-binding protein [Sorangium cellulosum 'So ce 56'] (414 aa)
Score = 315, Expect = 3.9e-27, Identities = 71/217 (32%), Positives = 126/217 (58%)
  Q:    50 IDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I+  +P + V +L  ++       + ++ F V PGE   F+G NGAGKTTTI+ +        G + I G+D        R  +GY+P++     RI+  +YL + A   ++ S +     +++L+   +  ++++     S G K+++ L + L ++P +LI+DEP ++LDP+ARI+  D+L EL+ L K+IF+SSHIL+EL     ++ IL+ G++V
  S:    17 IERPRPTIRVRHLSHRFGALD--VLKDVTFDVGPGEIFGFIGPNGAGKTTTIRVMATLLEPMAGRVEIDGVDVTIDPAAVRRSIGYMPDHAGVYDRITVREYLEFFADAFRVPSLDV---VDAVLELTDLGKIQDRIVATMSKGMKQRLQLGRILLHDPKVLILDEPASDLDPRARIEIRDLLLELRSLGKTIFLSSHILTELSDVCTSIGILEKGRLV 230
>gi|186455840|ref|ZP_02966154.1| ABC transporter related [bacterium Ellin514] >gi|184207918|gb|EDU04963.1| ABC transporter related [bacterium Ellin514] (408 aa)
Score = 315, Expect = 4.2e-27, Identities = 66/202 (32%), Positives = 122/202 (60%)
  Q:    64 KQYYGK-KHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K ++G+ K   +DN+NF+V  GE    +G NG+GK+TT+K ++G      G I +     +++ +++++GY+PE ++    ++S + L +   L ++   E +  AE +L+   +   R ++   FS G +++I LAQAL N+PD++I+DEPTA LDP    +  D++  L +  K++ +SSH+LS+++   + V I   G+I
  S:    32 KDFWGRPKARAVDNVNFEVRRGEVFGLLGPNGSGKSTTVKMLLGLLYPTKGHIEVFNHSPRHVATKSRIGYLPEESYLYRYLNSHETLDFFGNLFRLPGAEREKRAEQLLEMVGLSQTRTRAVGEFSKGMQRRIGLAQALINDPDLVILDEPTAGLDPIGCREVKDLILALARRGKTVILSSHLLSDVEDVCDRVVIYYGGRI 234
>gi|196239919|ref|ZP_03138690.1| ABC transporter related [Cyanothece sp. PCC 7425] >gi|196216178|gb|EDY10826.1| ABC transporter related [Cyanothece sp. PCC 7425] (344 aa)
Score = 314, Expect = 5.0e-27, Identities = 69/213 (32%), Positives = 120/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y   +   + ++ FKV PGE    +G NGAGKTTT++ + G      G+  I+G  + N+ ++ R ++GY+PEN      ++   YL++ A+L  + + E      + L    + D R       S G K+++ +AQA+ ++P  +I+DEPT  LDP+  ID  +++  L    K++ +S+HIL E+ +  N V I+  G++V T
  S:     1 MIEVEHLSKVYGSTR--ALKDVTFKVEPGEILGLLGPNGAGKTTTMRILSGYLPASSGTATIAGYEVHNQPMQVRQRIGYLPENPPLYPEMTVESYLFFVARLKGVSAGERAYRVTAALASCNLQDKRRVLIRKLSKGYKQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIDVRNLIKNLAG-QKTVILSTHILPEVSMTCNRVAIIHQGQVVAT 212
>gi|55981428|ref|YP_144725.1| ABC transporter, ATP-binding protein [Thermus thermophilus HB8] >gi|55772841|dbj|BAD71282.1| ABC transporter, ATP-binding protein [Thermus thermophilus HB8] (307 aa)
Score = 314, Expect = 5.1e-27, Identities = 61/192 (31%), Positives = 114/192 (59%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++LN  V  GE +  +G NG+GKTTTI  ++G      G   + G D   + L+ ++++GY+P+   F   +S+++ L YT +L  +  KEA+   E +LK+  +W++R++    FS G ++++ LA+ L   P + I+DEPT  LDP+A  +F D++  L+    ++ +SSH+L ++    + V +   G++
  S:    19 VEDLNLSVREGEVYGLLGPNGSGKTTTILMLLGLTEPTSGEARVLGFDPMREPLKVKSRVGYLPDQVGFYGELSAWENLRYTTRLLGLPDKEAEARIEEVLKRMGLWEVRDRKVAAFSRGMRQRLGLAEVLLKRPKVAILDEPTLGLDPEAAREFLDLIKGLKAEGITVLLSSHLLHQVQEVCDRVGLFHKGRL 212
>gi|20808566|ref|NP_623737.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] >gi|20517193|gb|AAM25341.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] (308 aa)
Score = 314, Expect = 5.4e-27, Identities = 74/215 (34%), Positives = 133/215 (61%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +++V NL K+Y    +  +  ++F++  G  +  +G NGAGKTTT+  + G      G IYI+G  +D    +   ++GY+PE+  F + ++  +YL + +K+  I  K+AK   + +L   ++ +  N+    +S G K+K+ LA AL +NP+I+ +DEPT+ LDP++R D F+ + E++K  K+I +S+HILS+ +   + + ILD GKI+++ K
  S:     1 MIKVFNLTKKY--GNYEVLKGISFEIEKGTIYGLLGRNGAGKTTTMNILTGLIDYNRGEIYINGKMLDKNKRKPLEEIGYLPESPTFYTYMTGSEYLLFISKIRGIPYKKAKKEIDKLLDLVKLKEAANKKIQTYSRGMKQKLGLAVALLDNPEIIFLDEPTSALDPESRYDIFNQILEMKKNGKTILLSTHILSDAERVCDYIGILDKGKIIFSGK 215
>gi|116872137|ref|YP_848918.1| ABC transporter, ATP-binding protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741015|emb|CAK20135.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (301 aa)
Score = 314, Expect = 5.5e-27, Identities = 99/301 (32%), Positives = 168/301 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLYKKYVIYGSVD 352
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL ++P +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   N   ++ +R    E  +       EV  + E +    +++  AE  +KL+SK I V + +K   S+EDL+ +     S+D
  S:     1 MTEQALQVTNLYKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDASIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSSPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLNSREQLRWRATPFEQAKAFLESVTEVEVDGEYVVTAMNEHS-AEWNEKLVSKGIQVHEIDKKKPSLEDLFLELTGGHSID 301
>gi|26554184|ref|NP_758118.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] >gi|26454193|dbj|BAC44522.1| ABC transporter ATP-binding protein [Mycoplasma penetrans HF-2] (318 aa)
Score = 313, Expect = 6.7e-27, Identities = 85/219 (38%), Positives = 133/219 (60%)
  Q:    57 LEVVNLRKQYYGKKH-PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEA-KLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNE 275
           +EV NL  +Y  KK  P I + NF V  G+FH  +G NGAGK+T IK IIG   N+ G I I+GI+ K  +   K+ ++P+   FP+  + FDYL    ++    + E  K      L+ F + +  ++ PNN SSGQK+K+L+ + L     I+++DEPT+NLD   R  F  +L EL + +K ++FIS+H+L E+  Y+N+ T +D GK++++ K +  E
  S:    86 IEVKNLYMRYGSKKKDPFIKDCNFNVDEGDFHVIIGQNGAGKSTLIKMIIGLNLNYQGDILINGINRKKCDPNQKLTFVPDKPIFPNEWNVFDYLLEICRMYDSSNIEILKKKINGYLEDFDLLNDADKDPNNLSSGQKQKLLIIKILLLKSKIIVLDEPTSNLDAITRKQFLSLLKELSQKNKVTVFISTHVLEEIKYYANSATFIDKGKVLWSGKVSNEE 307
>gi|150388658|ref|YP_001318707.1| ABC transporter related [Alkaliphilus metalliredigens QYMF] >gi|149948520|gb|ABR47048.1| ABC transporter related [Alkaliphilus metalliredigens QYMF] (240 aa)
Score = 313, Expect = 6.7e-27, Identities = 70/211 (33%), Positives = 124/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L++  + K Y       +D+++F+V PGE   F+G NGAGKTTT+K I+G  +  +G+IYI G+DN+  +LE++  + Y+P+      R++  +YL + A +  +  +E     +  L+ F++ +  N    ++S G K+KI+L  AL ++P I I+DEP   LDPKA     +I+    +  KS+F S+H+L   +   + + I+  G+I+
  S:     1 MLKLEKVSKAYQKGTVKAVDDISFEVKPGEIFGFLGPNGAGKTTTLKMIVGLLKPDEGNIYIDGMDNQEESLETKKIISYVPDTHEVYERLTGIEYLNFIADMYAVSREERVQRIQYYLEVFQLKEAVNDLIKSYSHGMKQKIVLIGALIHDPKIFILDEPMVGLDPKASFQLKEIMRLRCQEGKSVFFSTHVLEVAEKLCDRIAIIRKGEII 213
>gi|116512940|ref|YP_811847.1| ABC-type multidrug transport system, ATPase component [Lactococcus lactis subsp. cremoris SK11] >gi|116108594|gb|ABJ73734.1| ABC-type multidrug transport system, ATPase component [Lactococcus lactis subsp. cremoris SK11] (256 aa)
Score = 313, Expect = 7.4e-27, Identities = 75/211 (35%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L+V NL   Y G  +P +  LNF++  GE    +G NGAGK+TTI+ IIG    + G I + G+   ++LE  R K+G+IPE       ++  +++  TA    I    A   AE +L+ FR+ D  +  P NFS G K+K+++  A    P + I+DEP   LDP A  D  D++ E++K   SI +S+HIL+  + + +   +L  G++V
  S:     1 MLKVTNLTGGYLG--YPVLKELNFEIKEGELVGLIGLNGAGKSTTIQEIIGLLTPYSGQIELDGLTLQQDLEGYRRKIGFIPETPSLYEELTLREHIEVTALAYGISVDLAFKRAEKLLETFRLSDKLDWFPVNFSKGMKQKVMIICAFLVEPSLYIVDEPFMGLDPLAIQDLIDLMMEMKKTGSSILMSTHILATAEKFCDKFIVLHEGQVV 211
>gi|147919576|ref|YP_686684.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110622080|emb|CAJ37358.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (343 aa)
Score = 313, Expect = 7.9e-27, Identities = 79/237 (33%), Positives = 136/237 (57%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKL-NKIKSKEAKLFAESILKKFRMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK----RNKNENGEMCYRIKLVEDFE 290
           +P+++ VNL K Y   K   I+++N  V  G+   F+G NGAGK+TTI++++   R   GS  I G+D    +++ + ++GYIP +      +S + +L Y  K+     +++A+ +A  +       D+R ++    +S G ++K+ + QA  NNPD++IMDEPT  LDP  +  F D++ E      +IF+SSH+LS+++   N V I+  G+I   +K    R K  N     R+K  E+ +
  S:    51 EPIIKTVNLTKSY--GKSRGIEDVNLSVNRGDIFGFLGPNGAGKSTTIRTLLDFIRPTSGSASIFGLDCQKDSVQIKKRIGYIPGDFGLYGNMSGWKFLEYFGKVRGGYDAEDARAYAARL-------DIRLDRKMKEYSRGMRQKVAIIQAFMNNPDLIIMDEPTNGLDPLVQQTFMDMIREKAAEGTTIFMSSHVLSDVEKVCNRVAIIKGGRIATEEKVEDLRKKAGN---VVRVKFAEEVD 283
>gi|42522582|ref|NP_967962.1| ATP-binding protein of ABC transporter [Bdellovibrio bacteriovorus HD100] >gi|39575114|emb|CAE78955.1| ATP-binding protein of ABC transporter [Bdellovibrio bacteriovorus HD100] (314 aa)
Score = 313, Expect = 8.1e-27, Identities = 77/238 (32%), Positives = 139/238 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV---YTQKRNKNENGEMCYRIKLVEDFEGDK 293
           ++EV +L K Y  ++   ID LNF +  G+   F+G NGAGK+TT+K I G      G+  ++G D     LE + ++GY+PE     + +   DYL Y A L ++  ++ +    + ++K  + D++ +  ++ S G K+++ +AQA+ ++P++LI+DEPT  LDPK   +  +++  L+  H +I +S+HIL E++     V I++ GKIV     Q  +  + G++   ++L +D E  K
  S:     1 MIEVKDLTKDYGPRR--AIDKLNFSISKGDVVGFLGPNGAGKSTTMKIITGFMAPSHGNASVAGFDVFENPLEVKKRIGYLPEIPPVYADMFVRDYLRYVAALKQVPKEKIEACVNNAIEKTNLGDVQKRLIHHLSKGFKQRVGIAQAIVSDPEVLILDEPTVGLDPKQVAEIRELIKALKGQH-TIILSTHILPEVEATCEKVIIINKGKIVAEDSIQNLSALDQGQVRLHVRLRKDVEDMK 240
>gi|163812088|ref|ZP_02203767.1| ABC transporter related [Dehalococcoides sp. VS] >gi|157404276|gb|EDO70317.1| ABC transporter related [Dehalococcoides sp. VS] (306 aa)
Score = 312, Expect = 8.5e-27, Identities = 78/211 (36%), Positives = 129/211 (61%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE----SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKL-HKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K + GK    +DN+ F V PGE   F+G NGAGKTTT++ I+G      G   ++G   KNL     +R+K+G + E      R+S+++ L Y A + +I ++EA++    +L+ F +   RN     FS G K+K+ LA+A+ + P++L +DEP + LDP+A+ +F D++  L +  + +IF++SH L E+    N V I+  GK++
  S:     1 MIEVSNLSKIFKGKT--VLDNITFNVAPGEIFGFLGPNGAGKTTTMRIILGLLNPSSGQATLNG---KNLARDDAARSKVGVLLEVDGIYDRLSAYENLRYFADIYQIPNREARI--NELLEFFDLNGQRNDPAGKFSKGMKRKLALAKAIMHKPEVLFLDEPASGLDPEAQKNFRDLILSLSREGNMTIFLNSHDLDEVQRICNKVAIIKGGKLL 209
>gi|170759242|ref|YP_001788461.1| ABC transporter, ATP-binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406231|gb|ACA54642.1| ABC transporter, ATP-binding protein [Clostridium botulinum A3 str. Loch Maree] (231 aa)
Score = 312, Expect = 9.3e-27, Identities = 77/223 (34%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   K+K  + K  AE +LK+F +WD R++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNEGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKVKDYKDK--AEHMLKRFDLWDKRDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEEGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|55378793|ref|YP_136643.1| ABC transporter ATP-binding protein [Haloarcula marismortui ATCC 43049] >gi|55231518|gb|AAV46937.1| ABC transporter ATP-binding protein [Haloarcula marismortui ATCC 43049] (314 aa)
Score = 312, Expect = 9.5e-27, Identities = 72/215 (33%), Positives = 123/215 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPE----NTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +T+P +    L+K+Y   +   +D+L   V  GEF   +G NGAGKTT I +++G      G+  + G D ++   E+R ++G  P+    + FFP      + L + A  + I   EA+  AE  LK   +WD R+   +  S G K++ +LA+AL ++PD+LI+DEPTA +D + R D +DI+  +     +I +++H + E +   + V I+D+G+ V
  S:     1 MTEPAIRASGLQKRYGDVQ--ALDDLELTVEQGEFFGLLGPNGAGKTTFINTLVGLVHKDRGTAEVFGFDVEDDYREARDRIGVAPQEFNVDRFFPI----IEVLEHKAGYHGIGRAEARERAEDALKTVGIWDKRDTRFDWLSGGMKRRFVLARALVSDPDLLILDEPTAGVDVQLRHDLWDIINRMNDAGTTILLTTHYIEEAERLCDRVAIMDDGRKV 215
>gi|21322653|emb|CAD31223.1| hypothetical protein [Streptococcus salivarius] (236 aa)
Score = 311, Expect = 1.1e-26, Identities = 75/211 (35%), Positives = 120/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE+ N  K Y  KK   +DNL+  V PG+ + F+GANGAGKTTTIK+++G +   DGSI I+G  I  + +  +  M YIP+N      ++   Y+ + A L +I +K  +   ++    F M +  +   +++S G K++  +  AL ++P +LI+DEP   LDPKA      I+ E      +IF S+H+L   +   N + I+ NGK+V
  S:     1 MLEIKNFSKSYGDKK--VVDNLSISVQPGDIYGFIGANGAGKTTTIKAVVGIHDFEDGSIIINGHSIKEEPVICKKMMAYIPDNPDLYEHMTGLQYINFIADLFEIPTKIRRERIQNYGDLFDMTEHLSGIISSYSHGMKQRTAIISALVHSPKLLILDEPFVGLDPKATFLLKKIMHECVSDGGAIFFSTHVLDVAEKLCNKIAIIKNGKLV 211
>gi|57641988|ref|YP_184466.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] >gi|57160312|dbj|BAD86242.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] (305 aa)
Score = 311, Expect = 1.1e-26, Identities = 77/211 (36%), Positives = 126/211 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIG-------SYRNFDGSIYISG-IDNKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ V NL K Y  K    +D LN +V PG+ + F+G NGAGK+TTI S +G         + FD  ++  G  D  NL +++ ++GY+PE+      ++    L   A   KI   E +   + +L    + + +N+    FS G ++++LLAQAL N+PD+LI+DEP + LDPK   +F DI+ E +K  K++F SSHIL+ ++   + V ++  GK++
  S:     1 MMRVENLVKFY--KDVRALDGLNLEVKPGQIYGFLGPNGAGKSTTILSTLGLIFPQQGRIQLFDLEVFRDGKFDENNLVQAKKRIGYMPEHATLWDFLTPVQTLDIIADAFKIPKAEKEKRIKELLDLVGLSEAKNRKVGKFSKGMRQRLLLAQALINDPDLLILDEPMSGLDPKGIAEFKDIIREQRKAGKTVFFSSHILAHVEEICDTVGVIVKGKLI 218
>gi|156740736|ref|YP_001430865.1| ABC transporter related [Roseiflexus castenholzii DSM 13941] >gi|156232064|gb|ABU56847.1| ABC transporter related [Roseiflexus castenholzii DSM 13941] (316 aa)
Score = 311, Expect = 1.3e-26, Identities = 68/215 (31%), Positives = 123/215 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + + ++E  +L KQY  +    +D LN  V  GE    +G NGAGKTTTI  ++G      GS+ + G+D   + L  ++++GY+P+   F   +++ + L Y AKLN I+ +E +    + L +  + D+ ++    FS G ++++ +A+ L   P ++IMDEPT  LDP+A  +F D++  L+    +I +SSH+L ++    + V +   G++V
  S:     1 MDETVVECRDLTKQY--ESLVAVDRLNLTVRKGEIFGLLGPNGAGKTTTILMLLGLTEPTSGSVRVLGLDPARQPLSVKSRVGYLPDQVGFYDGLTARENLSYIAKLNGIRGREMQDRIRAALGQVGLSDVADRRVGTFSRGMRQRLGVAEVLLKRPQLIIMDEPTLALDPEAVREFLDLIRRLKADGMTIMLSSHLLHQVQAVCDRVGLFHKGRMV 215
>gi|45659135|ref|YP_003221.1| ABC transporter, ATP-binding protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|45602381|gb|AAS71858.1| ABC transporter, ATP-binding protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (309 aa)
Score = 310, Expect = 1.4e-26, Identities = 80/220 (36%), Positives = 126/220 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNE 275
           +++V NL K +YGKK   ID LNF++  GE    +G NGAGKTTTI+ + G     DG   I GI+     LE + K+GY+PE       +S  DYL + A++ ++ S+      + + ++  + D+R       S G +K++ +AQAL  NP I+I+DEP + LDPK  ++  +++  L+  H +I +SSHIL E+    N    L  G++VY + R + E
  S:     1 MIKVKNLSK-FYGKKL-AIDRLNFELGEGEIVGLLGLNGAGKTTTIRILTGYLIASDGICEIDGINTFENPLEVKKKIGYLPETPPLYPELSVQDYLKFAARIKQVSSELIDSEIDRVCERTFLTDVRKNDIETLSLGFRKRVGIAQALLGNPRIVILDEPVSGLDPKQIVEIRNLIHSLKDGH-TILLSSHILPEVYKTCNRFLFLHQGRMVYQRDRKQLE 219
>gi|24216855|ref|NP_714336.1| ABC transporter ATP-binding protein [Leptospira interrogans serovar Lai str. 56601] >gi|24198230|gb|AAN51354.1|AE011569_8 ABC transporter ATP-binding protein [Leptospira interrogans serovar Lai str. 56601] (309 aa)
Score = 310, Expect = 1.5e-26, Identities = 80/220 (36%), Positives = 126/220 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNE 275
           +++V NL K +YGKK   ID LNF++  GE    +G NGAGKTTTI+ + G     DG   I GI+     LE + K+GY+PE       +S  DYL + A++ ++ S+      + + ++  + D+R       S G +K++ +AQAL  NP I+I+DEP + LDPK  ++  +++  L+  H +I +SSHIL E+    N    L  G++VY + R + E
  S:     1 MIKVKNLSK-FYGKKL-AIDRLNFELGEGEIVGLLGLNGAGKTTTIRILTGYLIASDGICEIDGINTFENPLEVKKKIGYLPETPPLYPELSVQDYLKFAARIKQVSSELIDSEIDRVCERTFLTDVRKNDIETLSLGFRKRVGIAQALLGNPRIVILDEPVSGLDPKQIVEIRNLIHSLKDGH-TILLSSHILPEVYKTCNRFLFLHQGRMVYQRDRKQLE 219
>gi|170055159|ref|XP_001863457.1| ATP-binding cassette sub-family A member 3 [Culex quinquefasciatus] >gi|167875201|gb|EDS38584.1| ATP-binding cassette sub-family A member 3 [Culex quinquefasciatus] (1504 aa)
Score = 310, Expect = 1.5e-26, Identities = 71/219 (32%), Positives = 127/219 (57%)
  Q:    48 EDIDLTKPLLEVVNLRKQY---YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           E+ D    ++++ NL K Y   YG +   + NL+ K+Y     A +G NGAGKTTT+  I G      G I I G DN +   R ++G+ P++      ++  ++L +   L  +   +A+  A+ IL++  + D   +  +N S G K+++ LA A+     +LI+DEPT+ LDP++R D +D+L +L+K H +I I++H + E D+  + + I++NG+++
  S:   379 EEGDHLDKVVKISNLNKIYKTSYGTR-TAVKNLSLKIYKNRITALLGHNGAGKTTTMNIITGMTPRTSGRIEIDGDDNAS-NYRQQIGFCPQHNVALGYMNCREHLVFFGALRGMSMADAERKADEILERVNLSDKSEEVLSNLSGGMKRRLCLANAIIGRTKLLILDEPTSGLDPESRRDIWDVLLKLKKDH-TILITTHFMEEADVLGDWIAIMENGELI 597
Score = 247, Expect = 3.5e-19, Identities = 69/256 (26%), Positives = 134/256 (52%)
  Q:    10 NNFISSLKSKQ---LEKKEKEYQM------EMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES---RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           N FI ++  ++     K +  Y++      +++A ++  ++ I    E    +   + V NL+K+Y     P +  ++F V  GE    +G NGAGKT+T + I  +    DG+IY++  + ++  S   R + GY P+       ++ ++ + YTA +  IK+ +   F    L    +    +   N  S G K+K+    A+  NP I+ +DEPT  +DPK+R   +  +  LQ+  ++I ++SH + E +   N ++I+ +G++
  S:  1127 NEFIENIYRREALVTRKPDSNYELRHEVDDDVDAENKMVDQLI--TNEQPPFSPHTIAVHNLKKRYL--DLPAVRGISFAVKRGECFGLLGMNGAGKTSTFQMITQNLPITDGTIYLNEQNVRSSHSKDYRAQYGYCPQGDSLLDFMTPYELVKYTALMKDIKTPDN--FISMWLTDLDILSFAHSRTNECSGGTKRKVNTVLAMLGNPSIVFLDEPTTGVDPKSRHYVWSRIKALQRHDQTIILTSHSMDECEELCNRLSIMVDGQL 1388
>gi|192808205|ref|ZP_03036882.1| ABC transporter related [Geobacillus sp. Y412MC10] >gi|192803625|gb|EDV80128.1| ABC transporter related [Geobacillus sp. Y412MC10] (243 aa)
Score = 310, Expect = 1.6e-26, Identities = 63/212 (29%), Positives = 119/212 (56%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +P+L+V ++++  Y    P I +++F+V PGE    +G NGAGK+TTIK+++G  ++    +YI+G       S  +  Y+PE   F   ++ +++L   A    +  +  +  A  +L++F M  +R++ P  FS G K+K++L     + PD+ I+DEP   LDP+A  DF ++L E ++    + +S+H+L   +   +   ++  G+I
  S:    12 EPVLKV-DIQEAGYEPSRPRIRDISFQVVPGELLGLIGPNGAGKSTTIKTVLGLLKDSKADVYIAG-------SPPRYAYVPEQPVFYEDLTLWEHLDLAAAAFGMDDQHFEEQAAQLLRQFGMESVRHELPGGFSKGMKQKMMLMIGFLSKPDVYIVDEPFIGLDPRATRDFLNLLLEERRRGAGVLMSTHVLDTAEKICDRFVLISGGRI 215
>gi|116327004|ref|YP_796724.1| ATP-binding protein of an ABC transporter complex [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116332330|ref|YP_802048.1| ATP-binding protein of an ABC transporter complex [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116119748|gb|ABJ77791.1| ATP-binding protein of an ABC transporter complex [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116126019|gb|ABJ77290.1| ATP-binding protein of an ABC transporter complex [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (309 aa)
Score = 310, Expect = 1.6e-26, Identities = 79/220 (35%), Positives = 126/220 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNE 275
           +++V NL K +YGKK   ID LNF++  GE    +G NGAGKTTTI+ + G     DG   I G +     LE + K+GY+PE       +S  DYL + A++ ++ S+        + ++  + D+R  +    S G +K++ +AQAL  NP I+I+DEP + LDPK  ++  +++  L++ H +I +SSHIL E+    N    L  G++VY + R + E
  S:     1 MIKVKNLSK-FYGKKL-AIDRLNFELGEGEIVGLLGLNGAGKTTTIRILTGYLIASDGICEIDGTNTFENPLEVKKKIGYLPETPPLYPELSVEDYLKFAARIKQVSSESIDSEIARVCERTFLTDVRKNNIETLSLGFRKRVGIAQALLGNPRIIILDEPVSGLDPKQIVEIRNLIHSLKEGH-TILLSSHILPEVYKTCNRFLFLHRGRMVYQRDRKQLE 219
>gi|51893246|ref|YP_075937.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] >gi|51856935|dbj|BAD41093.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] (296 aa)
Score = 310, Expect = 1.6e-26, Identities = 68/191 (35%), Positives = 111/191 (58%)
  Q:    76 NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++F V PG  + FVG NGAGKTTT+K I    R   GS++I   D   +  E+RT++GY+P+       +   +Y+ + A    + +        S+L    + D R    +  S G K+++ LA++L ++PD+LI+DEP + LDP+ R++  +IL EL +  K+I ISSHIL+EL      + I+  G++V
  S:     3 DVSFTVEPGAIYGFVGPNGAGKTTTMKIIATLLRPDAGSVFIGDTDALKRPGEARTRLGYMPDFFGVYDNLKVDEYMQFYADCYDVPTDGRDRLIGSLLGLVGLADKRGAYVDTLSRGMKQRLCLARSLVHDPDVLILDEPASGLDPRNRVEMREILLELSRRGKTILISSHILAELAEMCTHIGIIHAGRMV 195
>gi|89210780|ref|ZP_01189165.1| ABC transporter related [Halothermothrix orenii H 168] >gi|89159634|gb|EAR79297.1| ABC transporter related [Halothermothrix orenii H 168] (258 aa)
Score = 310, Expect = 1.7e-26, Identities = 69/228 (30%), Positives = 136/228 (59%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV----YTQKRNKNENGEM 279
           +TKP++ + NLRK +    +  +  +N +VYPG+   ++G NGAGK+TT+K ++G    ++G I I G D     + + ++GY+PE+      ++ ++YL +  K+  +  + A   AE + + F + +  +   +++S G K+K+L+  +L +NPDIL +DEP + LD  + +   ++L  L +  K+IF  SHI+  ++  SN + +++ G+IV    + + + K++ G +
  S:     2 VTKPVISIKNLRKSF--GSNEVLKGVNLEVYPGQVIGYIGPNGAGKSTTVKIMLGIIEEYEGQIEIFGEDITGQTDYKKRIGYVPEDGEIYESLTGYEYLTFLGKIYGLDFESANKKAERLSQLFGIEESYHSPISSYSKGMKQKLLIIASLLHNPDILFLDEPLSGLDANSVMVLKELLARLARQGKTIFYCSHIMEVVEKISNRILLINKGQIVADGSFEELKAKSKQGSL 232
>gi|73749393|ref|YP_308632.1| ABC transporter, ATP-binding protein [Dehalococcoides sp. CBDB1] >gi|73661109|emb|CAI83716.1| ABC transporter, ATP-binding protein [Dehalococcoides sp. CBDB1] (313 aa)
Score = 310, Expect = 1.7e-26, Identities = 62/193 (32%), Positives = 117/193 (60%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +D L+  V       F+G NGAGKTT ++ + G  +   G  Y+SG  +  +NL  R+K+G++P+   F S ++  +++ ++ +L+K+  +E  L A+ +L+   + +   +    +S G K+++ +AQAL N P++L MDEPT+ LDP  R D  +++  L     ++F+S+HILS+++   + V I++ GK++
  S:    19 LDGLDLAVEKNRVFGFLGPNGAGKTTAVRMLTGLSQPTSGKAYVSGEEVTPRNLSLRSKIGFLPDVPAFYSWMTGREFMLFSGELHKLSPRENNLRADELLELVDLSEAGKRRVGGYSRGMKQRLGIAQALVNKPEVLFMDEPTSALDPMGRRDVLNLIERLSG-DTTVFMSTHILSDVERVCDRVAIINEGKLI 212
>gi|196235105|ref|ZP_03133909.1| ABC transporter related [Thermus aquaticus Y51MC23] >gi|196221061|gb|EDY15676.1| ABC transporter related [Thermus aquaticus Y51MC23] (307 aa)
Score = 310, Expect = 1.8e-26, Identities = 60/192 (31%), Positives = 114/192 (59%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++LN +V  GE    +G NG+GKTTTI  ++G      G   + G+D   + L+ + K+GY+P+   F   +++++ L YT +L  +   EAK   E +L++  +W++R++  + FS G ++++ LA+ L   P + I+DEPT  LDP+A  +F D++  L+    ++ +SSH+L ++    + V +   G++
  S:    19 VEDLNLEVAEGEVFGLLGPNGSGKTTTILMLLGLTEPTSGEARVLGLDPMREPLKVKAKVGYLPDQVGFYGELTAWENLRYTTRLLGLPEAEAKARIEEVLRRMGLWEVRDRRVSAFSRGMRQRLGLAEVLLKRPKVAILDEPTLGLDPEAAREFLDLIKGLKAEGITVLLSSHLLHQVQEICDRVGLFHKGRL 212
>gi|87312279|ref|ZP_01094378.1| ABC transporter, ATP-binding protein [Blastopirellula marina DSM 3645] >gi|87285017|gb|EAQ76952.1| ABC transporter, ATP-binding protein [Blastopirellula marina DSM 3645] (310 aa)
Score = 309, Expect = 2.2e-26, Identities = 90/287 (31%), Positives = 164/287 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--------VYTQKRNKNENGEMCYRIKLVEDFE-GDKVGKYEVN--------SNNEIIYEFK-DKNELAELIDKLISKEILVK-FEKYYLSIEDLY 342
           ++E+++  K Y       ++ LN K+  GE   F+G NGAGK+T+I+ +    +   G   ++G  +    +  R  +GY+P+N      +  +++L + A    I     K     +L+   +   RN   N  S G K+++ LA+ L ++P +LI+DEP + LDP+AR++   +L EL+K+ K+I ISSHIL+EL     +V I++ G++        VY + R KN       +IKLV++F+ G  + + E +        S N I  E + D + +A L++KL++  + V+ + +   ++ED++
  S:     1 MIELIDFGKDY--GAFTAVECLNLKIEAGEMFGFIGPNGAGKSTSIRYLATLLKATRGGGTVNGYSVAKDPMNVRHSVGYMPDNFGVYDGMKVWEFLDFFAVAYGIPRSRRKAVITDVLELLDLTYKRNDFVNGLSRGMKQRLCLAKTLVHDPPVLILDEPASGLDPRARLEVKALLKELRKMGKTILISSHILTELADCCTSVGIIERGQLLMHGPIDEVYRRIR-KNR----ILQIKLVDNFDVGLSIIRSEPSCIDVDFEASRNLITCELQTDDDGVASLLEKLLANRVRVRSYAEKDPTLEDVF 301
>gi|116626147|ref|YP_828303.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116229309|gb|ABJ88018.1| ABC transporter related [Solibacter usitatus Ellin6076] (254 aa)
Score = 309, Expect = 2.3e-26, Identities = 72/210 (34%), Positives = 118/210 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI----DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LEV  L K+Y G   P + +++F + PGE   +VG NGAGK+TT+K IIG     DG +  +G     D    +SR  +GY+PE       +S  +YL  T +L  ++    +   +  L  F +WD R+ + + +S G ++K+LL+ +L +NPD+LI+DEP + LD    +   +++  L    + I  SSH+L  L+   + V IL  G++
  S:     1 MLEVRGLTKRYNGI--PAVQDVSFTLRPGEILGYVGPNGAGKSTTVKMIIGLLDPSDGQVLFNGTSIIEDMPGYQSR--IGYVPEEPHLYPHLSGREYLQLTGRLRGLERGILESKIDEFLNLFSLWDDRHCAVSAYSKGMRQKVLLSASLLHNPDLLILDEPLSGLDVTTALVLRELVEGLAASGRMILYSSHVLDVLEKVCSRVLILCKGRV 210
>gi|57640877|ref|YP_183355.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] >gi|57159201|dbj|BAD85131.1| ABC-type multidrug transport system, ATPase component [Thermococcus kodakarensis KOD1] (306 aa)
Score = 309, Expect = 2.3e-26, Identities = 75/211 (35%), Positives = 127/211 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIG-------SYRNFDGSIYISGI--DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ V NL K Y  K    ++ LN +V PG+ + F+G NGAGK+TTI S +G         + FD  ++  G   +NK ++++ ++GY+PE+      ++    L   A   KI   E +   + +L    + + +N+    FS G ++++LLAQAL N+PD+LI+DEP + LDPK   +F DI+ E +K  K++F SSHIL+ ++   + V ++  GK++
  S:     1 MMRVENLVKFY--KDVKALNGLNLEVKPGQIYGFLGPNGAGKSTTILSTLGLIFPQQGRIQLFDLEVFRDGKFDENKLVQAKKRIGYMPEHATLWDFLTPVQTLDIIADAFKIPKTEKEKRIKELLDLVGLSEAKNRKVGKFSKGMRQRLLLAQALINDPDLLILDEPMSGLDPKGIAEFKDIIREQRKAGKTVFFSSHILAHVEEICDTVGVIVKGKLI 218
>gi|147669789|ref|YP_001214607.1| ABC transporter related [Dehalococcoides sp. BAV1] >gi|146270737|gb|ABQ17729.1| ABC transporter related [Dehalococcoides sp. BAV1] (306 aa)
Score = 308, Expect = 2.4e-26, Identities = 75/211 (35%), Positives = 127/211 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKL-HKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K + GK    +DN+ F V PGE   F+G NGAGKTTT++ I+G      G   ++G +  K+  +R+ +G + E      R+S+++ L Y A + +I ++EA++    +L+ F + + RN     FS G K+K+ LA+A+ + P++L +DEP + LDP+A+  F D+   L +  + +IF++SH L E+    N V I+  GK++
  S:     1 MIEVNNLSKVFKGKT--VLDNITFSVAPGEIFGFLGPNGAGKTTTMRIILGLLNPSSGKATLNGKNLAKDDTARSNVGVLLEVDGIYDRLSAYENLRYFADIYQIPNREARI--NELLEFFNLSERRNDPAGKFSKGMKRKLALAKAIMHKPEVLFLDEPASGLDPEAQKSFRDLTLSLSREGNMTIFLNSHDLDEVQRICNKVAIIKGGKLL 209
>gi|153201468|ref|ZP_01943277.1| ABC transporter, ATP-binding protein [Listeria monocytogenes HPB2262] >gi|133735776|gb|EBA37474.1| ABC transporter, ATP-binding protein [Listeria monocytogenes HPB2262] (301 aa)
Score = 308, Expect = 2.5e-26, Identities = 101/291 (34%), Positives = 162/291 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK-IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L K    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTELALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSAIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALAKNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLESVTEVEVDGEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|27375428|ref|NP_766957.1| copper ABC transporter [Bradyrhizobium japonicum USDA 110] >gi|3850616|emb|CAA05520.1| nosF [Bradyrhizobium japonicum] >gi|27348565|dbj|BAC45582.1| copper ABC transporter [Bradyrhizobium japonicum USDA 110] (302 aa)
Score = 308, Expect = 2.6e-26, Identities = 68/188 (36%), Positives = 109/188 (57%)
  Q:    76 NLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           +++F + PG   A VG NGAGKTT IK ++G  R   GSI +   D       +R ++GY+PEN  F + ++  + L + A+L  +K  +A  F    L +  + D  ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL EL+    ++ ISSH L+EL+  +  V I++ G
  S:    22 DVSFDLAPGRLSALVGHNGAGKTTLIKLMLGLIRPDQGSIRVLDEDPAAGEFSARRQLGYLPENVAFNAALTGRETLTFYARLKHVKPSKAWAF----LDRVGLTDAADRRVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRQTFYEILNELRDDGATVLISSHALNELEDRAEHVLIMNRG 207
>gi|47095318|ref|ZP_00232929.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|153173677|ref|ZP_01929391.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL N3-165] >gi|153178847|ref|ZP_01932134.1| ABC transporter, ATP-binding protein [Listeria monocytogenes F6900] >gi|153184187|ref|ZP_01934970.1| hypothetical protein LMOG_00867 [Listeria monocytogenes J0161] >gi|153190137|ref|ZP_01937582.1| ABC transporter, ATP-binding protein [Listeria monocytogenes J2818] >gi|47016389|gb|EAL07311.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 1/2a F6854] >gi|126943251|gb|EBA20980.1| hypothetical protein LMOG_00867 [Listeria monocytogenes J0161] >gi|127766455|gb|EBA26793.1| ABC transporter, ATP-binding protein [Listeria monocytogenes J2818] >gi|133730757|gb|EBA32455.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL N3-165] >gi|133733535|gb|EBA35233.1| ABC transporter, ATP-binding protein [Listeria monocytogenes F6900] (301 aa)
Score = 308, Expect = 2.7e-26, Identities = 100/291 (34%), Positives = 164/291 (56%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYR------------IKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F S ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R            ++ V + E D  G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTERALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYSFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRWLATPMEQAKAFLESVTEVEVD--GEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|118590833|ref|ZP_01548233.1| ABC transporter related protein [Stappia aggregata IAM 12614] >gi|118436355|gb|EAV42996.1| ABC transporter related protein [Stappia aggregata IAM 12614] (307 aa)
Score = 308, Expect = 2.8e-26, Identities = 71/217 (32%), Positives = 124/217 (57%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           P+L V +L K Y G     + +++  +  GE  A +G NGAGKTT I +I G  R   GSI++ G D  ++   +R  +G +P+           D + ++  L  +K   A++  ESILK   +WD RN      S G K+++L+A+AL++ P IL +DEPTA +D + R D + I+GEL+    +I +++H + E +  ++ V +++ G+I+  +++
  S:     3 PILSVRDLEKTYDGG-FQALKSVSLDIQQGEVFALLGPNGAGKTTLISTICGLVRPTSGSIHVCGHDALSEYRAARQMIGLVPQEMPTAPFEMVGDTVAFSRGLFGMKPDPARI--ESILKDLTLWDKRNNPIMALSGGMKRRLLVAKALAHEPKILFLDEPTAGVDVELRHDMWRIVGELKNKGVTIILTTHYIEEAEEMADRVGVINKGEIILVEEK 218
>gi|15893533|ref|NP_346882.1| ABC-type multidrug transport system, ATP-ase compoment [Clostridium acetobutylicum ATCC 824] >gi|15023076|gb|AAK78222.1|AE007537_7 ABC-type multidrug transport system, ATP-ase compoment [Clostridium acetobutylicum ATCC 824] (310 aa)
Score = 308, Expect = 2.9e-26, Identities = 88/278 (31%), Positives = 152/278 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT----QKRNKNENGEMC------YRIKLVEDFEGDK-VGKYEVNSNNEIIYEFKDKNELAELIDKLI---SKEILVKFEK 333
           +LE+ NL+K Y  K+   +D+LN K+  GE +  +G NGAGK+TTI +I G  +   G I I G   +  +   +  +G +P++    S +S+++ + +  KLN ++    K   +  L    +WD R   P  +S G ++++ +A A+ + P ++IMDEPT  +DP++R    D + +L ++  +I  +SH + E++   + +TI+D+GK + T    Q +    N E            LVE  EG K V K   N N  +I   K+   ++ +  K+    SK I +  EK
  S:     2 ILEIKNLKKTY--KEFTAVDSLNLKIEDGEIYGLLGPNGAGKSTTINTITGLTKVDSGEIKIFGKRFNGSDTNIKRNIGVVPQDIAVFSELSAYENVAFFGKLNGLRGAVLKERVKEALDFTGLWDRRKSKPGQYSGGMQRRLNIACAIVHRPKLIIMDEPTVGIDPQSRNHILDSVKKLNEMGSTIIYTSHYMEEIETLCSKITIIDHGKEIATGTKEQLKEMISNEEKVELELSEVTDDLVEAVEGIKNVKKCRRNENMLVIVSDKNSENISTITAKIAEFKSKIISINVEK 293
>gi|187776936|ref|ZP_02993409.1| hypothetical protein CLOSPO_00480 [Clostridium sporogenes ATCC 15579] >gi|187775595|gb|EDU39397.1| hypothetical protein CLOSPO_00480 [Clostridium sporogenes ATCC 15579] (231 aa)
Score = 308, Expect = 3.0e-26, Identities = 76/223 (34%), Positives = 130/223 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G +NK+LE+++K  Y+PE       ++ ++++ Y A   KI+  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNEGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKNNKSLEAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKIQDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEKRTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|153940086|ref|YP_001392419.1| ABC transporter, ATP-binding protein [Clostridium botulinum F str. Langeland] >gi|152935982|gb|ABS41480.1| ABC transporter, ATP-binding protein [Clostridium botulinum F str. Langeland] (231 aa)
Score = 308, Expect = 3.0e-26, Identities = 76/223 (34%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   K+K  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNGGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKVKDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEEGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|170755539|ref|YP_001782776.1| ABC transporter, ATP-binding protein [Clostridium botulinum B1 str. Okra] >gi|169120751|gb|ACA44587.1| ABC transporter, ATP-binding protein [Clostridium botulinum B1 str. Okra] (231 aa)
Score = 307, Expect = 3.3e-26, Identities = 76/223 (34%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   K+K  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNDGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKVKDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEEGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|89894187|ref|YP_517674.1| hypothetical protein DSY1441 [Desulfitobacterium hafniense Y51] >gi|109646237|ref|ZP_01370141.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] >gi|89333635|dbj|BAE83230.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109641483|gb|EAT51037.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] (259 aa)
Score = 307, Expect = 3.6e-26, Identities = 68/215 (31%), Positives = 120/215 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + + L++   L K+Y     P ++ LN +V  GE   F+G NGAGKTTTIK + G     +G   I G D +   ++ K  M Y+P+      ++S++++L     L +I    ++  AE +++ F + D  ++    +S G ++K++LA AL + P ++++DEPT  LDP +     D+L EL     ++F+S+HIL   +   + V IL+ GK++
  S:     1 MNQVLIKTHQLTKRY--GDVPVVNQLNLEVRAGEIFGFLGPNGAGKTTTIKILTGLMEPSEGEALICGYDIRKQPTQAKALMAYVPDQPKLYGKLSAWEFLKLIGDLYQIPKDVSRKRAEMLMEMFGLLDRADELLEGYSHGMRQKVVLASALIHQPKVILLDEPTVGLDPASARLLKDVLQELAHQGAAVFVSTHILEIAERMCHRVGILEKGKLI 215
>gi|56963735|ref|YP_175466.1| multidrug ABC transporter ATP-binding protein [Bacillus clausii KSM-K16] >gi|56909978|dbj|BAD64505.1| multidrug ABC transporter ATP-binding protein [Bacillus clausii KSM-K16] (304 aa)
Score = 307, Expect = 3.7e-26, Identities = 84/291 (28%), Positives = 153/291 (52%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSI-YISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY--TQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAE--------LIDKLISKEI-LVKFEKYYLSIEDLYKKYV 346
            + V +L K Y G+  P +DNL+F++ P    A +G NGAGKTTT+K + G  +    +I +     +     R  +GY+P+   F   ++ F++L+Y  +L  +  +EAK   + +L K  + +  +Q    +S G K+++ +AQAL + P ++++DEP + LDP  R +   ++  L++   ++  S+H+L + +  S+AV I+D G++ Y  T    + E  +    I+  +D         E     + + E      L E        L+     +++ L KFE   +S+EDL+ K V
  S:     3 FVSVRHLTKTYTGQ--PAVDNLSFELQPHSCIALLGVNGAGKTTTLKMLSGLVKPTSSTIQFHQPTPHGKGHIRADIGYLPQFPVFCDWMTGFEFLFYVGQLAHLSRREAKRRTKELLDKVGLTEAAHQRIGQYSGGMKQRLGIAQALIHQPKLVMLDEPVSALDPVGRREILQLMQTLKE-EATVLFSTHVLHDAEEVSDAVLIIDQGQLKYGGTLDSLQQEWQDAAIIIEAQDDLTNQLRNWREQKRIVDFVTEDDGYKILVEDIELAVPFLLHAFAQRQVRLTKFEVAKMSLEDLFLKVV 302
>gi|150384590|ref|ZP_01923275.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] >gi|150259036|gb|EDM96284.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] (318 aa)
Score = 307, Expect = 3.7e-26, Identities = 68/210 (32%), Positives = 122/210 (58%)
  Q:    61 NLRKQYYGKKHP---TIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           NL K Y     P    +++L   V  G    F+G NGAGKTTTIK ++   +   G  Y+ G  + +++ + K+G++P++  F  +++++++L   AKL ++ S+      E +L   +M D       +FS G  +++ +AQAL N P++LI+DEP   LDP  R +F +I+   ++   S+F SSHILS+++   + + IL+ G+++ T +
  S:    10 NLSKTYKRWFRPGTCALNDLTITVPKGSIFGFLGPNGAGKTTTIKILMDLIKCTAGKAYVLGKPSYDVDVKAKIGFLPDSPAFSPQLTAYEFLNICAKLLRLPSEVRPGRIEEVLSDVKMADHARDKIGSFSRGMLQRVGVAQALLNKPELLILDEPLLGLDPFGRQEFKNIILSQRERGTSVFFSSHILSDVEEICDRIAILNKGRLLCTGR 222
>gi|148381091|ref|YP_001255632.1| ABC transporter ATP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|153934141|ref|YP_001385464.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|153934715|ref|YP_001388871.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. Hall] >gi|148290575|emb|CAL84704.1| ABC transporter ATP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152930185|gb|ABS35685.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|152930629|gb|ABS36128.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. Hall] (231 aa)
Score = 307, Expect = 3.8e-26, Identities = 76/223 (34%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   K+K  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKELCKNY--NKFKAVNNVSFDVNEGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKVKDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEEGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|167453444|ref|ZP_02319667.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL J2-064] (301 aa)
Score = 307, Expect = 3.9e-26, Identities = 100/291 (34%), Positives = 162/291 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTELALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKATSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLESVTEVEVDGEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|163847152|ref|YP_001635196.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187602190|ref|ZP_02988416.1| ABC transporter related [Chloroflexus sp. Y-400-fl] >gi|163668441|gb|ABY34807.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187485875|gb|EDU23850.1| ABC transporter related [Chloroflexus sp. Y-400-fl] (315 aa)
Score = 307, Expect = 4.0e-26, Identities = 64/211 (30%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E + L KQ+       + +LN  V PGE  A +G NGAGKTTT++ +        G   I G D  +   R +  +G + E      R+++ +YL +   L  +++   +  +E++L++F +W++R++   +FS G ++K+ L +AL ++P +L +DEPT  +DP++     D +GEL+   +SI +++H LSE +  ++ + I+  G+I+
  S:     1 MIEAIQLGKQF--GDFVAVRDLNLVVQPGELVALLGPNGAGKTTTVRMLAAILPPGSGQARICGYDVVSHAQRVRGMVGLLTEYPGLYGRMAALEYLAFFGALLGVEATLCRQRSEALLRQFGLWEVRDRQLESFSKGMRQKMALIRALIHDPPVLFLDEPTTAMDPQSARTVRDAIGELRSAQRSILLTTHNLSEAEELADRIAIIRGGQII 211
>gi|168265321|ref|ZP_02687286.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL J2-071] (301 aa)
Score = 306, Expect = 4.2e-26, Identities = 100/291 (34%), Positives = 162/291 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTERALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGEDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLESVTEVEVDGEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|166364790|ref|YP_001657063.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] >gi|166087163|dbj|BAG01871.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] (313 aa)
Score = 306, Expect = 4.2e-26, Identities = 83/268 (30%), Positives = 145/268 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLI 323
           ++EV +L K Y       I +++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   ++LE R ++GY+PEN      ++   +L + A++  I S + K   + +L K ++ + R       S G K+++ +AQA+ ++P ++I+DEPT  LDPK  I+  +++  L   H +I +S+HIL E+ +  +  TI++ G+IV          G   Y I++    EGD+      +S  EI+ +     + A++ D L+
  S:     1 MIEVEHLSKIY--GSTTAISDVDFTVEKGEILGFLGPNGAGKTTTMRILSGYIPATTGTARIAGYDVHQQSLEVRRRIGYLPENPPLYPEMTVESFLDFVARIKGISSGDRKARVDLVLGKCQLLEKRKVIIRKLSKGYKQRVGIAQAIIHDPPVIILDEPTVGLDPKQIIEVRNLIKSLAGEH-TIILSTHILPEVSITCDRATIINRGRIVANNITTATPAGS-SYEIEI----EGDR------DSLLEILQQIPQVEQAAKVGDNLL 256
>gi|46906995|ref|YP_013384.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 4b F2365] >gi|46880261|gb|AAT03561.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 4b F2365] (301 aa)
Score = 306, Expect = 4.3e-26, Identities = 100/291 (34%), Positives = 162/291 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK-IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTELALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSAIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLESVTEVEVDGEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|47091707|ref|ZP_00229503.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 4b H7858] >gi|153166060|ref|ZP_01926703.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL N1-017] >gi|167014143|ref|ZP_02276676.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL J1-194] >gi|167213996|ref|ZP_02284303.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL R2-503] >gi|47020026|gb|EAL10763.1| ABC transporter, ATP-binding protein [Listeria monocytogenes str. 4b H7858] >gi|133727869|gb|EBA29567.1| ABC transporter, ATP-binding protein [Listeria monocytogenes FSL N1-017] (301 aa)
Score = 306, Expect = 4.5e-26, Identities = 100/291 (34%), Positives = 162/291 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL +NP +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+
  S:     1 MTELALQVTNLHKKI--RKREIIKGISFEVMPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDSSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLESVTEVEVDGEYLVTAVNE---------HSAEWNEQLVAKGIQVHEIDKKKPSLEDLF 291
>gi|118046909|ref|ZP_01515554.1| ABC transporter related [Chloroflexus aggregans DSM 9485] >gi|117996638|gb|EAV10834.1| ABC transporter related [Chloroflexus aggregans DSM 9485] (316 aa)
Score = 306, Expect = 4.5e-26, Identities = 67/215 (31%), Positives = 121/215 (56%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +T  ++E  +L KQY       +D+LN  V  GE    +G NGAGKTTTI  ++G      GS+ + G+D   + L  + ++GY+P+   F   +++ + L Y AKLN I+  +      + L++  +  + ++    FS G ++++ +A+ L   P ++IMDEPT  LDP+A  +F D++ +L+    +I +SSH+L ++    + V +   G++V
  S:     1 MTDVVIECHDLTKQY--GTFTAVDHLNMTVRKGEIFGLLGPNGAGKTTTILMLLGLTEPTSGSVRVLGLDPARQPLSVKARVGYLPDQVGFYDNLTARENLNYIAKLNGIREPDMSKRIAAALEQVGLSHVTDRRVKTFSRGMRQRLGVAEVLIKQPQLIIMDEPTLALDPEAVREFLDLIRQLKASGITILLSSHLLQQVQAICDRVGLFHKGRMV 215
>gi|57233588|ref|YP_182314.1| ABC transporter, ATP-binding protein [Dehalococcoides ethenogenes 195] >gi|57224036|gb|AAW39093.1| ABC transporter, ATP-binding protein [Dehalococcoides ethenogenes 195] (313 aa)
Score = 306, Expect = 4.6e-26, Identities = 62/194 (31%), Positives = 116/194 (59%)
  Q:    73 TIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           T+D L+  V       F+G NGAGKTT ++ + G  +   G  Y+SG  +  +NL  R+K+G++P+   F   ++  +++ ++ +L+K+  K+  L A+ +L+   + +   +    +S G K+++ +AQAL N P++L MDEPT+ LDP  R D  +++  L     ++F+S+HILS+++   + V I+  GK++
  S:    18 TLDGLDLAVEKNRVFGFLGPNGAGKTTAVRMLTGLSQPTSGKAYVSGEEVTPRNLSLRSKIGFLPDVPAFYGWMTGREFMLFSGELHKLAPKDNNLRADELLELVDLKEAGKRRVGGYSRGMKQRLGIAQALVNKPEVLFMDEPTSALDPMGRRDVLNLIERLSG-DTTVFMSTHILSDVERVCDRVAIISEGKLI 212
>gi|163846072|ref|YP_001634116.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187602721|ref|ZP_02988944.1| ABC transporter related [Chloroflexus sp. Y-400-fl] >gi|163667361|gb|ABY33727.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187485219|gb|EDU23197.1| ABC transporter related [Chloroflexus sp. Y-400-fl] (316 aa)
Score = 306, Expect = 4.9e-26, Identities = 65/212 (30%), Positives = 121/212 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +E +NL  +Y  +K   +D+LN +V  G  + F+G NGAGKTTT++ + G      G I + G       ++  +GY+P+       +  ++YL + A+   ++    +   + +L    +   R+      S G ++++ LA AL ++P IL++DEP + LDP+AR++  ++L  L+ + K+I +SSHILSEL    +A+ I+D+G+++ +
  S:     5 IETINLTHRY--RKFVALDHLNLQVSQGSIYGFIGPNGAGKTTTLRLLAGLITPTSGEIRLLGERLTMRSAQRLVGYMPDFFGVYDDLRVWEYLDFFARCYGLRGARLRQVVDELLDLVDLSAKRDAFVQTLSRGMQQRLCLAHALVHDPPILLLDEPASGLDPRARVELRELLRTLRDMGKTIMLSSHILSELAEVCDAIGIIDHGRMIIS 214
>gi|18976407|ref|NP_577764.1| daunorubicin resistance ATP-binding protein [Pyrococcus furiosus DSM 3638] >gi|18891935|gb|AAL80159.1| daunorubicin resistance ATP-binding protein; (drrA) [Pyrococcus furiosus DSM 3638] (322 aa)
Score = 306, Expect = 5.1e-26, Identities = 73/211 (34%), Positives = 127/211 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V+++ K +   K   +  DNL+FKV  G+    +G NGAGKTTT++ +   YR   G I I GID   N N E+R +M Y+ +       +S  DY+ Y  +   +  +EA+      LK F + +  N+ P   S+G K+++ LA  LS++  ++ +DEPTA +DPK++ D ++++GE+ ++   +I +SSH L E++  ++ V I++ GK V
  S:     3 MVDVISVTKTFSTPKGKVVAVDNLSFKVKRGQVFGILGPNGAGKTTTLRMMATIYRPDSGRILIDGIDVVENPN-EARKRMAYMTQEPDLSPTLSVRDYITYYFRFRGLSKREARERCSYALKTFNLEEHANKKPFQLSTGLKRRVQLACVLSSDAPLVFLDEPTAGVDPKSKRDAWELIGEMVREKDMTIILSSHDLYEVEYLADEVLIINYGKAV 218
>gi|177668204|ref|ZP_02943490.1| ABC transporter related [Cyanothece sp. PCC 8801] >gi|172073200|gb|EDT58634.1| ABC transporter related [Cyanothece sp. PCC 8801] (330 aa)
Score = 305, Expect = 5.5e-26, Identities = 71/219 (32%), Positives = 125/219 (57%)
  Q:    50 IDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           I +  P++EV +L K Y       I +++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   +++E R ++GY+PEN      ++   +L + A++  + S +        +++ ++ D R       S G K+++ +AQA+ ++P  +I+DEPT  LDPK  I+  +++  L   H +I +S+HIL E+ +  + VTI++ GK+V T
  S:     5 IVINSPMIEVQHLSKIY--GSTAAIQDVDFSVESGEILGFLGPNGAGKTTTMRILSGYIPATTGTAKIAGYDVHEQSMEVRRRIGYLPENPPLYPEMTVEGFLMFVARIKGVASGDRVSRVNWSIERCQLQDKRKILIRKLSKGYKQRVGIAQAIVHDPPAIILDEPTVGLDPKQIIEVRNLIKSLAGEH-TIILSTHILPEVSMTCDRVTIINKGKVVAT 222
>gi|163764031|ref|ZP_02171090.1| ABC-type multidrug transport system ATPase component-like protein [Bacillus selenitireducens MLS10] >gi|160355465|gb|EDP82119.1| ABC-type multidrug transport system ATPase component-like protein [Bacillus selenitireducens MLS10] (310 aa)
Score = 305, Expect = 5.6e-26, Identities = 92/293 (31%), Positives = 160/293 (54%)
  Q:    50 IDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPN---NFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARID---FFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDF-----EGDKVGKYEVNS-NNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLY 342
           +D   P++ V NL K     K P I N++F +YPGE   F+G NG+GKTTTI+ I+G  R  +G + I G D +   +++   +G I EN         +DYL     L + +     +  + + +   +  ++N+  +    +S G ++++ +AQAL N P +LI+DEP   LDPK   +   F   L E + L  S+ +SSH+LSE+ L  + V I+  G ++   + ++   E G + +    V++      E  +V   EV +  +E I    D  +LAE+ + L+   + V + E++  ++EDL+
  S:     1 MDSETPVMSVKNLSKTI--GKAPIIHNISFDLYPGEVFGFLGPNGSGKTTTIRMIVGLIRPTEGVVTIGGYDVQKQFVKAMRHIGSIVENP------EMYDYLSGWENLKQFQRMVPGVTEKRMHEVIELVGMKNRVHDPVKTYSLGMRQRLGIAQALLNRPKVLILDEPANGLDPKGIREMRQFIRRLAEEEGL--SVLVSSHLLSEIQLMCDRVAIISKGAVLAVDRVDELLAEQGRVIWEASPVDEARAIIQEHLEVLDEEVAAGEHEPIVTMDDGTDLAEVNEALVKAGVRVHRMERHLPALEDLF 300
>gi|147670002|ref|YP_001214820.1| ABC transporter related [Dehalococcoides sp. BAV1] >gi|146270950|gb|ABQ17942.1| ABC transporter related [Dehalococcoides sp. BAV1] (313 aa)
Score = 305, Expect = 5.6e-26, Identities = 61/193 (31%), Positives = 116/193 (60%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +D L+  V       F+G NGAGKTT ++ + G  +   G  Y+SG  +  +NL  R+K+G++P+   F   ++  +++ ++ +L+K+  +E  L A+ +L+   + +   +    +S G K+++ +AQAL N P++L MDEPT+ LDP  R D  +++  L     ++F+S+HILS+++   + V I++ GK++
  S:    19 LDGLDLAVEKNRVFGFLGPNGAGKTTAVRMLTGLSQPTSGKAYVSGEEVTPRNLSLRSKIGFLPDVPAFYGWMTGREFMLFSGELHKLSPRENNLRADELLELVDLSEAGKRRVGGYSRGMKQRLGIAQALVNKPEVLFMDEPTSALDPMGRRDVLNLIERLSG-DTTVFMSTHILSDVERVCDRVAIINEGKLI 212
>gi|163846546|ref|YP_001634590.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187603060|ref|ZP_02989281.1| ABC transporter related [Chloroflexus sp. Y-400-fl] >gi|163667835|gb|ABY34201.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187484958|gb|EDU22938.1| ABC transporter related [Chloroflexus sp. Y-400-fl] (315 aa)
Score = 305, Expect = 5.6e-26, Identities = 67/211 (31%), Positives = 123/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E  NL + YYG     +D+LN  +  G  + F+G NGAGKTTT++ +        G  +++G  + ++  E R  +G++P++  F + +++ +YL + A    +         E +L    +   R+    + S G K+++ LA+ L ++P +LI+DEP + LDP+AR++  ++L EL++L K+I ISSHIL+EL      + I++ GK++
  S:     4 IVETKNLTR-YYGAML-ALDHLNLHIPAGAVYGFIGPNGAGKTTTMRILTTLLTPSGGEAWVAGFSVTHQRTEVRRAVGFMPDSFGFYNNMTAAEYLKFFADAYHVPPARQLGLIEDLLTLVDLAHKRDSDVMSLSRGMKQRLSLARTLIHDPQLLILDEPASGLDPRARVELRELLKELRRLGKTIMISSHILTELAEMCTHIGIIERGKLL 214
>gi|73749023|ref|YP_308262.1| ABC transporter, ATP-binding protein [Dehalococcoides sp. CBDB1] >gi|73660739|emb|CAI83346.1| ABC transporter, ATP-binding protein [Dehalococcoides sp. CBDB1] (306 aa)
Score = 305, Expect = 5.9e-26, Identities = 74/211 (35%), Positives = 127/211 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKL-HKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K +  K    +DN+ F V PGE   F+G NGAGKTTT++ I+G      G   ++G +  K+  +R+ +G + E      R+S+++ L Y A + +I ++EA++    +L+ F + + RN     FS G K+K+ LA+A+ + P++L +DEP + LDP+A+  F D++  L +  + +IF++SH L E+    N V I+  GK++
  S:     1 MIEVNNLSKVF--KDKTVLDNITFSVAPGEIFGFLGPNGAGKTTTMRIILGLLNPSSGKATLNGKNLAKDDTARSNVGVLLEVDGIYDRLSAYENLRYFADIYRIPNREARI--NELLEFFNLSERRNDPAGKFSKGMKRKLALAKAIMHKPEVLFLDEPASGLDPEAQKSFRDLILSLSREGNMTIFLNSHDLDEVQRICNKVAIIKGGKLL 209
>gi|168179209|ref|ZP_02613873.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] >gi|182670070|gb|EDT82046.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] (231 aa)
Score = 305, Expect = 6.2e-26, Identities = 76/223 (34%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   KI+  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNEGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEISICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKIEDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEEGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|168183461|ref|ZP_02618125.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] >gi|182673287|gb|EDT85248.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] (231 aa)
Score = 305, Expect = 6.2e-26, Identities = 75/223 (33%), Positives = 129/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR----NKNENGE 278
           +L V  L K Y   K   ++N++F V  GE    +G NGAGK+T+IK+I G  + F G I I G DNK+L +++K  Y+PE       ++ ++++ Y A   K++  + K  AE +LK+F +WD +++  +  S G ++K+ +  AL  NP +++ DEP   LDPKA  +   +  EL++   ++ IS+HI+  +    +   I+  G IV+ + +    +KNE+ E
  S:     1 MLVVKGLCKNY--NKFKAVNNVSFDVNEGEIAVLLGPNGAGKSTSIKAIAGLLK-FQGEINICGKDNKSLGAKSKFAYVPEVPALYDLLTVYEHVEYMANAYKVRDYKDK--AEHMLKRFDLWDKKDKLGSELSKGMQQKVSICAALITNPKVILFDEPMIGLDPKAIKELKKVFLELKEKGTAVIISTHIIDSISEIWDKALIMKEGNIVFARTKQELIDKNESLE 222
>gi|157151101|ref|YP_001451143.1| ABC transporter ATP-binding protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157075895|gb|ABV10578.1| ABC transporter ATP-binding protein [Streptococcus gordonii str. Challis substr. CH1] (237 aa)
Score = 305, Expect = 6.3e-26, Identities = 75/211 (35%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYY-GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L++ +L K Y  GKK   +D+L+  V PG+ + F+GANGAGKT+TIKSI+G +    G IYI G  I  + L  + KM ++P+N      +++  +L + A + ++  ++ +   E   K F +    +Q  + +S G K+++ L  AL + P++LI+DEP   LDPK    F  I+ EL     +IF S+H+L   +   N V IL  G++V
  S:     1 MLKIEHLTKVYSNGKK--AVDDLSLMVEPGDIYGFIGANGAGKTSTIKSIVGIHDFDKGEIYICGHSIRKEPLLCKKKMAFLPDNPDLYKNLTARQFLDFVADIYRVSMEKRQAAIEKYSKMFELDTSLDQLISAYSHGMKQRLALIAALLHEPELLILDEPFVGLDPKGAYYFKQIMRELAGQGHAIFFSTHVLEVAEELCNKVAILQKGRLV 212
>gi|167756203|ref|ZP_02428330.1| hypothetical protein CLORAM_01733 [Clostridium ramosum DSM 1402] >gi|167704195|gb|EDS18774.1| hypothetical protein CLORAM_01733 [Clostridium ramosum DSM 1402] (311 aa)
Score = 305, Expect = 6.4e-26, Identities = 72/199 (36%), Positives = 118/199 (59%)
  Q:    71 HPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQ 269
           +  ID+L+F +  G+ +  +G NGAGK+TT+  ++G      GS  I G    + E++  MGY PE   F S +S  +YL Y   L+ +   EA    + +L++F + + + +    FS+G KKK+ L QA+ + P+IL++DEPTANLDP +R +    L  L K  K ++ ISSH+L+EL++  + V +++ G +V  Q
  S:    17 YKAIDDLSFSLEGGKIYGMIGPNGAGKSTTMSLLMGLIFPTKGSGLIKGYPLGSNEAKAIMGYSPEFPNFYSDMSCLEYLVYMGMLSDLSYDEALKRTKELLEEFDLVEHQLKRVAKFSTGMKKKVGLIQAMMHKPEILLLDEPTANLDPTSRYEIIQTLKRLVKQRKMTVLISSHVLTELEMIIDHVIMINKGHVVLNQ 216
>gi|126179289|ref|YP_001047254.1| ABC transporter-related protein [Methanoculleus marisnigri JR1] >gi|125862083|gb|ABN57272.1| ABC transporter-related protein [Methanoculleus marisnigri JR1] (301 aa)
Score = 305, Expect = 6.4e-26, Identities = 75/210 (35%), Positives = 115/210 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++   NL K Y GK    +D L+  V  GE   F+G NGAGK+TTI  + G      G  ++ GI+     L  +  +GY+PE+  F   ++    L Y A+   + +KE K     +L+   + D   Q    +S G K+++ LAQAL N+P +L +DEPTANLDP+   ++ +++  L    K+IF+SSHILSE+      V +L  GK+
  S:     1 MIRTENLTKVYNGKT--AVDGLDLVVGEGEIFGFLGPNGAGKSTTILMLTGMIEPTGGRCFVDGIEVAKDPLNVKKIIGYLPEDVGFYGNMTGEQNLDYFARFYGMDAKERKERIAELLELVHL-DGVAQKAGEYSRGMKQRLGLAQALINDPKVLFLDEPTANLDPEGVREYRELVTHLAGEGKTIFVSSHILSEVREVCRTVGLLAKGKL 209
>gi|167748405|ref|ZP_02420532.1| hypothetical protein ANACAC_03149 [Anaerostipes caccae DSM 14662] >gi|167652397|gb|EDR96526.1| hypothetical protein ANACAC_03149 [Anaerostipes caccae DSM 14662] (336 aa)
Score = 305, Expect = 6.5e-26, Identities = 72/210 (34%), Positives = 121/210 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           L+EV +L K Y G  HP +D+L+F +  G  + F+G NGAGK+TT+  + G      G + I+G D   +  +++  +GY+PE       ++  +YL + ++L +I  KE     + +L   R+ D+ ++   N S G +++  LA A+   PDI+I+DEPT  LDPK  I+   ++  L K H +I +SSHIL+E+    + V I+  G++
  S:    12 LIEVKHLTKSYDG--HPALDDLSFTIEKGRVYGFLGPNGAGKSTTMNIMTGYIGADSGEVLINGFDILKEPEKAKRSVGYLPEIPPLYPDMTVREYLSFVSELKEIPGKERAAQVDEVLSLVRLTDVSSRLIRNLSKGYRQRTGLAAAVLGFPDIIILDEPTVGLDPKQIIEIRQLIRTLSKDH-TIILSSHILAEVQEICDYVLIISKGRL 220
>gi|115525103|ref|YP_782014.1| ABC transporter related [Rhodopseudomonas palustris BisA53] >gi|115519050|gb|ABJ07034.1| ABC transporter related [Rhodopseudomonas palustris BisA53] (301 aa)
Score = 305, Expect = 6.7e-26, Identities = 68/193 (35%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +++F++ PG   A VG NGAGKTT IK ++G  R   G+I + G D       +R  +GY+PEN  F + ++  + L + A+L +IK   A      +L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL EL+    ++ ISSH L+EL+  +  V I++ G +V
  S:    20 LHDVSFELTPGRLSALVGHNGAGKTTLIKLMLGLIRADGGAIRVLGEDPAAGEFSARRLLGYLPENVAFNAALTGRETLAFYARLKRIKPATA----WPLLERVGLAPAADRKVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRQTFYEILDELRDDGATVLISSHALNELEDRAEHVLIMNRGLLV 210
>gi|118047478|ref|ZP_01516113.1| ABC transporter related [Chloroflexus aggregans DSM 9485] >gi|117995983|gb|EAV10189.1| ABC transporter related [Chloroflexus aggregans DSM 9485] (316 aa)
Score = 304, Expect = 7.1e-26, Identities = 68/212 (32%), Positives = 124/212 (58%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK---MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +E ++L  +Y  KK   +D LN +V  G  + F+G NGAGKTTT++ + G  +   G + + G   + L +RT    +GY+P+       +  ++YL + A+   ++    +     +L    + + R+      S G ++++ LA AL ++P IL++DEP + LDP+AR++  ++L  L+ + K+I +SSHILSEL    +A+ I+D+G++V +
  S:     5 IETIDLTHRY--KKLIALDRLNLQVEQGCIYGFIGPNGAGKTTTLRIVAGLLQPTKGEVRLLG---ERLTTRTAQRLVGYMPDFFGVYDDLRVWEYLDFFARCYGLRGSRLRQVVNELLDLVDLSEKRHAFVQTLSRGMQQRLCLAHALVHDPPILLLDEPASGLDPRARVELRELLRTLRDMGKTIMLSSHILSELAEVCDAIGIIDHGRMVLS 214
>gi|147920712|ref|YP_685484.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110620880|emb|CAJ36158.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (325 aa)
Score = 304, Expect = 7.9e-26, Identities = 70/211 (33%), Positives = 118/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++   NL K Y G +   +D+++  V  GE   F+G NG+GKTTTI  I+G     +G  +I+ ++     L+++   GY+P+   F   +++   L Y +K   +   EA    + +L+   +  +  Q+   FS G ++++ LAQAL N+P +L MDEPT  LDP+  + F  I+ +L    K+IF SSHILSE+ L    + ++  GK++
  S:    25 MIRTENLTKVYNGVR--AVDSVSLNVGKGEVFGFLGPNGSGKTTTIGMIVGLIEPSEGKCFINDVEVTRNPLQAKKITGYLPDGIGFYPTLTARQNLKYFSKFYGLSDAEADRRIDELLEYVGLKGVTTQT-GGFSRGMRQRLGLAQALINDPQVLFMDEPTNGLDPQGVVQFRHIISDLAGKGKTIFFSSHILSEVQLVCKNIGVISKGKLI 234
>gi|89896555|ref|YP_520042.1| hypothetical protein DSY3809 [Desulfitobacterium hafniense Y51] >gi|89336003|dbj|BAE85598.1| hypothetical protein [Desulfitobacterium hafniense Y51] (293 aa)
Score = 304, Expect = 8.1e-26, Identities = 98/284 (34%), Positives = 156/284 (54%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK-RNKNENGEMCYRIK----------LVEDFEGDKVGKYEVNSNNEIIYEFKDK--NELAELID----KLISKEILVKFEKYYLSI 338
           PL+E+ N+ K Y GK     D ++  V  GE   FVG NGAGKTT I+ ++G  R  +GS+ I G+D+   + E + ++GYIP    FP   +   +L   A+L  +       +A+ I++K ++    N      S G K+K  +  A   + +ILIMDEPT  LDP  R +F DIL E +K  K+IF+SSH+  E++   + V ++ +GKI+  +  R    N +  Y+I+          L E FE  +    +  + N+++    DK  N+   ++     K I+ EI    EKY+ S+
  S:     2 PLIEIKNITKNY-GKGRGNFD-VSLSVEKGEVFGFVGTNGAGKTTLIRQMMGFLRPGNGSVKIDGLDSWADSAEIKKRVGYIPGEIAFPDAPTGTAFLKRQAELLGLTDMS---YADFIIQKLQLDPTANL--KRMSKGMKQKTAIVAAFMADSEILIMDEPTTGLDPLMRAEFIDILNEEKKKGKTIFMSSHMFEEVEDTCDQVALIKDGKIIAVKSTREIKHNQDKVYKIEFTSHKDYRRFLTEAFEFSE----QRETQNQVLVNVHDKDINQFMAVLKGYRVKFIT-EIKYSLEKYFKSL 292
>gi|6318169|emb|CAB60255.1| MrsF protein [Bacillus sp. HIL-Y85/54728] (303 aa)
Score = 304, Expect = 8.3e-26, Identities = 71/207 (34%), Positives = 127/207 (61%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKN-LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           +L K+Y  KKH ++D LN ++  GE + F+G NGAGKTTTI+ ++G  +   G+I I G + NKN L+   ++G + E+  +   ++ ++ L    +L  +  ++       +L+  R+  + N+    +S G K+++ +A AL ++PD+LI+DEPT  LDP    +  +++ EL K   S+ +SSH+LSE+D  +  V I++NGK+++
  S:    10 DLTKKY--KKHTSVDGLNLRIRRGEIYGFLGPNGAGKTTTIRMLLGLIKPTKGNIEIFGQNLNKNRLQILQRIGSLVESPTYYGNLTGYENLEAVRRLRGLPEQQVN----EVLETVRLSKVANRLTKEYSLGMKQRLGIAVALLSSPDLLILDEPTNGLDPSGIQEIRELIKELPKSGMSVIVSSHLLSEIDQMATQVGIINNGKMIF 212
>gi|125717308|ref|YP_001034441.1| ABC-type multidrug transport system, ATPase component, putative [Streptococcus sanguinis SK36] >gi|125497225|gb|ABN43891.1| ABC-type multidrug transport system, ATPase component, putative [Streptococcus sanguinis SK36] (237 aa)
Score = 304, Expect = 8.5e-26, Identities = 75/211 (35%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYY-GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L++ +L K Y  GKK   +D+L+  V PG+ + F+GANGAGKT+TIKSI+G +    G IYI G  I  + L  + KM ++P+N      +++  +L + A + ++  ++ +   E   K F +    +Q  + +S G K+++ L  AL + P++LI+DEP   LDPK    F  I+ EL     +IF S+H+L   +   N V IL  G++V
  S:     1 MLKIEHLTKVYSNGKK--AVDDLSLIVEPGDIYGFIGANGAGKTSTIKSIVGIHDFDKGEIYICGHSIRKEPLLCKKKMAFLPDNPDLYKNLTARQFLDFVADIYRVSLEKRQAAIEKYSKMFELDTSLDQLISAYSHGMKQRLALIAALLHEPELLILDEPFVGLDPKGAYYFKQIMRELASQGHAIFFSTHVLEVAEELCNKVAILQKGRLV 212
>gi|21283506|ref|NP_646594.1| hypothetical protein MW1777 [Staphylococcus aureus subsp. aureus MW2] >gi|21204947|dbj|BAB95642.1| MW1777 [Staphylococcus aureus subsp. aureus MW2] (246 aa)
Score = 304, Expect = 8.9e-26, Identities = 71/200 (35%), Positives = 118/200 (59%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I ++NF++  GE    +G NGAGK+TTIK ++G     +GS+ IS I+ N ++E+ R K+ YIPE+      ++  +++  TA    I   EA   A  +LK FR+ +     P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E +   +++ +S+HIL+  + Y +   ILD G++V
  S:    12 YGKR-PVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLSISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDEAMNRAMPLLKTFRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKNEGRTVLMSTHILATAERYCDRFIILDEGEVV 212
>gi|15924827|ref|NP_372361.1| ABC transporter [Staphylococcus aureus subsp. aureus Mu50] >gi|15927411|ref|NP_374944.1| hypothetical protein SA1655 [Staphylococcus aureus subsp. aureus N315] >gi|49484078|ref|YP_041302.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|82751489|ref|YP_417230.1| ABC transporter ATP-binding protein [Staphylococcus aureus RF122] >gi|148268308|ref|YP_001247251.1| ABC transporter related [Staphylococcus aureus subsp. aureus JH9] >gi|150394370|ref|YP_001317045.1| ABC transporter related [Staphylococcus aureus subsp. aureus JH1] >gi|156980153|ref|YP_001442412.1| ABC transporter [Staphylococcus aureus subsp. aureus Mu3] >gi|13701630|dbj|BAB42923.1| SA1655 [Staphylococcus aureus subsp. aureus N315] >gi|14247609|dbj|BAB57999.1| ABC transporter ecsA homolog [Staphylococcus aureus subsp. aureus Mu50] >gi|49242207|emb|CAG40914.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|82657020|emb|CAI81457.1| probable ATP-binding ABC transporter [Staphylococcus aureus RF122] >gi|147741377|gb|ABQ49675.1| ABC transporter related [Staphylococcus aureus subsp. aureus JH9] >gi|149946822|gb|ABR52758.1| ABC transporter related [Staphylococcus aureus subsp. aureus JH1] >gi|156722288|dbj|BAF78705.1| ABC transporter ecsA homolog [Staphylococcus aureus subsp. aureus Mu3] (246 aa)
Score = 304, Expect = 8.9e-26, Identities = 71/200 (35%), Positives = 118/200 (59%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I ++NF++  GE    +G NGAGK+TTIK ++G     +GS+ IS I+ N ++E+ R K+ YIPE+      ++  +++  TA    I   EA   A  +LK FR+ +     P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E +   +++ +S+HIL+  + Y +   ILD G++V
  S:    12 YGKR-PVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLSISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDEAMNRAMPLLKTFRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKNEGRTVLMSTHILATAERYCDRFIILDEGEVV 212
>gi|168700522|ref|ZP_02732799.1| ABC transporter, ATP-binding protein [Gemmata obscuriglobus UQM 2246] (322 aa)
Score = 303, Expect = 9.0e-26, Identities = 64/211 (30%), Positives = 117/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E V LRK Y   +   +  ++ +V  G+ +  +G NGAGKTT IK ++G     +G   + G    +  +R ++GY+PE+  FP   + +  + +   L  + S E K      L++  +    +     +S G K+++ +AQA+ + PD++I+DEPT  +DP  R +  D++ +L+    +IF++SH+L E++L  + V IL  GK+V
  S:     3 VIETVELRKTY--GRLQALKGVSLRVEKGQIYGLLGQNGAGKTTLIKILLGIVGLTEGQASLLGAPAGDANARRRVGYLPEDHAFPGYHTGYSLMDFYGSLYGVPSAERKKRIPETLEQVGIAGRMHYKIKTYSKGMKQRLGIAQAMLHRPDLIILDEPTDGVDPMGRAEIRDLMAQLKDDGHTIFLNSHLLGEVELICDRVAILQQGKLV 211
>gi|154492738|ref|ZP_02032364.1| hypothetical protein PARMER_02375 [Parabacteroides merdae ATCC 43184] >gi|154087043|gb|EDN86088.1| hypothetical protein PARMER_02375 [Parabacteroides merdae ATCC 43184] (246 aa)
Score = 303, Expect = 9.5e-26, Identities = 65/211 (30%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+  L K+Y       +++LN ++  GE    +G NGAGK+TTI  ++G      GS+ +  ID+    +E + K+GY+PE+  F   ++  + L YTA LN I+ KEA+  AE +L +  +    ++    +S G ++++ LA  L  +P+++I+DEPT+ +DP    +F D++ +L +    ++  SSH L+++    + V +   GK++
  S:     5 VIELTGLTKKY--GDFTAVNDLNLQIRKGEIFGLLGPNGAGKSTTILMMLGLTEPTTGSVKVCDIDSTTHPIEVKRKVGYLPEDVGFYEDMTGIENLVYTAALNGIRRKEARAKAERLLDRIGLVKEADKKAGKYSKGMRQRLGLADVLIKSPEVIILDEPTSGIDPAGVQEFMDLIRQLSREEGLTVLFSSHHLNQVQQVCDRVGLFGGGKLL 216
>gi|86607482|ref|YP_476245.1| ABC transporter, ATP-binding protein [Synechococcus sp. JA-3-3Ab] >gi|86556024|gb|ABD00982.1| ABC transporter, ATP-binding protein [Synechococcus sp. JA-3-3Ab] (336 aa)
Score = 303, Expect = 9.5e-26, Identities = 66/213 (30%), Positives = 123/213 (57%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           TK  +EV +L K Y       I +++F+V  GE   F+G NGAGKTT+++ + G     +G+  ++G D     +  R ++GY+PEN      ++   YL + A++ ++ + +     + ++++  + D R+      S G K+++ LAQAL ++P ++I+DEPT  LDPK  I+  +++  L   H +I +S+HIL E+ +  + V I++ G++
  S:    10 TKAAIEVEHLSKTY--GSFTAIRDISFQVNAGEIMGFLGPNGAGKTTSMRILAGYLPASEGTARVAGFDVHENPMAVRQRIGYLPENPPLYPDMTVESYLDFVAQIKRVSAGDRPRRVDEVIRRCSLEDKRHTLIRKLSKGYKQRVGLAQALVHDPPVIILDEPTIGLDPKQIIEVRNLIKSLAGEH-TIILSTHILPEVSMTCDRVVIINRGQV 221
>gi|89210322|ref|ZP_01188712.1| ABC transporter related [Halothermothrix orenii H 168] >gi|89159971|gb|EAR79629.1| ABC transporter related [Halothermothrix orenii H 168] (310 aa)
Score = 303, Expect = 1.0e-25, Identities = 76/211 (36%), Positives = 128/211 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN-KN-LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV  + K+Y G+K   +  +NFKV  GE   F+G NGAGKTTT++ I G      G + + G D  KN L+ +  +GY+PEN      ++ + +L + A+L  I   +     + +++   + D+RN+   N S G K+++ LAQAL  +P++LI+DEPT+ LDP+  I+  +++  L    K+I +SSHIL E+++ +  V I++ G+IV
  S:     1 MIEVKQVTKRY-GEK-VALKGINFKVGKGEIIGFLGPNGAGKTTTMQIITGYIPPTSGEVKVGGFDTFKNPLDVKRLIGYLPENPPLYPNMTVYRFLKFIAELKDIPRDQHDKELDRVMEVISIKDVRNRLIKNLSKGYKQRVGLAQALIGDPEVLILDEPTSGLDPRQIIEIRNLIKALST-DKTIILSSHILPEVNMIAERVLIINEGEIV 210
>gi|186686748|ref|YP_001869941.1| ABC transporter related [Nostoc punctiforme PCC 73102] >gi|186469100|gb|ACC84900.1| ABC transporter related [Nostoc punctiforme PCC 73102] (250 aa)
Score = 303, Expect = 1.0e-25, Identities = 64/210 (30%), Positives = 116/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L++  + K Y    H  ++NL+ ++  G F+A +G NGAGKTTT++ I G  R   G + I G  I     +++  + Y+P+     +++   +YL + A L  I   +A++ A+ ILK+  +W+ R      FS G K+K+ LA AL + P ILI+DEP   LD  A     ++L E      ++ +++HI+   +  +  + I+++G+++
  S:     5 LQLSQISKSY--GSHQAVNNLSLQITEGSFYALLGPNGAGKTTTLRMIAGLLRPDKGDVMILGHSIRRAPQKAKQTLAYLPDEPLIYNKLRPMEYLEFIAGLWGINPPKAQILAQEILKQLNLWNHRGDLSETFSRGMKQKLALAGALIHQPRILILDEPLTGLDAAAARLVKNMLAEYVNQGNTVILTTHIMEIAERMAQRIGIINHGRLI 214
>gi|196177897|gb|EDX72900.1| ABC transporter, ATP-binding protein [Microcoleus chthonoplastes PCC 7420] (363 aa)
Score = 303, Expect = 1.1e-25, Identities = 68/205 (33%), Positives = 116/205 (56%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           P I +++FKV PGE   F+G NGAGKTTT++ + G      G+  I+G D    +L  R ++GY+PE       ++   +LY+ A+L  + + +     +  + +  + + R       S G ++++ +AQA+ ++P  +I+DEPT  LDP+  ID  +++  L   H +I +S+HIL E+ +  + V I++ GKIV T   N  EN
  S:    12 PAIQDVSFKVEPGEILGFLGPNGAGKTTTMRILAGYLPATSGTARIAGYDVHENSLAVRQRIGYLPETPPLYPEMTVEGFLYFVARLKGVSAGDRTKRVKMAIARCNLVEKRKVLIRKLSKGFRQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIDVRNLIKSLAGEH-TIILSTHILPEVSMTCSRVAIINRGKIVAT---NSPEN 214
>gi|116625625|ref|YP_827781.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116228787|gb|ABJ87496.1| ABC transporter related [Solibacter usitatus Ellin6076] (254 aa)
Score = 303, Expect = 1.1e-25, Identities = 69/211 (32%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LEV  + K+Y   +   +D+++F +  GE   ++G NG+GK+TT++ + G      G +   G  I    +  +  +GY+PE  F    +S  +YL   A+L  +  + A    +++L+ F M++ R  +  ++S G K+KILLA AL +NP+++I DEP + LD  A + F +++  L +  K I  SSH+L  ++  S  V IL  GK+V
  S:     1 MLEVREITKEY--NRRAVVDHVSFTIGRGEVLGYLGPNGSGKSTTVRMLTGLLDPTSGEVLYGGRPIREDLIAYKRVLGYVPEEPFLYPYLSGREYLQLAARLRCLPERAACEKIDALLQLFSMYEHRFSTIGSYSKGMKQKILLAAALLHNPELIIFDEPLSGLDVTAALVFRNLISGLAREGKMILYSSHVLEVVEKVSRRVLILRRGKVV 211
>gi|163848021|ref|YP_001636065.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187603377|ref|ZP_02989594.1| ABC transporter related [Chloroflexus sp. Y-400-fl] >gi|163669310|gb|ABY35676.1| ABC transporter related [Chloroflexus aurantiacus J-10-fl] >gi|187484567|gb|EDU22551.1| ABC transporter related [Chloroflexus sp. Y-400-fl] (316 aa)
Score = 302, Expect = 1.2e-25, Identities = 65/215 (30%), Positives = 122/215 (56%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + + ++E  +L KQY       +D LN  V  GE    +G NGAGKTTTI  ++G      GS+ + G+D   + L  + ++GY+P+   F   +++ + L Y AKLN ++  E      + L++  + ++ ++    FS G ++++ +A+ L   P ++IMDEPT  LDP+A  +F D++ +L++   ++ +SSH+L ++    + V +   G++V
  S:     1 MAEVVVECRDLTKQY--GTFTAVDGLNLTVRKGEIFGLLGPNGAGKTTTILMLLGLTEPTSGSVRVLGLDPARQPLSVKARVGYLPDQVGFYDNLTARENLNYIAKLNGMREPEMSKRIATALEQVGLSNVADRRVKTFSRGMRQRLGVAEVLIKQPQLIIMDEPTLALDPEAVREFLDLIRKLKESGITMLLSSHLLQQVQAVCDRVGLFHKGRMV 215
>gi|177664120|ref|ZP_02939923.1| ABC transporter related [Cyanothece sp. PCC 8801] >gi|172076801|gb|EDT62212.1| ABC transporter related [Cyanothece sp. PCC 8801] (326 aa)
Score = 302, Expect = 1.3e-25, Identities = 70/222 (31%), Positives = 128/222 (57%)
  Q:    45 VNQEDIDLTKPLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILK--KFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +NQE      P++++ NL K Y       +K  ++ + +  VYPGE    +G NGAGKTT +K ++G  R   G   + G      + + ++GY+PEN +F   ++++++L +TA L ++  K  K   + +L   K      R +    +S G  +++ +AQAL N+P+++ +DEP + LDP  R    +I+  L++  K+IF +SHIL++++   + + IL  G+I+
  S:    13 LNQE-----MPVVQIWNLSKVYRTGFWLNQKVRSLTHCSLTVYPGETFGLLGPNGAGKTTLLKILLGVIRPTSGRAVLLGEPIGRRDIKQRVGYLPENAYFYDYLTAWEFLDFTAGLFQMPPKGKKQRIQELLDLVKLDPKTARKKQLRQYSKGMLQRVGMAQALINDPEVVFLDEPMSGLDPLGRYQVREIILSLKEQGKTIFFNSHILTDVEQICDRIAILARGEIL 236
>gi|158301934|ref|XP_321601.4| AGAP001523-PA [Anopheles gambiae str. PEST] >gi|157012711|gb|EAA00830.4| AGAP001523-PA [Anopheles gambiae str. PEST] (1524 aa)
Score = 302, Expect = 1.3e-25, Identities = 68/214 (31%), Positives = 121/214 (56%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPT---IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           T+ ++ + NL K ++ +K      + N    +Y       +G NGAGKTTT+  I G      G+I + G  + N   R K+G+ P++  F S +S  ++L +   L  +  +EA+  A+ +L+K  + D  +   +  S G K+++ LA AL     +LI+DEPT+ LDP++R D +DIL  L++ H +I +++H + E D+  + V I++ G++V
  S:   402 TQQVVRIANLTKVFHSRKSGAKVVVKNFGLSIYSNSITVLLGHNGAGKTTTMNIITGMVPRTSGTIVVDGEHDAN-RYRHKIGFCPQHDVFFSYLSCLEHLVFFGCLRGLGREEAEKEAKLVLEKVHLLDKSDALVHTLSGGMKRRLSLAIALVGATKLLILDEPTSGLDPESRRDIWDILLNLRQNH-TILLTTHFMEEADVLGDWVAIMEEGELV 616
Score = 234, Expect = 9.2e-18, Identities = 56/207 (27%), Positives = 111/207 (53%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN---LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           V  L+K Y    H  + +++F V  GE    +G NGAGKTT  + +  +     G IY+   + +    L+ R + GY P+       ++ ++ + Y A++  I++++  +   S L K  + + R+ +  + S G K+K+    AL   P ++++DEPT  +DPK+R   +  +  +Q+ H++I ++SH + E +   N ++I+  G++
  S:  1209 VQELQKTY--TNHEAVKSVSFAVKQGECFGLLGMNGAGKTTVFQMLSRNLPLTGGKIYLQQCEVQAADALQYRRQYGYCPQFDVLLDFMTVYEVIDYFAQIKGIEARDKHIM--SWLVKLDIVEYRDHALRDCSGGTKRKVNTILALLGGPSVVLLDEPTTGVDPKSRRFLWKTIKTIQRKHQTILLTSHSMDECEELCNRLSIMVGGRL 1414
>gi|16799824|ref|NP_470092.1| hypothetical protein lin0750 [Listeria innocua Clip11262] >gi|16413201|emb|CAC95982.1| lin0750 [Listeria innocua] (301 aa)
Score = 302, Expect = 1.4e-25, Identities = 101/301 (33%), Positives = 166/301 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKV-----------GKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLYKKYVIYGSVD 352
           +T+  L+V NL K+   +K   I  ++F+V PGE   F+G NGAGKTTTI+ I+G  +   G+I I G D  KN  E+   +G I EN  F + ++  + L Y A+++  IK +  +   E +  + R+    N   + +S G ++++ +AQAL ++P +LI+DEPT  LDP    +  D +  L +    S+ +SSH+LSE++L  + V I+ +G I+ T + +   +     R  L   FE  K            G+Y V + NE           AE  ++L++K I V + +K   S+EDL+ +     S+D
  S:     1 MTELALQVTNLHKKI--RKREIIKGISFEVRPGEVFGFLGPNGAGKTTTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFARMDPSIKKERIQEVTELVGLEKRI----NDRVSTYSLGMRQRLGIAQALLSSPKLLILDEPTNGLDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLLSSRAQLRW-LATPFEQAKAFLASVTEVEVDGEYLVTAVNE---------RSAEWNEQLVAKGIQVHEIDKKKPSLEDLFLELTGGHSID 301
>gi|171911158|ref|ZP_02926628.1| ABC-type transport protein [Verrucomicrobium spinosum DSM 4136] (346 aa)
Score = 302, Expect = 1.4e-25, Identities = 68/212 (32%), Positives = 125/212 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           L+EV +L +  +   H  + +LNF ++ G+   F+GANGAGKTTT++ +        G + ++G++  ++  + R  +G++P++    S ++ ++YL + A+    K  E +   E ++    +  L ++  N  S G  +++   + L  +PD +I+DEP A LDPKAR++F +++  L +  K++FISSHILSEL    + +  +D GK+VY
  S:    34 LVEVRHLHR-VFDNVH-AVKDLNFDIHRGQVVGFIGANGAGKTTTMRIMATLDSPTSGMVRVAGVNVMDRPEKVRRLIGWMPDHYGTYSCMTVYEYLDFFARAYGFKRAERRARVEEVMDFADLLVLADRPMNKLSKGMGQRLCFGRMLLPDPDFMILDEPAAGLDPKARLEFKNLVRLLAQRGKTLFISSHILSELGEMCDTLLFIDGGKLVY 245
>gi|186459412|ref|ZP_02969717.1| ABC transporter related [bacterium Ellin514] >gi|184204100|gb|EDU01154.1| ABC transporter related [bacterium Ellin514] (320 aa)
Score = 302, Expect = 1.4e-25, Identities = 65/211 (30%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL K+Y G  H  + N++F V  GE    +G NGAGK+TT++ +        G++ ++G D   +  E R ++GY+PEN      +   +YL + A++  +  ++ +   ++++ +  + D+  +   + S G ++++ LA AL + P+++I+DEPT  LDP        ++ +L + H ++ IS+HIL E+++  N V IL  GKI+
  S:     6 MIEVSNLTKRYAG--HTAVSNISFTVGRGEIVGLLGTNGAGKSTTMRILSCYMPATAGTVRVAGYDVFTQADEVRRRIGYMPENNPLHPEMRVREYLKFRARIKGLGRRQCRERVDTVIDQCSLGDVSRKIIGHLSKGYRQRVGLADALVHEPELIILDEPTIGLDPNQIRSVRQLIKDLGRTH-TVLISTHILPEVEMTCNRVLILHGGKIL 215
>gi|154688065|ref|YP_001423226.1| MrsF [Bacillus amyloliquefaciens FZB42] >gi|154353916|gb|ABS75995.1| MrsF [Bacillus amyloliquefaciens FZB42] (303 aa)
Score = 302, Expect = 1.5e-25, Identities = 70/207 (33%), Positives = 127/207 (61%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKN-LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           +L K+Y  KKH ++D LN ++  GE + F+G NGAGKTTTI+ ++G  +   G+I I G + NKN L+   ++G + E+  +   +++++ L    +L  +  +        +L+  R+  + N+    +S G K+++ +A AL ++PD+LI+DEPT  LDP    +  +++ EL K   S+ +SSH+LSE+D  +  V I++NG++++
  S:    10 DLTKKY--KKHTSVDGLNLRIRRGEIYGFLGPNGAGKTTTIRMLLGLIKPTKGNIEIFGQNLNKNRLQILQRIGSLVESPTYYGNLTAYENLEAVRRLRGLPEQRVN----EVLETVRLSKVANRLTKEYSLGMKQRLGIAVALLSSPDLLILDEPTNGLDPSGIQEIRELIKELPKSGMSVIVSSHLLSEIDQMATQVGIINNGRMIF 212
>gi|171912880|ref|ZP_02928350.1| ABC transporter related protein [Verrucomicrobium spinosum DSM 4136] (317 aa)
Score = 301, Expect = 1.6e-25, Identities = 67/211 (31%), Positives = 124/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V +LRK  +G K   +D + F V  GE   F+G NGAGK+TT++ + G ++   G+I + G+D   K   ++  +GY+PEN    S +S   +L + A++  +         +  L+   +  +RNQS +  S G + +  LAQ++ ++P++LI+DEPT  LDP  + +  +++  + + +K+I  S+HIL E++   +   I+D+GK+V
  S:     1 MIQVKDLRK-VFGPK-VAVDGITFNVEKGEVLGFLGPNGAGKSTTMRMVTGYFQPTAGTISVGGVDMLEKPEIAKRALGYLPENAPLYSDMSVVGFLGFCAEMRGLYGSARSKAIDKALETCFLEPVRNQSVDTLSKGYRHRTCLAQSIIHDPEVLILDEPTDGLDPNQKHEVRNLIKRMGQ-NKAIVFSTHILEEVEAVCSRAIIIDHGKVV 210
>gi|42781057|ref|NP_978304.1| ABC transporter, ATP-binding protein [Bacillus cereus ATCC 10987] >gi|42736978|gb|AAS40912.1| ABC transporter, ATP-binding protein [Bacillus cereus ATCC 10987] (293 aa)
Score = 301, Expect = 1.6e-25, Identities = 82/231 (35%), Positives = 129/231 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-NENGEMCYRIKL 285
           PL+E+ N+ K Y   +   I +++  +  GE   FVG NGAGKTTTI+ ++G  +   G+  I+G+D    + E +  +GYIP    FP   +  ++L   A+L  +K      +AESI+KK ++    N      S G K+K  +  AL  +P+ILI DEPT  LDP  R +F  IL E +K  K+IF+SSH+  E++   + V ++ +GKI+  +   +   N E  Y+I+ 
  S:     2 PLIEINNMTKDYGDGR--GIFDVSLSIEKGEVFGFVGTNGAGKTTTIRHMMGFLKPQSGNATINGMDCWKDSAEIKKMIGYIPGEIAFPDAPTGTEFLKRQAELLGLKDMS---YAESIIKKLQLDPTANLK--RMSKGMKQKTAIVAALMADPEILIFDEPTTGLDPLMRAEFISILDEQKKKGKTIFMSSHMFDEVEHTCDKVALIKDGKIIAVKSTKEIKYNQEKAYKIEF 228
>gi|73670659|ref|YP_306674.1| ABC transporter ATP-binding protein [Methanosarcina barkeri str. Fusaro] >gi|72397821|gb|AAZ72094.1| ABC transporter ATP-binding protein [Methanosarcina barkeri str. Fusaro] (307 aa)
Score = 301, Expect = 1.6e-25, Identities = 68/211 (32%), Positives = 121/211 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           +E+ +L K Y  +K P +  +N +  P      +G NGAGKTT +K ++       GSI I G D    E+  + ++GY+P+       ++ + +L Y A L  +  +E K   ES ++K  + + +N      S GQK+++ +AQAL N+P++LI+DEPT  LDP  R+ F ++L E    H+ + +S+HI+ +++   N + +L+ G+I++
  S:    22 IEIKDLSKAYMPEK-PVLSGINLEFRPPSIVGLIGPNGAGKTTFMKVLVRQLLASTGSIKIDGTDISKSENYLKNRLGYLPQEFGLYEELTVYQFLDYMALLKGL-GREKKERIESCIEKTGLSEKKNSRIRTLSGGQKQRVGIAQALLNDPELLIVDEPTVGLDPAERVRFRNLLAE-NANHRLVLLSTHIIEDVESICNRLIVLNRGEILF 231
>gi|146295427|ref|YP_001179198.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409003|gb|ABP66007.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] (317 aa)
Score = 301, Expect = 1.6e-25, Identities = 77/211 (36%), Positives = 125/211 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V +L K+Y   +H  I +++F+V  GE   F+G NGAGK+TT+  I G     +G+ Y+ G D   +  E + ++GY+PEN      ++  +YL + + + K+  KE K   + I++   +  +RN+   N S G K+++ LAQAL  NP +LI+DEPT  LDPK  I+   ++  L+  H +I +SSHIL E+      V I++ GKIV
  S:     1 MIKVEHLTKKY--GQHYAIHDISFEVQKGEIVGFLGPNGAGKSTTMNIITGYLSPTEGTAYVDGFDILEEPEEVKKRIGYLPENPPLYMDMTVQEYLDFVSDIKKVDKKEKKRSMDKIMETVGIAHVRNRLIKNLSKGYKQRVGLAQALIGNPPVLILDEPTIGLDPKQIIEIRSVIKNLRSEH-TIILSSHILPEVSAVCERVLIINKGKIV 210
>gi|83647756|ref|YP_436191.1| ABC-type multidrug transport system, ATPase component [Hahella chejuensis KCTC 2396] >gi|83635799|gb|ABC31766.1| ABC-type multidrug transport system, ATPase component [Hahella chejuensis KCTC 2396] (306 aa)
Score = 301, Expect = 1.7e-25, Identities = 66/211 (31%), Positives = 118/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++++ NL K+Y   +   +  ++F + PGE   F+G NGAGKTTT++ I G  +   GS+ + G+D  +   + +  MGY+PE       ++   +L +  K+  ++  + +   E ++ +  +  +  Q     S G K+++ LAQAL ++P +LI+DEPT  LDP  + +   ++  L K  K + IS+HIL E+D   + V I+  G+IV
  S:     1 MIKIQNLEKKYGDIQ--AVSGISFDIAPGEVLGFLGPNGAGKTTTMRMITGYVQPSGGSVSVMGVDVAHAPQQAQRIMGYLPEGAPLYGEMTVAAFLSFIGKVRGLRGAQLQQRIERVVAQVSLQHVMQQPIETLSKGFKRRVGLAQALIHDPQVLILDEPTDGLDPNQKHEVRKLIQNLSK-DKIVVISTHILEEVDALCSRVVIISKGRIV 210
>gi|91202939|emb|CAJ72578.1| similar to ABC-type transport system (ATPase component) [Candidatus Kuenenia stuttgartiensis] (282 aa)
Score = 301, Expect = 1.9e-25, Identities = 71/262 (27%), Positives = 146/262 (55%)
  Q:    64 KQYYGKKH-PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG--KIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISK 325
           K ++ +K  P + NLN ++  GE    +G NG+GKTTT+K ++G      G  ++ G  + +++++ K+G++PE ++  + +++ + L +  KL  +  KE K   + ++    +   R +  + +S G  ++I +AQA+ N+PD++I+DEPT+ LDP  R +  +++ E  K  K++ + SH+L+++    + + IL+ G  ++    K     N  M + +K + D + + V K+    N E++     ++ L EL   +I +
  S:    16 KDFWKRKSVPALTNLNLEIKQGEIFGLLGPNGSGKTTTVKLLLGFLHPTSGRSWLLGKPSGHIQTKNKIGFLPEESYLYTFLNAEEILDFYGKLFNLSRKERKERIDKLIYLVGLNPYRKRLLSKYSKGMLRRIGIAQAIINDPDLIILDEPTSGLDPIGRREIKELISEFNKQGKTVLLCSHLLADVQSICSRIAILNKGVLQVSGNVKELLCRNEVMEFLVKNLSDGDLELVKKFIAEKNGEVLSMHPHRSTLEELFVNIIQQ 280
>gi|16331772|ref|NP_442500.1| ABC transporter [Synechocystis sp. PCC 6803] >gi|1001733|dbj|BAA10570.1| ABC transporter [Synechocystis sp. PCC 6803] (342 aa)
Score = 301, Expect = 1.9e-25, Identities = 67/213 (31%), Positives = 124/213 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y       I N++F V  GE   F+G NGAGKTTT++ + G      G++ ++G D   ++L  R ++GY+PEN      ++   +L + A +  +K  + +      +++ ++ + R       S G K+++ +AQA+ ++P ++I+DEPT  LDPK  I+  +++  L + H +I +S+HIL E+ +  + VTI++ G++V T
  S:     1 MIEVEHLSKVY--GSTTAIQNVDFSVQKGEILGFLGPNGAGKTTTMRILAGYIPATTGTVRVAGFDVHEQSLAVRKRIGYLPENPPLYGDMTVASFLNFVASIKGVKPGDRRQRVIWAMERCQLTEKRKVLIRKLSKGFKQRVGIAQAIVHDPAVIILDEPTVGLDPKQIIEVRNLIKSLAEDH-TIILSTHILPEVSMTCDRVTIINQGRVVAT 212
>gi|196257265|ref|ZP_03155801.1| ABC transporter related [Cyanothece sp. PCC 7822] >gi|196200865|gb|EDX95684.1| ABC transporter related [Cyanothece sp. PCC 7822] (317 aa)
Score = 301, Expect = 2.0e-25, Identities = 70/215 (32%), Positives = 124/215 (57%)
  Q:    52 LTKPL-LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +TK L L    L KQ+  +++  ++N+  +V  GE +  +G NGAGKTT ++ +  +     G IYI+G     D  N   + ++GY+P++      ++ +DYL Y A+L ++K    +     +L+  ++   R+ S    S G K+++ LA+ + + P +L++DEP + LDP AR+ F +I+  LQ    +I ISSH+LS+L     +V I++ G +V
  S:     2 MTKELALATYGLTKQF--ERNLAVNNVELQVETGEVYGLIGPNGAGKTTLLRMLAAACEPTTGEIYINGELLLRDQSNPRLKQRLGYLPDDFPLYDDLTVWDYLDYFARLYRLKQSHRRRRLHEVLELVQLTSKRDSSIATLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFREIIKILQAAGMTIVISSHVLSDLAELCTSVGIMELGCLV 219
>gi|116619737|ref|YP_821893.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116222899|gb|ABJ81608.1| ABC transporter related [Solibacter usitatus Ellin6076] (261 aa)
Score = 300, Expect = 2.0e-25, Identities = 65/211 (30%), Positives = 118/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLH-KSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ V NL K +       +D+++F V PGE  AF+G NGAGKTTTIK +    +   G + I G+D  +   + R + G + ++    + +++++ +   A L  +  ++     ES+LK F +W+ R      FS G K+++ +A+   + P IL +DEPT  LDP++R   +  +  L      ++F+++H + E D  ++ + I+D+GKIV
  S:     1 MIHVQNLVKTF--GSFTAVDHVSFDVQPGEIFAFLGPNGAGKTTTIKMLTTLLKPTSGGLTIDGLDPAHNQDDVRQRFGIVFQDPSLDADLTAYENMEIHAVLYHVPRRDRAARIESLLKLFELWERRKDQVKKFSGGMKRRLEIARGFLHTPKILFLDEPTLGLDPQSRNQLWTHVKHLNATEGTTVFLTTHYMDEADRVAHRIAIIDHGKIV 212
>gi|29346335|ref|NP_809838.1| ABC transporter, ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] >gi|29338230|gb|AAO76032.1| ABC transporter, ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] (247 aa)
Score = 300, Expect = 2.0e-25, Identities = 70/208 (33%), Positives = 117/208 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           +  L KQY   K   +D++   +  GE    +G NGAGK+TTI  ++G      G + I GI++    +E + K+GY+PE+  F   ++  + L YTA+LN I  KEAK+ A  ++K+  + D   +    +S G ++++ LA  L  NP+I+I+DEPT+ +DP    +F +++  L K    ++  SSH L +     + V +  NGKI+
  S:     8 LTELTKQY--GKFTAVDHIRLSIRKGEIFGLLGPNGAGKSTTILMMMGLTEPTSGIVEICGINSTTHPIEVKRKIGYLPEDVGFYDDMTGLENLMYTARLNGIPDKEAKVKALELMKRVGLEDQLKKKTGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGVQEFIELIRWLSKEEGLTVLFSSHHLDQAQKVCDRVGLFSNGKIL 216
>gi|163811705|ref|ZP_02203389.1| ABC transporter related [Dehalococcoides sp. VS] >gi|157404759|gb|EDO70795.1| ABC transporter related [Dehalococcoides sp. VS] (313 aa)
Score = 300, Expect = 2.1e-25, Identities = 61/193 (31%), Positives = 115/193 (59%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +D L+  V       F+G NGAGKTT ++ + G  +   G  Y+SG  +  +NL  R+K+G++P+   F   ++  +++ ++ +L+K+  K+  L A+ +L+   + +   +    +S G K+++ +AQAL N P++L MDEPT+ LDP  R D  +++  L     ++F+S+HILS+++   + V I+  GK++
  S:    19 LDGLDLAVEKNRVFGFLGPNGAGKTTAVRMLTGLSQPTSGKAYVSGEEVTPRNLSLRSKIGFLPDVPAFYGWMTGREFMLFSGELHKLAPKDNNLRADELLELVDLKEAGKRRVGGYSRGMKQRLGIAQALVNKPEVLFMDEPTSALDPMGRRDVLNLIERLSG-DTTVFMSTHILSDVEKVCDRVAIISEGKLI 212
>gi|170759310|ref|YP_001786131.1| ABC transporter, ATP-binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406299|gb|ACA54710.1| ABC transporter, ATP-binding protein [Clostridium botulinum A3 str. Loch Maree] (262 aa)
Score = 300, Expect = 2.1e-25, Identities = 72/221 (32%), Positives = 137/221 (61%)
  Q:    59 VVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K ++G  R ++G + I G  I  +N+E + K+GY+PEN      +++++Y+ +  ++  ++ KE    A+ +++ F + +  +   +++S G ++K+L+  +L +NPDIL +DEP + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     8 VVSIRDLKMSYGSKE-VLKGINLDVNKGEIIGYIGPNGAGKSTTVKIMLGLVRGYEGEVKIFGNNISYENVEYKHKIGYVPENGEIYDNLTAYEYITFLGEIYGMELKEVNNKAKKLMRLFGIEEAYHSRISSYSKGMRQKLLIIASLIHNPDILFLDEPLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIAADGTFEELKKKNMEGSL 235
>gi|153954918|ref|YP_001395683.1| transporter protein [Clostridium kluyveri DSM 555] >gi|146347776|gb|EDK34312.1| Predicted transporter protein [Clostridium kluyveri DSM 555] (295 aa)
Score = 300, Expect = 2.1e-25, Identities = 71/212 (33%), Positives = 122/212 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           LE+ NL KQY  K    ++N++  + PG +   +GANGA KTT I+ I G      G I   GI+   L+   R  +GY+P++  F    +  DYL Y A L  +   + K   + +L+   + ++R +  +  S G K+++ +AQAL N+P++LI+DEPT+ LDP  R+ F  ++ E  +  + + IS+HI+S+++  +    I+ +G+I+ T
  S:     3 LEICNLTKQY--KDKIAVNNVSLNISPGVW-GLLGANGARKTTLIRMIAGIMVPTSGKILYDGIEIGVLKGAYRDILGYLPQDFGFYPEFTVMDYLKYIAALKGLTKYDTKEKIDELLQILTLTEVRKKKISKLSGGMKRRVGIAQALLNDPEVLILDEPTSGLDPGERVKFRKLISEFAQ-DRIVLISTHIVSDVEYIATCNAIMKDGEIIST 212
>gi|162449024|ref|YP_001611391.1| ABC transporter, ATP-binding protein [Sorangium cellulosum 'So ce 56'] >gi|161159606|emb|CAN90911.1| ABC transporter, ATP-binding protein [Sorangium cellulosum 'So ce 56'] (359 aa)
Score = 300, Expect = 2.2e-25, Identities = 69/239 (28%), Positives = 127/239 (53%)
  Q:    57 LEVVNLRKQYYG-----KKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVG 295
           +E  ++RK Y G          +  L+  +  G     +G NGAGKTT IK+++G  R   G++ + G D ++   R ++GY+PE  F PS  +   +L   A++  +   E  L A  ++++  +    ++    FS G ++++ LA AL   P++L++DEPT  +DP  R +   ILGE +    ++F++SH+LSE +   + + IL  G++V      +    E  YR++  +  +  ++G
  S:    53 IEASSVRKVYRGFFRRSGGQTALAGLDLAIQRGAAFGLIGLNGAGKTTFIKTLLGVVRPTSGAVRVLGGDPEDPGVRARIGYLPERLFLPSAFTPRQFLASVARMKGLSPGEGALRA--LVERVGLGVDSDRKIGGFSKGMRQRLGLAAALLGQPELLVLDEPTDGVDPLGRAEIRRILGEERARGATLFLNSHLLSETERICDRIGILAGGRLVREGALVELCGSETAYRVRFADGADAARLG 294
>gi|84617316|emb|CAI94676.1| putative ABC transporter [Streptomyces achromogenes subsp. rubradiris] (310 aa)
Score = 300, Expect = 2.3e-25, Identities = 58/195 (29%), Positives = 113/195 (57%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P +  ++  V  GEF   +G NGAGK+TTI  +        GS  + G+D     +E + ++G + +N    S++++ + L +  +   + +KEA+   + +++ F + + R  +P   S GQ K++++ +AL + PD L +DEPTA LDP+ R + + +L ELQ   ++I +++H + E +   + + ++D+GKI+
  S:    15 PAVRGIDLDVGRGEFFGLLGPNGAGKSTTIGMLTTLIVPTGGSAEVYGVDVVRNPIEVKRRIGVVSQNNTLDSQLTAAENLEFRGRYFGLTAKEARRRTDELIELFDLAEQREGNPFEMSGGQAKRVMICRALMHRPDALFLDEPTAGLDPQTRTNLWQVLRELQAGGQTILLTTHYMEEAEALCDRIAVVDHGKIL 211
>gi|118592258|ref|ZP_01549651.1| ABC transporter, ATP-binding protein NosF [Stappia aggregata IAM 12614] >gi|118435230|gb|EAV41878.1| ABC transporter, ATP-binding protein NosF [Stappia aggregata IAM 12614] (306 aa)
Score = 300, Expect = 2.3e-25, Identities = 64/218 (29%), Positives = 121/218 (55%)
  Q:    49 DIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +  L  P L V  + K + G  H  +D+++F +  GE  A +G NGAGKTT  K ++G  +   G + + G    + ++R    Y+PE+  FP+ ++  + L + A+L      E+   A  +L++  + +   +    +S G ++++ LAQAL   P ++++DEPT  LDP +R   ++++GE+     ++ +SSH L+EL+  ++ + IL  G++V
  S:     3 ETSLAAPTLRVDGVCKTFSG--HKAVDDVSFSLNAGERVAMLGHNGAGKTTLFKIVLGFLKRDHGDVTVMGAAPGSHDARVGTAYLPESVAFPASLTGKEVLTFYARLKG----ESPAKALPLLERVGLAEAAKRRVGTYSKGMRQRLGLAQALIGRPRLILLDEPTTGLDPISRQTVYELIGEIAGQGTTVLLSSHALTELEARTDRILILSKGRLV 214
>gi|157106521|ref|XP_001649361.1| abc transporter [Aedes aegypti] >gi|108868824|gb|EAT33049.1| abc transporter [Aedes aegypti] (1480 aa)
Score = 300, Expect = 2.3e-25, Identities = 68/229 (29%), Positives = 128/229 (55%)
  Q:    38 YFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKK--HPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +++ +  +  +   + ++++ NL K +         + NL+ ++Y     A +G NGAGKTTT+  I G      G I + G DN +   R ++G+ P++      +S  ++L +   L  +   EA+  A+ IL+K  + D  ++   N S G K+++ LA A+     +LI+DEPT+ LDP++R D +DIL  L+K H +I I++H + E D+  + + I++NG+++
  S:   320 FSKQYYQKGKNKVKQNQHVVKISNLNKIFKSSSGTRVAVRNLSLRIYKNRITALLGHNGAGKTTTMNIITGMTPRTSGRIEVDGEDNAS-NYRQQIGFCPQHNVALGYMSCREHLVFFGALRGMSIPEAEREADDILEKVNLADKSDEVLANLSGGMKRRLCLANAIIGRTKLLILDEPTSGLDPESRRDIWDILLRLKKDH-TILITTHFMEEADVLGDWIAIMENGELI 548
Score = 218, Expect = 7.0e-16, Identities = 59/221 (26%), Positives = 112/221 (50%)
  Q:    45 VNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN---LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           V+++  +     + V  LRK+Y     P +  ++F V  GE    +G NGAGKT+T + I  +    DG+IY++  D +     E R++ GY P+       ++  + + Y A +  ++  +  +     L    +    +   N  S G K+K+    A+  NP I+ +DEPT  +DPK+R   +  +  LQ+  ++I ++SH + E +   N ++I+ +G++
  S:  1143 VSKDPPEFASHTIAVHGLRKRYLSL--PAVRGVSFAVKRGECFGLLGMNGAGKTSTFQMITRNLPITDGTIYLNERDVRQSGEREYRSQFGYCPQGDALLDFMTPHELIRYCAMVKNLQHIDDLI--NLWLTDLDILPFAHSRINECSGGTKRKVNTILAMLGNPSIVFLDEPTTGVDPKSRHFVWSRIKALQRADQTIILTSHSMDECEELCNRLSIMVDGRL 1362
>gi|16080917|ref|NP_391745.1| hypothetical protein BSU38660 [Bacillus subtilis subsp. subtilis str. 168] >gi|1783260|dbj|BAA11737.1| yxlF [Bacillus subtilis] >gi|2636401|emb|CAB15892.1| yxlF [Bacillus subtilis subsp. subtilis str. 168] (295 aa)
Score = 300, Expect = 2.3e-25, Identities = 83/291 (28%), Positives = 158/291 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEM--CYRIKLVEDFEG-----DKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV-KFEKYYLSIEDLYKKYV 346
           +L + +L K Y  + H  + N++F V   E  A +G NGAGKTTT++ + G      G+I + G   K L+ R  +GY+P+   F S +++ ++L +  +L+ +  ++ +     +L+   + +  ++    +S G K+++ LAQAL + P  LI+DEP + LDP  R +  D++ EL+K H ++  S+H+L + +   + V I+ NG+I +  +  + +  +    + + + E  EG       V      + ++ ++E  D +    L+   I K + V +FE+   S+ED+Y K V
  S:     1 MLSIESLCKSY--RHHEAVKNVSFHVNENECVALLGPNGAGKTTTLQMLAGLLSPTSGTIKLLG--EKKLDRRL-IGYLPQYPAFYSWMTANEFLTFAGRLSGLSKRKCQEKIGEMLEFVGLHEAAHKRIGGYSGGMKQRLGLAQALLHKPKFLILDEPVSALDPTGRFEVLDMMRELKK-HMAVLFSTHVLHDAEQVCDQVVIMKNGEISWKGELQELKQQQQTNVFTLSVKEKLEGWLEEKPYVSAIVYKNPSQAVFELPDIHAGRSLLSDCIRKGLTVTRFEQKTESLEDVYLKVV 293
>gi|116623347|ref|YP_825503.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116226509|gb|ABJ85218.1| ABC transporter related [Solibacter usitatus Ellin6076] (1110 aa)
Score = 300, Expect = 2.5e-25, Identities = 69/211 (32%), Positives = 115/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE  +L K Y     P + +++F V PGE   ++G NGAGK+TT+K + G     +G I+ +G  +       + ++GY+PE       +S  +YL    +L  I   E +      L+ F +WD R++  + +S G ++KILL+ AL ++P+ILI+DEP + LD  + +    +L  L    K I  SSH+L  ++   + V IL  G++V
  S:     1 MLEARSLTKYY--SHTPAVRDVSFIVKPGEILGYLGPNGAGKSTTVKMLTGLIEPSEGQIFYNGKSVYEDFTAFQQRIGYVPEEAHLYPHLSGREYLQLMGRLRGIPRAELEPKMHEFLRSFGLWDDRHEPLSAYSKGMRQKILLSAALLHDPEILILDEPFSGLDVTSALMLRSLLRTLADRGKIILYSSHVLEVVEKICSTVLILRKGEVV 211
>gi|163815441|ref|ZP_02206814.1| hypothetical protein COPEUT_01604 [Coprococcus eutactus ATCC 27759] >gi|158449078|gb|EDP26073.1| hypothetical protein COPEUT_01604 [Coprococcus eutactus ATCC 27759] (241 aa)
Score = 299, Expect = 2.7e-25, Identities = 67/213 (31%), Positives = 116/213 (54%)
  Q:    64 KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           K+ YG    ++D+L+F +  GE   FVG NGAGKTTTIK + G     +G + I+G D   K +E++  MGYI +N     R++  +Y+ + A +  +   + K   E + ++F M D  N+   ++S G ++K+++  AL +NP + I+DEP   LDP A  +   ++ E       +F S+H+L   +   + + ++  GK +Y     + EN
  S:     8 KKVYGGDFVSVDDLSFHINKGEIVGFVGQNGAGKTTTIKMLTGILMPTEGRVVINGYDMREKPMEAKQSMGYIADNPDIFLRLTGLEYVNFIADIYGVSVSDRKARIEQMAERFGMEDSLNRQMVSYSHGMRQKMMVIAALVHNPPVWILDEPMTGLDPNAAYELKKMMREHADAGNCVFFSTHVLEVAEKLCDKIIMIRKGKDIYQGTLEELEN 222
>gi|126699500|ref|YP_001088397.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] >gi|115250937|emb|CAJ68765.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] (288 aa)
Score = 299, Expect = 2.7e-25, Identities = 84/251 (33%), Positives = 138/251 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIY 307
           L V  L KQY  K    +D ++FK+  G  + F+G NGAGKTT ++ I G      G + + G +N ++  + R  +GY+P+N  +    ++ +++ Y A L  +    AK   + +L+   + ++ N+    FS G K+++  AQ L N+P ILI+DEPTA LDPK R+ F +++ E  K  K + +S+HI+S+++  ++ + I+  G+ V T         E+  +IK       DKV K  VN  NEI Y
  S:     3 LSVERLTKQYNNKI--IVDKIDFKLNEG-IYGFLGENGAGKTTLMRMICGILSPTSGEVKVDGKNNLDMGEDFRDMIGYLPQNFGYYPDFTAKEFMLYIASLKGLMPSYAKRKTQELLEMVGLSEVINKKIRTFSGGMKQRLGFAQTLLNDPKILILDEPTAGLDPKERVRFRNLISEFSK-EKIVILSTHIVSDVEYIADKILIMKKGRFVLTGSVE-----EVTSKIK-------DKVWKCVVNE-NEIDY 238
>gi|167769606|ref|ZP_02441659.1| hypothetical protein ANACOL_00940 [Anaerotruncus colihominis DSM 17241] >gi|167667967|gb|EDS12097.1| hypothetical protein ANACOL_00940 [Anaerotruncus colihominis DSM 17241] (244 aa)
Score = 299, Expect = 2.8e-25, Identities = 70/215 (32%), Positives = 119/215 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +L++ NL K Y  KK   + NL+F V  G+   F+G NGAGKTTT+K+ +G     +G I + G     K +  + KM Y+P+N      ++   YL +   + ++ SK  K   E +   F++    N   +++S G K+K+ L  A S+ P +LI+DEP   LDP+A +   + + EL     S+  SSHIL  ++   N V+++ +G+++Y+ +
  S:     1 MLQIKNLSKSYGAKK--AVSNLSFVVEDGDIMGFIGKNGAGKTTTLKACLGIIGIDEGEILLDGTSVLKKPMACKRKMAYVPDNPQLDEYMTGLQYLNFICDIYEVPSKMRKQNFEKLASAFQVGPHLNNLISSYSHGMKQKLALIAAFSHTPKLLILDEPFVGLDPEAFVILKEQMKELCASGNSVLFSSHILDVVEKVCNKVSVIKHGQLLYSGR 215
>gi|196125821|ref|ZP_03117570.1| ABC transporter, ATP-binding protein [Clostridium difficile ATCC 43255] (288 aa)
Score = 299, Expect = 2.8e-25, Identities = 84/251 (33%), Positives = 138/251 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIY 307
           L V  L KQY  K    +D ++FK+  G  + F+G NGAGKTT ++ I G      G + + G +N ++  + R  +GY+P+N  +    ++ +++ Y A L  +    AK   + +L+   + ++ N+    FS G K+++  AQ L N+P ILI+DEPTA LDPK R+ F +++ E  K  K + +S+HI+S+++  ++ + I+  G+ V T         E+  +IK       DKV K  VN  NEI Y
  S:     3 LSVERLTKQYNNKI--IVDKIDFKLNEG-IYGFLGENGAGKTTLMRMICGILSPTSGEVKVDGKNNLDMGEDFRDMIGYLPQNFGYYPDFTAKEFMLYIASLKGLMPSYAKRKTQELLEMVGLSEVINKKIRTFSGGMKQRLGFAQTLLNDPKILILDEPTAGLDPKERVKFRNLISEFSK-EKIVILSTHIVSDVEYIADKILIMKKGRFVLTGSVE-----EVTSKIK-------DKVWKCVVNE-NEIDY 238
>gi|49486653|ref|YP_043874.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|49245096|emb|CAG43562.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. aureus MSSA476] (246 aa)
Score = 299, Expect = 2.8e-25, Identities = 70/200 (35%), Positives = 117/200 (58%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I ++NF++  GE    +G NGAGK+TTIK ++G     +GS+ IS I+ N ++E+ R K+ YIPE+      ++  +++  TA    I   EA      +LK FR+ +     P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E +   +++ +S+HIL+  + Y +   ILD G++V
  S:    12 YGKR-PVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLSISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDEAMNRVMPLLKTFRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKNEGRTVLMSTHILATAERYCDRFIILDEGEVV 212
>gi|170788355|gb|EDT29399.1| copper transport ATP-binding protein NosF [Oligotropha carboxidovorans OM5] (302 aa)
Score = 299, Expect = 2.9e-25, Identities = 71/200 (35%), Positives = 113/200 (56%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK    +  ++F +  G  +A VG NGAGKTT IK ++G  +   G+I + G D       +R  +GY+PEN  F + ++  + L + A+L ++    A      +L +  + D  ++    +S G ++++ LAQAL   P IL++DEPT  LDP  R  F+DIL EL+    ++ ISSH LSEL+  +  V I++ G +V
  S:    14 YGKIR-ALREVSFDLPAGGIYALVGHNGAGKTTLIKLMLGLIQPSGGTIRVLGEDPAAGEFSARRMLGYLPENVAFNTALTGRETLNFYARLKQLTPATA----WPLLDRVGLGDAADRRVGTYSKGMRQRLGLAQALLGRPRILLLDEPTTGLDPALRQTFYDILQELRDDGATVLISSHALSELEGRAEQVLIMNRGTLV 210
>gi|148655433|ref|YP_001275638.1| ABC transporter related [Roseiflexus sp. RS-1] >gi|148567543|gb|ABQ89688.1| ABC transporter related [Roseiflexus sp. RS-1] (334 aa)
Score = 299, Expect = 2.9e-25, Identities = 70/211 (33%), Positives = 117/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E  NL K  +G  H  +  +   V PGE  A +G NGAGKTTT++ +    R   G   ++G D   +  E R  +G + E      R+   DYL +   L  + + ++   AE +L++F +WD R +  ++FS G K+KI L +AL +NP +L +DEPT  +DP +     D + EL+   ++I +++H L+E +  ++ + I+ NG IV
  S:     1 MIEAHNLHK-IFGAFH-AVRGVTLNVDPGEVVALLGPNGAGKTTTVRMLGAILRPSSGYARVAGYDVVEQAREVRRVVGLLTEFPGLYLRMRPQDYLCFFGALQGMSAVDSARRAEQLLRQFGLWDAREKRLDSFSKGMKQKIALIRALIHNPPVLYLDEPTTAMDPHSARQVRDAMLELRAARRTILLTTHNLTEAEELADRIVIIRNGMIV 211
>gi|57650626|ref|YP_186719.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. aureus COL] >gi|87161760|ref|YP_494469.1| ABC transporter, ATP-binding protein EcsA [Staphylococcus aureus subsp. aureus USA300] >gi|88195659|ref|YP_500465.1| ABC transporter, ATP-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221940|ref|YP_001332762.1| hypothetical protein NWMN_1728 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510052|ref|YP_001575711.1| ABC transporter ATP-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727388|ref|ZP_02759665.1| ABC superfamily ATP binding cassette transporter, ABC protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57284812|gb|AAW36906.1| ABC transporter, ATP-binding protein [Staphylococcus aureus subsp. aureus COL] >gi|87127734|gb|ABD22248.1| ABC transporter, ATP-binding protein EcsA [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203217|gb|ABD31027.1| ABC transporter, ATP-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374740|dbj|BAF68000.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368861|gb|ABX29832.1| ABC superfamily ATP binding cassette transporter, ABC protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (246 aa)
Score = 299, Expect = 2.9e-25, Identities = 70/200 (35%), Positives = 117/200 (58%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I ++NF++  GE    +G NGAGK+TTIK ++G     +GS+ IS I+ N ++E+ R K+ YIPE+      ++  +++  TA    I   E    A  +LK FR+ +     P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E +   +++ +S+HIL+  + Y +   ILD G++V
  S:    12 YGKR-PVIKDINFELNKGEIVGLIGLNGAGKSTTIKHMLGLLTPMEGSLSISDININDDIEAYRRKLSYIPESPVIYEELTLEEHIEMTAMAYDIDRDETMNRAMPLLKTFRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKNEGRTVLMSTHILATAERYCDRFIILDEGEVV 212
>gi|84499788|ref|ZP_00998076.1| ABC transporter, ATP-binding protein [Oceanicola batsensis HTCC2597] >gi|84392932|gb|EAQ05143.1| ABC transporter, ATP-binding protein [Oceanicola batsensis HTCC2597] (309 aa)
Score = 299, Expect = 3.0e-25, Identities = 63/218 (28%), Positives = 120/218 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           P+L + NL+K Y G     +  ++  +  GE  A +G NGAGKTT I +I G      GS+ ++G D   +  ++R  +G +P+       +  F+ +  T  L +     +      E IL++  +WD ++      S G K+++L+A+ALS+ P +L +DEPTA +D   R D ++I+ EL+    ++ +++H + E +  S+ V ++  G+++  +++N
  S:     3 PILRISNLKKTYKGG-FEALKGVDLDIREGEILALLGPNGAGKTTLISTICGITVPTSGSVTVNGFDTLTQYRQARAMIGLVPQEI----NLEPFEKVINTVALTRGLFGKRRDDALLERILRRLSLWDKKDSRIRELSGGMKRRVLIAKALSHEPRVLFLDEPTAGVDVDLRKDMWNIVSELKAEGVTVILTTHYIEEAEAISDRVGVISEGRLLLVEEKN 219
>gi|153955436|ref|YP_001396201.1| ABC transporter ATPase [Clostridium kluyveri DSM 555] >gi|146348294|gb|EDK34830.1| Predicted ABC transporter, ATPase component [Clostridium kluyveri DSM 555] (241 aa)
Score = 299, Expect = 3.0e-25, Identities = 66/218 (30%), Positives = 127/218 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           ++E++N+ K Y  KK   +D++N  +  GE   F+G NGAGKTTT+K I G     +G I ++GI+ K+  ++++ ++GY+P+N     R+   +YL + + + ++ S       E + ++  ++D  +    ++S G ++KI+L  AL + P I ++DEP   LDPKA     +++ E     K++F S+H+L   +   + V I++ G+I+++   N+
  S:     1 MIELINVTKSY-SKKIKAVDSINLTINDGEIFGFLGHNGAGKTTTLKMITGILHPDEGDIRLNGINIKDQPIKAKMEIGYVPDNPDMFLRLKGIEYLNFMSDMYEVPSSIRNKRIEDLSRRLNLYDELDDKIQSYSHGMRQKIVLIGALIHEPPIWVLDEPMTGLDPKASFILKEMMREHTSAGKTVFFSTHVLEVAEKICDKVAIINKGRILFSGTLNE 219
>gi|27468435|ref|NP_765072.1| ABC transporter ecsA-like protein [Staphylococcus epidermidis ATCC 12228] >gi|27315982|gb|AAO05116.1|AE016749_62 ABC transporter ecsA-like protein [Staphylococcus epidermidis ATCC 12228] (246 aa)
Score = 299, Expect = 3.0e-25, Identities = 71/200 (35%), Positives = 121/200 (60%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGKK P I +LNF++  GE    +G NGAGK+TTIK ++G     +G + IS I  N+++E+ R K+ YIPE+      ++  +++  TA   ++  +EA   A+ +LK FR+ +     P++FS G K+K+++  A   +P++ I+DEP   LDP       D++ E +  ++++ +S+HIL+  + Y +   ILD G+IV
  S:    12 YGKK-PVIKDLNFELEKGEIVGLIGLNGAGKSTTIKHMLGLINPMEGKLSISNIKINEDIENYRRKLSYIPESPVIYDELTLEEHIEMTAMAYQLSREEAMRRAKPLLKVFRLENELKVFPSHFSKGMKQKVMIICAFIVDPELYIIDEPFLGLDPLGIQSMLDLMVEKRNENRTVLMSTHILATAERYCDRFIILDKGEIV 212
>gi|118048348|ref|ZP_01516958.1| ABC transporter related [Chloroflexus aggregans DSM 9485] >gi|117995155|gb|EAV09386.1| ABC transporter related [Chloroflexus aggregans DSM 9485] (337 aa)
Score = 299, Expect = 3.1e-25, Identities = 63/211 (29%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E + L KQ+       + +L   V PGE  A +G NGAGKTTT++ +        G   I G D      R +  +G + E      R+++ +YL +   L  + + + +  +E++L++F +W++R+++  +FS G ++K+ L +A+ ++P +L +DEPT  +DP++     D +GEL+   +SI +++H LSE +  ++ + I+  G+IV
  S:    22 MIEAIQLGKQF--GDFVAVRDLTLTVQPGELVALLGPNGAGKTTTVRMLAAILPPSSGQARICGYDVVRDAQRVRGMVGLLTEYPGLYGRMAALEYLAFFGALLGLDAVQCRQRSEALLRQFGLWEVRDRNLESFSKGMRQKMALIRAMIHDPPVLFLDEPTTAMDPQSARTVRDAIGELRGAKRSILLTTHNLSEAEELADRIAIIRGGQIV 232
>gi|86750255|ref|YP_486751.1| ABC transporter related [Rhodopseudomonas palustris HaA2] >gi|86573283|gb|ABD07840.1| ABC transporter related [Rhodopseudomonas palustris HaA2] (301 aa)
Score = 299, Expect = 3.1e-25, Identities = 70/208 (33%), Positives = 117/208 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE--SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + ++ K Y   +   + +++F++ PG   A VG NGAGKTT IK ++G  R   G I + G D    E   R  +GY+PEN  F + ++  + L + A+L  IK   A      + ++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL EL+    ++ ISSH L+EL+  +  V I++ G++V
  S:     7 ISDVEKSYRAVR--ALRDVSFELAPGRLSALVGHNGAGKTTLIKLMLGLIRADRGDIRVLGEDPAAGEFAGRRLLGYLPENVAFNAALTGRETLAFYARLKSIKPATA----WPLFERVGLAAAADRKVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRQTFYEILDELRDDGATVLISSHALNELEDRAEHVLIMNRGRLV 210
>gi|89211524|ref|ZP_01189885.1| ABC transporter related [Halothermothrix orenii H 168] >gi|89158862|gb|EAR78549.1| ABC transporter related [Halothermothrix orenii H 168] (239 aa)
Score = 299, Expect = 3.3e-25, Identities = 76/223 (34%), Positives = 128/223 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQ-----KRNKNENGE 278
           +L + N+ K Y GKK+  +DNL+ ++  GE   FVG NGAGKTTTI+ I G      G I I+G  I +K +E++    Y+P++      I   DYL + A + ++     +   E   + F ++D   +  N++S G K+K+L++ AL  +P++ I+DEP + LDP++     DI+    +   ++F SSHIL  ++   + V I++ GK++        KRNK++  E
  S:     1 MLILENVSKSYDGKKY-AVDNLSLEISKGEIFGFVGPNGAGKTTTIRMITGILSPTKGRITINGRDISDKPIEAKRNFTYVPDHPEIFKSIRGIDYLNFIADMYEVPVDVRRERIEKFTRDFEIYDDLTRPINSYSHGMKQKLLISGALIPDPNLFILDEPLSGLDPRSARILKDIMRYHCENGGTVFFSSHILEVVENLCDRVAIINRGKLIACDTLENIKRNKDKTLE 229
>gi|119486622|ref|ZP_01620672.1| ABC transporter-like protein [Lyngbya sp. PCC 8106] >gi|119456239|gb|EAW37371.1| ABC transporter-like protein [Lyngbya sp. PCC 8106] (315 aa)
Score = 299, Expect = 3.3e-25, Identities = 66/215 (30%), Positives = 126/215 (58%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +T+  +E   L KQ+   +H  + +L+ +V  GE +  +G NGAGKTT ++ +  +     G IYI G     D+ N   + ++GY+P++    + ++ +DYL Y A+L  ++  +       +L+  ++ + R    +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F DI+  L++   +I ISSH+LS+L+ +  ++ I++ G +V
  S:     1 MTELAIETRGLTKQF--DRHLAVSDLDLQVRVGEVYGLIGPNGAGKTTLLRMLATAEEATTGEIYIHGERLKRDHTNSSLKQRLGYLPDDFPLYNDLTVWDYLDYFARLYYLREPKRSRRLYDVLELVQLSNKRKSQISTLSRGMKQRLSLARTIIHEPLVLLLDEPVSGLDPIARMQFRDIIKSLREAGMTIIISSHVLSDLEDFCTSIGIMELGYLV 217
>gi|149197487|ref|ZP_01874538.1| ABC transporter, ATP-binding protein [Lentisphaera araneosa HTCC2155] >gi|149139505|gb|EDM27907.1| ABC transporter, ATP-binding protein [Lentisphaera araneosa HTCC2155] (319 aa)
Score = 299, Expect = 3.3e-25, Identities = 70/237 (29%), Positives = 141/237 (59%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG---IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY---TQKRNKNENGEMCYRIKLVED 288
           +++ ++ V  L++ +   K   + +++F +  G+   F+GANGAGKTTT++ I        G ++I G   ID+ N   R+K+G++P+       ++ ++YL + A+    + +E     + ++    + DL+++  +  S GQ +++ L +AL ++P++L+MDEP A LDPKAR++   ++  L +  K+IFISSHILSEL    + +  L+ G++++    ++  +     +C ++K++ D
  S:     1 MSQVMISVRGLKRSF--GKLEAVKDVSFDIQRGQVVGFIGANGAGKTTTMRMIATLETPDAGEVHICGEDAIDDPN-AVRSKIGWVPDEFGRYQNMTIYEYLDFFARAFDYRDQERLNRIQEVMDFTGVTDLKDRFIDKLSKGQGQRVCLGRALLHDPEVLLMDEPAAGLDPKARMELKSLIRILAEEGKTIFISSHILSELSEICDTMIFLEQGQVLHHGGAEELKRGAKEGVCIKVKVLND 240
>gi|22299444|ref|NP_682691.1| ABC transporter ATP-binding protein [Thermosynechococcus elongatus BP-1] >gi|22295627|dbj|BAC09453.1| ABC transporter ATP-binding protein [Thermosynechococcus elongatus BP-1] (319 aa)
Score = 299, Expect = 3.4e-25, Identities = 69/212 (32%), Positives = 125/212 (58%)
  Q:    55 PLLEVVNLRKQY-YGKKHPTI----DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKK--FRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P++ V NL+K Y  G    T+     +++ +V PGE    +G NGAGKTT +K ++G  R   GS  + G    +   R ++GY+PEN +F   ++++++L +TA L  + +   K     +L+     + D R +    +S G  +++ LAQAL N+P+++ +DEP + LDP  R    +I+  L++  K+IF +SH+L++++   + V IL  G+++
  S:    11 PVVAVENLQKSYRTGFWLQTVLTPLKSISLQVQPGETFGLLGPNGAGKTTLLKILLGLVRPSAGSGTLLGYPLGDRAVRQRIGYLPENPYFYDYLTAWEFLEFTAGLFGLSAATCKERIPLLLEMVGLNLKDARKKQMRRYSKGMVQRVGLAQALINDPEVVFLDEPMSGLDPLGRYQIREIILSLKQQGKTIFFNSHVLADVEAICDRVGILAQGELI 229
>gi|89893906|ref|YP_517393.1| hypothetical protein DSY1160 [Desulfitobacterium hafniense Y51] >gi|89333354|dbj|BAE82949.1| hypothetical protein [Desulfitobacterium hafniense Y51] (319 aa)
Score = 298, Expect = 3.6e-25, Identities = 63/214 (29%), Positives = 124/214 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++ +++  NL K Y GK      +++ +V PG  + F+G NGAGK+T +++++G      G   I G    N+++R K+GY+PE   +P  ++    L     L  +   E +   +S++++  +     +    +S G +++I LA AL ++P+++ +DEPT+ LDP  R D  D++  L+K  K++F++SH+L+E++   + V I++ GK+
  S:     5 MSEFVIQTWNLTKHYDGKA--GCSDVSLQVPPGVVYGFIGPNGAGKSTFVRTLLGLIHPTSGRAEILGHPLNNVKARAKVGYLPELFRYPDWLTGAQLLELHGDLAGVPPAERQRRIQSLVERVGLSGREQEKIRRYSKGMQQRIGLACALISDPELIFLDEPTSALDPIGRRDVRDLILALRKEGKTVFLNSHLLAEVENVCDQVAIINQGKV 216
>gi|109646531|ref|ZP_01370435.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] >gi|109641777|gb|EAT51331.1| ABC transporter related [Desulfitobacterium hafniense DCB-2] (315 aa)
Score = 298, Expect = 3.6e-25, Identities = 63/214 (29%), Positives = 124/214 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++ +++  NL K Y GK      +++ +V PG  + F+G NGAGK+T +++++G      G   I G    N+++R K+GY+PE   +P  ++    L     L  +   E +   +S++++  +     +    +S G +++I LA AL ++P+++ +DEPT+ LDP  R D  D++  L+K  K++F++SH+L+E++   + V I++ GK+
  S:     1 MSEFVIQTWNLTKHYDGKA--GCSDVSLQVPPGVVYGFIGPNGAGKSTFVRTLLGLIHPTSGRAEILGHPLNNVKARAKVGYLPELFRYPDWLTGAQLLELHGDLAGVPPAERQRRIQSLVERVGLSGREQEKIRRYSKGMQQRIGLACALISDPELIFLDEPTSALDPIGRRDVRDLILALRKEGKTVFLNSHLLAEVENVCDQVAIINQGKV 212
>gi|186903345|ref|ZP_02976281.1| ABC transporter related [Cyanothece sp. PCC 7424] >gi|186689717|gb|EDU14357.1| ABC transporter related [Cyanothece sp. PCC 7424] (319 aa)
Score = 298, Expect = 3.6e-25, Identities = 68/213 (31%), Positives = 120/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y       I +++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   K+LE R ++GY+PEN      ++   +L + A++  +   + K      +++ ++ + R       S G K+++ +A AL +NP ++I+DEPT  LDPK   +  D++  L   H ++ +S+HIL E+ +  + V I++ GK++ T
  S:     1 MIEVEHLSKIY--GSTAAIQDVDFSVEAGEIVGFLGPNGAGKTTTMRILSGYIPATTGTARIAGYDVHEKSLEVRQRIGYLPENPPLYPDMTVEGFLTFVARIKGVSRSDRKARVNWAIERCQLKEKRKVLIRKLSKGYKQRVGIAHALVHNPPVIILDEPTVGLDPKQITEVRDLIKSLAGEH-TVILSTHILPEVSMTCDRVIIINQGKVIAT 212
>gi|149175491|ref|ZP_01854112.1| ABC-type multidrug transport system, ATPase component [Planctomyces maris DSM 8797] >gi|148845759|gb|EDL60101.1| ABC-type multidrug transport system, ATPase component [Planctomyces maris DSM 8797] (255 aa)
Score = 298, Expect = 3.7e-25, Identities = 71/221 (32%), Positives = 124/221 (56%)
  Q:    47 QEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           Q +    + ++E + L K +YG+   T D + F V  G+  AF+G NGAGK+TT+K + G     +G   + G D     +E+  K+GY+PEN      ++   +L Y   +  + + E +   E +++K  +  + N+     S G ++++ +AQAL ++PDILI+DEPT+ LDP       D++ +L K  K+I +S+HIL E+    + V +++ G IV+
  S:    12 QSETSSRENMIEAIGLSK-FYGQFAATKD-VTFSVPRGQVAAFLGPNGAGKSTTMKLLTGFLSPSEGQARVGGYDVSTHRIEASQKLGYLPENGPLYEEMTPQGFLTYAGSVRGMSTAELRNRLEFVMEKCDLSSVWNKPIRKLSRGFRQRVGMAQALLHDPDILILDEPTSGLDPNQNQSVRDLIRDLGKT-KTILLSTHILQEVKAVCSRVILINQGSIVF 231
>gi|153003553|ref|YP_001377878.1| ABC transporter related [Anaeromyxobacter sp. Fw109-5] >gi|152027126|gb|ABS24894.1| ABC transporter related [Anaeromyxobacter sp. Fw109-5] (339 aa)
Score = 298, Expect = 3.8e-25, Identities = 67/213 (31%), Positives = 116/213 (54%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           T+ L +V  LR    GK+   +D+L F V  GE   FVG NGAGKTTTIK ++G      G  +I      +  S+ ++GY+PEN  +   ++    L + A L  +  +E     E +L    +    ++    +S G ++++ +AQAL  +P  +++DEP + LDP  R +  D++ EL++  K++F S+HIL +++   + V ++  GK+
  S:    28 TEGLTKVFELRP---GKRVTAVDDLTFSVQEGEIFGFVGPNGAGKTTTIKMLMGLIFPTRGRAFIFDTPIPSEASKARIGYLPENPSYHEFLTGMQALRFFATLAGVPRRERGKRCEELLGMVGLEAAADRQLRKYSKGMQQRLGIAQALVGDPAFVVLDEPMSGLDPVGRKEVRDLILELKRRGKTVFFSTHILPDVETLCDRVGVILGGKL 237
>gi|40063270|gb|AAR38088.1| ABC transporter, ATP-binding protein [uncultured marine bacterium 578] (302 aa)
Score = 298, Expect = 3.9e-25, Identities = 73/210 (34%), Positives = 113/210 (53%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L   NL K Y   K   +  ++ KV  G+F A +G+NGAGKTT I  I G  ++  G + I+G+D K   +  K  +G +P+   F     + + L   A    I   EA+  AE +LKK  +WD R     + S G K++++LA+AL + P ILI+DEPTA +D + R   +  L +L     +I +++H L E +     + IL+NG +V
  S:     5 LSTENLTKTY-SNKLKALKGVSLKVERGDFFALLGSNGAGKTTAIGIIAGLLKSTSGEVQINGLDQKAHANEVKRMIGLMPQEFNFNPHEPNIEILMNQAGYFGISRSEARTQAEVLLKKMELWDRRFDVAQSLSGGMKRRLMLARALMHKPSILILDEPTAGVDVEIRQSMWRYLTQLNNEGMTIILTTHYLEEAEALCRNIAILNNGNLV 215
>gi|67924667|ref|ZP_00518076.1| ABC transporter [Crocosphaera watsonii WH 8501] >gi|67853494|gb|EAM48844.1| ABC transporter [Crocosphaera watsonii WH 8501] (326 aa)
Score = 298, Expect = 3.9e-25, Identities = 69/219 (31%), Positives = 126/219 (57%)
  Q:    47 QEDIDLTKPLLEVVNLRKQYY-----GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESI-LKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           Q+  D   P+++  NL K Y+      +K  ++++ +F VY GE    +G NGAGKTT +K ++G  R   G   + G    NL  + K+GY+PEN ++   ++++++L + A L +I KS + +   E I L        + +    +S G  +++ +AQAL N+P+++  DEP + LDP  R    +I+  L++  K+IF +SH+L++++   + + IL  G +
  S:    10 QDTKDELMPVVQTWNLSKVYHTGFWMNQKLRSLNDCSFSVYKGETFGLLGPNGAGKTTLLKMLLGIVRPSTGRAVLLGYPVGNLSVKQKIGYLPENAYYYDYLTAWEFLEFVAGLFQIPKSVQKRRIPELIDLVGLAQKTAKKKQLRRYSKGMLQRVGMAQALINDPEVVFFDEPMSGLDPLGRYQVREIVLSLKEQGKTIFFNSHVLTDIEKICDRIAILARGDL 235
>gi|192808983|ref|ZP_03037658.1| ABC transporter related [Geobacillus sp. Y412MC10] >gi|192801654|gb|EDV78159.1| ABC transporter related [Geobacillus sp. Y412MC10] (315 aa)
Score = 298, Expect = 4.2e-25, Identities = 63/211 (29%), Positives = 120/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI--DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
            LE+ ++ K+Y  K   ++D++N +V+ GE    +G NGAGK+T+I  I G      G I I GI  + + LE + ++G +P++      +S++D + + AKL  ++    K   E  L    + D   + P+ FS G K+++ +A ++++ P ++IMDEPT  +DP++R    + +  L ++  ++  +SH + E+   S+ V I+D G ++
  S:     7 FLEMKDVVKRYGSKL--SVDHMNLEVHEGEIFGLLGPNGAGKSTSINMICGLLAKDQGIIKIDGISIEEQPLEVKRRIGLVPQDLALYEEMSAWDNVAFFAKLYGLRGHLLKERVEEALAFVGLQDRAKERPSTFSGGMKRRLNIACSITHRPKLIIMDEPTVGIDPQSRNHILESVKTLNRMGSTVIYTSHYMEEVAAISDRVAIMDQGHVI 217
>gi|42527195|ref|NP_972293.1| ABC transporter, ATP-binding protein [Treponema denticola ATCC 35405] >gi|41817619|gb|AAS12204.1| ABC transporter, ATP-binding protein [Treponema denticola ATCC 35405] (252 aa)
Score = 298, Expect = 4.2e-25, Identities = 73/233 (31%), Positives = 131/233 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT-------QKRNKNENGEMCYRIKLVED 288
           ++E+ N+ K Y   K   +D ++  V  GE   F+G NGAGKTTTIK I G      GSI + G++     +E++ ++GY+ +N    S++ + +YL +   +  + +   +   E   K F + D  N S  +FS G K+K+L+  +L ++P + I+DEP   LDPK+     +I+ E     K +F S+H++   +   + + I++ GKI++        +KR +N + E  + ++LV+D
  S:     1 MIEISNVSKAYGSSKTKAVDCISVNVKNGEIFGFLGPNGAGKTTTIKMITGVLNPDSGSIIVDGVNIAEDPMEAKRRIGYVTDNPELFSQLKAAEYLNFIGDVYGVSADVRQERIEKYTKLFGINDALNGSIGSFSHGMKQKLLVTGSLLSDPPVWILDEPMVGLDPKSAFSLKEIMRERADAGKVVFFSTHVMEVAEKLCDRLAIINAGKIMFEGSLQELREKRGENASLEKLF-LELVDD 241
>gi|153806274|ref|ZP_01958942.1| hypothetical protein BACCAC_00530 [Bacteroides caccae ATCC 43185] >gi|149130951|gb|EDM22157.1| hypothetical protein BACCAC_00530 [Bacteroides caccae ATCC 43185] (247 aa)
Score = 298, Expect = 4.2e-25, Identities = 69/208 (33%), Positives = 118/208 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           + +L KQY       +D++   +  GE    +G NGAGK+TTI  ++G      GS+ I GI++    +E + K+GY+PE+  F   ++  + L YTA+LN I  KEA+  A  ++K+  + D   +    +S G ++++ LA  L  NP+I+I+DEPT+ +DP    +F +++  L K    ++  SSH L ++    + V +  NGKI+
  S:     8 LTDLTKQY--GNFTAVDHIRLHIQKGEIFGLLGPNGAGKSTTILMMLGLTEPTSGSVEICGINSTTHPIEVKRKIGYLPEDVGFYDDMTGLENLIYTARLNGIPDKEAREKAMELMKRTGLEDQLKKKAGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGVQEFIELIRWLSKEKGLTVLFSSHHLDQVQKVCDRVGLFSNGKIL 216
>gi|126649420|ref|ZP_01721661.1| ABC transporter, ATP-binding protein EcsA [Bacillus sp. B14905] >gi|126593745|gb|EAZ87668.1| ABC transporter, ATP-binding protein EcsA [Bacillus sp. B14905] (249 aa)
Score = 298, Expect = 4.2e-25, Identities = 72/210 (34%), Positives = 114/210 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LEV ++   Y   + P I +L+F +  GE    +G NGAGK+TTIK IIG+    +G IY++G+  K    + RT   YIPE       ++  ++L  TA    I        +E +LK+FRM    N  P++FS G ++K+++  A   NP + I+DEP   LDP       D + E +K   SI +S+HILS  + + + + +L  G++
  S:     3 VLEVQHVTGGY--TRKPVIKDLSFTIEKGELVGLIGLNGAGKSTTIKHIIGTMLPKEGDIYLNGVTLKEDTDKYRTAFSYIPETPVLYDELTLREHLELTAMAYGIDKATLDARSEVLLKEFRMEKRLNWFPSHFSKGMRQKVMIMCAFLVNPSLYIIDEPFVGLDPLGIQSLLDQMDEKKKEGASILMSTHILSTAEKHCDRIILLHEGRV 212
>gi|186899996|ref|ZP_02972956.1| ABC transporter related [Cyanothece sp. PCC 7424] >gi|186692932|gb|EDU17548.1| ABC transporter related [Cyanothece sp. PCC 7424] (316 aa)
Score = 298, Expect = 4.4e-25, Identities = 67/210 (31%), Positives = 122/210 (58%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L    L KQ+  ++H  ++++  +V  GE +  +G NGAGKTT ++ +  +     G IYI+G     DN N   + ++GY+P++      ++ +DYL Y A+L  +K+   +     +L+  ++   R+   +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F +I+  LQ    +I ISSH+LS+L    ++V I++ G +V
  S:     7 LATYGLTKQF--ERHLAVNDVELQVESGEVYGLIGPNGAGKTTLLRMLAAAEEPTTGEIYINGDRLLRDNSNPRLKQRLGYLPDDFPLYDDLTVWDYLDYFARLYCLKNAHRRRRLHEVLELVQLTSKRHSLISTLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFREIIKILQAAGMTIIISSHVLSDLAELCSSVGIMELGCLV 218
>gi|168183439|ref|ZP_02618103.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] >gi|182673533|gb|EDT85494.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] (262 aa)
Score = 298, Expect = 4.4e-25, Identities = 73/228 (32%), Positives = 139/228 (60%)
  Q:    52 LTKPLLEVVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           + KP   VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K ++G  + ++G + I G  I  +N+E + K+GY+PEN      +++++Y+ +  ++  ++ KE    A+ ++  F + +  +   +++S G ++K+L+  +L +NPDIL +DEP + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     1 MDKPNDVVVSIRNLKMSYGSKE-VLKGINLDVNKGEIIGYIGPNGAGKSTTVKIMLGLVKGYEGEVKIFGNNISYENVEYKHKIGYVPENGEIYDNLTAYEYITFLGEIYGMELKEVNNKAKKLMSLFGIKEAYHSRISSYSKGMRQKLLIISSLIHNPDILFLDEPLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIGADGTFEELKKKNMEGSL 235
>gi|119720179|ref|YP_920674.1| ABC transporter related [Thermofilum pendens Hrk 5] >gi|119525299|gb|ABL78671.1| ABC transporter related [Thermofilum pendens Hrk 5] (318 aa)
Score = 297, Expect = 4.5e-25, Identities = 73/242 (30%), Positives = 124/242 (51%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN---KNENGEMCYRIKLVEDFEGDKVGKY 297
           ++EV  + K +   K   +++++F V  GE   FVG NGAGKTTTI+  +G      G ++I G  +    +E+  ++G++PE   F S   + DY  Y A        EA+     + ++  + +  N+    FS G KK+  LA +L N+P   + DE    LDP+    F  ++ E +K  K++  SSHILSE++  ++ V  +  G+IV T   +   +  +GE+   +  ++D       KY
  S:    16 MIEVRGVYKSF--GKARVLEDVSFSVRNGEVVGFVGLNGAGKTTTIRITVGVLPPDAGDVFIDGYSVSEDKVEASARVGWVPELPIFESEYRALDYFAYLAGYYGYSEGEARRLGRELFERVGIGEAANKRLEEFSQGMKKRFALAVSLINDPPNFLFDEVLNGLDPQGIAFFRGLVQEFRKAGKAVLFSSHILSEVEGLADRVVFIHRGRIVGTYTMDEIRRRASGELLVSVSPLDDGAASIAAKY 260
>gi|70726126|ref|YP_253040.1| hypothetical protein SH1125 [Staphylococcus haemolyticus JCSC1435] >gi|68446850|dbj|BAE04434.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (246 aa)
Score = 297, Expect = 4.7e-25, Identities = 68/200 (34%), Positives = 118/200 (59%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGK+ P I+++NF++  GE    +G NGAGK+TTIK ++G     +G++ IS  +   ++E  R K+ YIPE+      ++  +++  TA   ++  +EA   A  +LK FR+ +     P++FS G K+K+++  A   NP++ I+DEP   LDP       D++ E +   +++ +S+HIL+  + Y +   ILD GK+V
  S:    12 YGKR-PVIEDINFELKAGEIVGLIGLNGAGKSTTIKHMLGLLTPTEGNLSISNTEITDDIEVYRKKLSYIPESPIIYEELTLEEHIAMTAMAYQLSKEEAMKRARPLLKTFRLENELKVFPSHFSKGMKQKVMIICAFIVNPELYIIDEPFLGLDPLGIQSMLDLMVEKKNEGRTVLMSTHILATAERYCDRFIILDKGKVV 212
>gi|15789876|ref|NP_279700.1| ABC transporter, ATP-binding protein [Halobacterium sp. NRC-1] >gi|169235597|ref|YP_001688797.1| ABC-type transport system ATP-binding protein [Halobacterium salinarum R1] >gi|10580276|gb|AAG19180.1| ABC transporter, ATP-binding protein [Halobacterium sp. NRC-1] >gi|167726663|emb|CAP13449.1| ABC-type transport system ATP-binding protein [Halobacterium salinarum R1] (287 aa)
Score = 297, Expect = 4.7e-25, Identities = 70/228 (30%), Positives = 119/228 (52%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRI 283
           ++ V  L K+Y G     +D ++F V  GE    VG NGAGKT+T+K + G      G I ++G D  +   R  +G++PE +     ++   YL + A L  +    A    E+ L +  + D R++   +FS G  +K+ +A++L N+PD+L+ DEP + LDP       +   EL    K+I  S+H L  ++   + V I+ +G+   T      ++E+GE+ YR+
  S:     1 MISVQRLEKRYGGVT--AVDGVSFDVGAGEVFGLVGPNGAGKTSTLKMLCGLVEPSAGDITVNGFDAGDTAMRRTLGFLPEESPLYDEMTPRSYLRFFADLYDVDRATANERIEAALDRLDL-DARDRPVGDFSKGMTRKVAIARSLVNDPDVLVYDEPASGLDPLTTNTVIEFTRELAADGKTIVFSAHDLHHVESVCDRVAIMRDGQFAATGTLADIRDEHGEVSYRV 227
>gi|149180095|ref|ZP_01858600.1| ABC transporter, ATP-binding protein [Bacillus sp. SG-1] >gi|148852287|gb|EDL66432.1| ABC transporter, ATP-binding protein [Bacillus sp. SG-1] (310 aa)
Score = 297, Expect = 5.0e-25, Identities = 69/211 (32%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+VNL K+Y       +D++N  +  G     VG NGAGK+TT   +       +G+ Y++G D  K+ +  R ++GY+P+      +  + +YL +      + + E K     +L+   +   ++   +  S G K+++ LA+ L ++P++LI+DEP + LDP+ARI+  DIL EL+ + K+I ISSHIL EL    + + +++NGK+V
  S:     1 MIEIVNLSKKY--GSFTALDDMNLSIEKGTVFGVVGPNGAGKSTTFSILATLLAPTEGTAYVNGFDVTKDPKMVRKQIGYMPDFFGVYDQFKASEYLDFYGASYGLTAAERKALIPQLLELVNLSHKKDSYVDLLSRGMKQRLCLARCLIHDPEVLILDEPASGLDPRARIEMRDILKELKTMGKTILISSHILPELAEMCDELGVIENGKLV 211
>gi|187780200|ref|ZP_02996673.1| hypothetical protein CLOSPO_03796 [Clostridium sporogenes ATCC 15579] >gi|187773825|gb|EDU37627.1| hypothetical protein CLOSPO_03796 [Clostridium sporogenes ATCC 15579] (307 aa)
Score = 297, Expect = 5.5e-25, Identities = 77/212 (36%), Positives = 124/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D+ +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D   ++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVEKDSEKAIEKIGAMVEAPSFYGGVSGYKNLILMANLYGVPKKR----VDEVLQMVRLTDVAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRGLIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|168183040|ref|ZP_02617704.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum Bf] >gi|182673766|gb|EDT85727.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum Bf] (307 aa)
Score = 297, Expect = 5.5e-25, Identities = 77/212 (36%), Positives = 124/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVRKDSEKAIEKIGAMVEAPSFYGGLSGYKNLILMANLYGVSKKR----VDEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|114332456|ref|YP_748678.1| ABC transporter-related protein [Nitrosomonas eutropha C91] >gi|114309470|gb|ABI60713.1| ABC transporter-related protein [Nitrosomonas eutropha C91] (252 aa)
Score = 297, Expect = 5.5e-25, Identities = 69/222 (31%), Positives = 128/222 (57%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT------QKRNKN 274
           T P++E   L++ +   +H  +  +N K+  G+   F+G NGAGK+TT++ + G+     GS+ I G+D     LE++  +GY+PE       ++  +YL + A+L+ + +   ++  + + ++  + D+  +     S G ++++ +AQA+ + P ++IMDEPT  LDP        ++ EL K H +I +SSHILSE++   N V I+  G++V        ++RN N
  S:     6 TYPVIEADGLKRCF--GRHVVVHEVNLKLGCGDVLGFLGPNGAGKSTTMRMLTGNLAPDSGSVRICGVDLLKNPLEAKRYIGYLPEIPPLYKELTVDEYLQFAARLHGLANTSVQIALDEVKQQCELSDVGKRLIGILSKGYQQRVAIAQAIIHRPQLIIMDEPTVGLDPNQIQKVRALIRELGKTH-AIILSSHILSEVESVCNRVQIMHQGRLVLDDNLDNLKQRNMN 232
>gi|157690966|ref|YP_001485428.1| ABC transporter ATP-binding protein [Bacillus pumilus SAFR-032] >gi|157679724|gb|ABV60868.1| ABC superfamily ATP binding cassette transporter, ABC protein [Bacillus pumilus SAFR-032] (305 aa)
Score = 297, Expect = 5.5e-25, Identities = 66/210 (31%), Positives = 127/210 (60%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTK-MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LE   L K Y   +H  + +++F V       F+GANGAGKTTTI+ + G  R   G I ++G+D  K+++  +  +GY P++  F   ++  +++++   L  ++    +   E +LK  R+++ ++++  ++S G K+++ +AQAL N+P +LI+DEP + LDP  R D   ++  L K    IF+S+HIL +++  ++ + ++++GKI
  S:     3 MLECHGLTKSY--GRHEVLKDVSFSVGEVGCVGFLGANGAGKTTTIRILTGLARPTSGVIKVAGMDVTKDMDDISHVIGYCPQHPAFYQDMTGQEWMHWVGGLFHLEKNTIRSKTEELLKLCRVYEAKDRAIGSYSGGMKQRLAIAQALINSPKVLILDEPVSALDPMGRKDILTLIERL-KHEMLIFMSTHILDDIERVADHIIMINSGKI 211
>gi|114567238|ref|YP_754392.1| ABC transporter ATP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338173|gb|ABI69021.1| ABC transporter ATP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (308 aa)
Score = 297, Expect = 5.6e-25, Identities = 89/287 (31%), Positives = 155/287 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYE---VNSNNEIIYEF-------------KDKNELAELIDKLISKEI-LVKFEKYYLSIEDLY 342
           +L+V  L K Y   K   +D L+F V  G    FVG NGAGKTTT+K +    R   G  +I+G  +       R  +GY+P+       +   +YL + +   +I +++ +     +L+   +   R    ++ S G K+++ LA+ L ++P +LI+DEP + LDP+AR++  +IL EL+ + K+I ISSHILSEL      + I++ GK+V     +     E+ +R +  +  E   +GK +   +  NNE+ Y                D+ E+  ++  L+   I LV F +   ++E+++
  S:     1 MLQVEELSKSY--GKFLAVDRLSFNVEEGAIFGFVGPNGAGKTTTMKILASLLRPSSGKAWIAGENVSQNPRRIRQLVGYMPDFFGVYDDLKVDEYLDFYSASYRIPARQREKIISDLLELMDLEHKREAYVDSLSRGMKQRLCLARCLVHDPALLILDEPASGLDPRARVEVREILKELKNMGKTIIISSHILSELTELCTHLGIIEAGKMVACGSVD-----EIMHRSQSAQAIEIRVLGKIDEALLLINNELGYSAIKLDEQMLELPFNGDEEEMNRILTHLVQAGIPLVSFAESQSNLENIF 299
>gi|169827876|ref|YP_001698034.1| ABC transporter ATP-binding protein [Lysinibacillus sphaericus C3-41] >gi|168992364|gb|ACA39904.1| ABC transporter (ATP-binding protein) [Lysinibacillus sphaericus C3-41] (306 aa)
Score = 297, Expect = 5.8e-25, Identities = 74/215 (34%), Positives = 129/215 (60%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +T+P++++ NL K   GK+   I  LN  +YPG+   F+G NGAGKTTTI+ + G     +G + I G+  +    E+ +K+G I EN      +S +  L + A+++K  SKE  +    ++K+  + +  ++    +S G ++++ LAQAL + P  LI+DEPT  LDP    +F   L ++  + + S+F+SSH+LSE++L  + V ++ NGK++
  S:     1 MTEPIVQLQNLSKTIRGKQ--LIQQLNIDLYPGQITGFLGPNGAGKTTTIRMMTGLMHPTEGKVIIDGLSLQEHYEEAISKVGVIVENPEMYKFMSGYKNLLHFARMHKNVSKERIM---EVVKQVGLENRIHEKVATYSLGMRQRLGLAQALLHRPKFLILDEPTNGLDPAGIREFRMYLRKIAAEDNVSVFVSSHLLSEIELMCDRVAVIQNGKLI 213
>gi|182415990|ref|YP_001821056.1| ABC transporter related [Opitutus terrae PB90-1] >gi|177843204|gb|ACB77456.1| ABC transporter related [Opitutus terrae PB90-1] (240 aa)
Score = 296, Expect = 5.9e-25, Identities = 68/211 (32%), Positives = 124/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFA-ESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV  L K Y  K+   ++ ++F V  G+   F+G NGAGK+TT+K I G  R   G+  + GID     +  ++K+GY+PE+      ++  ++L + A++   ++K+A+  A E ++    +  +R Q+    S G K+++  AQAL ++P +L++DEPT  LDP  + +   ++ ++    K++ +S+HIL E+D   N V I+  G+IV
  S:     1 MIEVKGLVKTYGTKR--AVNGVSFSVRRGDILGFLGPNGAGKSTTMKLITGFLRPNAGTAMVDGIDVTLDPVAVKSKLGYLPESAPAYPEMTVEEFLGFIAEVRGFRAKDARQAAVERVIALTHLVSVRKQTIETLSKGYKQRVGFAQALLHDPPVLVLDEPTDGLDPNQKNEVRALIKKMAA-EKAVILSTHILEEVDAICNRVIIISEGRIV 211
>gi|147920700|ref|YP_685497.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110620893|emb|CAJ36171.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (311 aa)
Score = 296, Expect = 6.5e-25, Identities = 64/210 (30%), Positives = 125/210 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++E  +L + Y   +   ++NL+F V  GE   F+G NGAGK+TT+K ++G  +   G+  ++G D  +  LE R   G +P+   F    +++  L +  KL  I+ KE +   +  L K  + D +++  + FS G K+++ +AQ + ++P +++ DEPTA +DP+   DF +++ E++   K+IF++SH++ E++   + + I+ NG++
  S:     1 MIETQSLTRLY--DQKAVVNNLSFSVGAGEIFGFLGPNGAGKSTTMKMLLGLVQPTSGTGKVAGHDIIHDVLEVRKACGVLPDPYGFYENQTAWQNLEFYCKLYGIRGKELEEKVDKTLDKVGLHDAKHKKVHKFSKGMKQRLGVAQVIVHDPPVMMFDEPTAGIDPQGAEDFRNLMLEMKAKGKTIFLTSHVMPEVEAICDRIGIIVNGEM 210
>gi|196258529|ref|ZP_03157063.1| ABC transporter related [Cyanothece sp. PCC 7822] >gi|196200443|gb|EDX95264.1| ABC transporter related [Cyanothece sp. PCC 7822] (316 aa)
Score = 296, Expect = 6.8e-25, Identities = 66/213 (30%), Positives = 121/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y       I +++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   ++++ R  +GY+PEN      ++   +L + A++  + + E K   +  +K+ ++ + R       S G K+++ +A A+ +NP ++I+DEPT  LDPK   +  D++  L   H ++ +S+HIL E+ +  + V I++ GK++ T
  S:     1 MIEVEHLSKIY--GSTAAIQDVDFSVQAGEIVGFLGPNGAGKTTTMRILSGYIPATTGTARIAGYDVHEQSMQVRRSIGYLPENPPLYPEMTVEAFLDFVARIKGVAAGERKTRVDWAIKRCQLTEKRKVIIRKLSKGYKQRVGIAHAIVHNPPVIILDEPTVGLDPKQITEVRDLIKSLAGEH-TVILSTHILPEVSMTCDRVIIINKGKVIVT 212
>gi|159901091|ref|YP_001547338.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] >gi|159894130|gb|ABX07210.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] (300 aa)
Score = 296, Expect = 7.0e-25, Identities = 70/211 (33%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSP-NNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++  NL K Y   K+  ID+LN  V  GE   ++G NGAGKTTTI++I+   R   G+  I G+D++  ++    K+ Y+P       +++  + L+Y  +L   +  +E K  AE +       +L  + P    S G K+K+ L QA    P++LI+DEPT+ LDP  +  F+ ++ E +   +++F+SSH++SE+D   + V I+  GK++
  S:     4 VVQTTNLTKTY--GKNRGIDSLNLHVQQGEVFGYLGPNGAGKTTTIRTILDFIRPTSGTAQIFGLDSQRDSVVIHQKISYLPGELVMYEKMTGMEMLHYFGQLRGNVSQQEIKQLAERL-------ELDLKRPIRTLSKGNKQKVGLVQAFMGKPELLILDEPTSGLDPLVQQTFYQLVLEAKATGRTVFLSSHVMSEVDHICDRVGIIRAGKLL 209
>gi|75909173|ref|YP_323469.1| ABC transporter-like [Anabaena variabilis ATCC 29413] >gi|75702898|gb|ABA22574.1| ABC transporter-like [Anabaena variabilis ATCC 29413] (316 aa)
Score = 296, Expect = 7.0e-25, Identities = 64/205 (31%), Positives = 119/205 (58%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+  ++H  +++++ ++  GE +  +G NGAGKTT I+ +  +     G IYI+G    +D  N   +  +GY+P++      ++ +DYL Y A+L +++          +L+  ++ + R    +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F  I+  LQ+   +I ISSH+LS+L     +V I++ G +V
  S:    12 LTKQF--ERHIAVNDVDLEIQMGEVYGLIGPNGAGKTTLIRMLAAAEEQTTGEIYINGEHLRLDKSNSTLKRHLGYLPDDYPLYEDLTVWDYLDYFARLYRLREPRRTQRLHEVLELIQLENKRKSQISTLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFRQIIKALQEAGMTILISSHVLSDLAELCTSVGIMELGFLV 218
>gi|186901147|ref|ZP_02974101.1| ABC transporter related [Cyanothece sp. PCC 7424] >gi|186691954|gb|EDU16576.1| ABC transporter related [Cyanothece sp. PCC 7424] (326 aa)
Score = 296, Expect = 7.0e-25, Identities = 71/212 (33%), Positives = 124/212 (58%)
  Q:    55 PLLEVVNLRKQYYGK--KHPTIDNL---NFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESI-LKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P+++  NLRK Y      + TI++L   +  VY GE    +G NGAGKTT +K ++G  R   G   + G    +   + ++GY+PEN +F   ++ +++L + A + +I +S + K   E + L        + +    +S G +++I +AQAL N+P+++ +DEP + LDP  R    +I+  LQK  K+IF +SHILS+++   + + IL  G+I+
  S:    18 PVVQTWNLRKVYRTGFWLNQTIESLKACDLSVYQGETFGLLGPNGAGKTTLLKMLLGIVRPTSGKAVLLGRPIGDRACKQRIGYLPENAYFYDFLTGWEFLEFIAGVFQIPRSVQKKRIPELLDLVGLATSAAKKKQMRQYSKGMQQRIGMAQALINDPELVFLDEPMSGLDPLGRYQVREIIVSLQKQGKTIFFNSHILSDVEQICDRIAILARGEII 236
>gi|191636944|ref|YP_001986110.1| ABC transporter related precursor [Lactobacillus casei] >gi|190711246|emb|CAQ65252.1| ABC transporter related precursor [Lactobacillus casei BL23] (309 aa)
Score = 296, Expect = 7.1e-25, Identities = 67/201 (33%), Positives = 119/201 (59%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++G K   + +LN  V  G  + FVG NGAGKTTT+K I+G  +   G+I ++G  +     E+  + GY+P+   F   +++ +YL    +L  ++  E +    ++L +  + D +++  + FS G ++++ +AQAL N P +LI DEPT+ LDP+ R DF  +L  L+    +I  S+HILS+++   + V IL +G++
  S:    11 KHFGSKQ-VLQDLNLTVPAGSIYGFVGENGAGKTTTMKLILGLDQASAGAIEVAGQPVHFGETETNRQTGYLPDVPAFYGYMTAPEYLKLCGQLTGLRGAELQSRVAAMLIQVGLADAKHRI-SGFSRGMRQRLGIAQALLNTPKLLICDEPTSALDPQGRTDFLQLLASLRG-QTTILFSTHILSDVERICDHVGILHHGRL 210
>gi|116493701|ref|YP_805435.1| ABC-type multidrug transport system, ATPase component [Lactobacillus casei ATCC 334] >gi|116103851|gb|ABJ68993.1| ABC-type multidrug transport system, ATPase component [Lactobacillus casei ATCC 334] (308 aa)
Score = 296, Expect = 7.1e-25, Identities = 67/201 (33%), Positives = 119/201 (59%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++G K   + +LN  V  G  + FVG NGAGKTTT+K I+G  +   G+I ++G  +     E+  + GY+P+   F   +++ +YL    +L  ++  E +    ++L +  + D +++  + FS G ++++ +AQAL N P +LI DEPT+ LDP+ R DF  +L  L+    +I  S+HILS+++   + V IL +G++
  S:    11 KHFGSKQ-VLQDLNLTVPAGSIYGFVGENGAGKTTTMKLILGLDQASAGAIEVAGQPVHFGETETNRQTGYLPDVPAFYGYMTAPEYLKLCGQLTGLRGAELQSRVAAMLIQVGLADAKHRI-SGFSRGMRQRLGIAQALLNTPKLLICDEPTSALDPQGRTDFLQLLASLRG-QTTILFSTHILSDVERICDHVGILHHGRL 210
>gi|182411912|ref|YP_001816978.1| ABC transporter related [Opitutus terrae PB90-1] >gi|177839126|gb|ACB73378.1| ABC transporter related [Opitutus terrae PB90-1] (341 aa)
Score = 296, Expect = 7.2e-25, Identities = 66/212 (31%), Positives = 121/212 (57%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P +EV +L K Y G     + ++ F V  GE   F+G NGAGK+TT++ + G      GS+ I G  + ++  E + ++GY+PEN   P  +   +YLY+  +L +I  ++     + +L+   +  +R++     S G ++++ +A+A+   P ++IMDEPT  LDP   +   D++  L+    ++ ISSHIL E+++  + V I++ G++V
  S:     5 PAIEVSHLFKTYAGVA--AVSDITFTVARGEILGFLGPNGAGKSTTMRILTGYLPATSGSVTICGLPVASQPDEVKRRIGYMPENNPLPEDMRVSEYLYFRGRLKEIPRRKLGPRIDEVLEVCDLKRVRHKIIGKLSKGFRQRVGIAEAILAEPPVIIMDEPTIGLDPHQILIVRDLIASLRG-RMTVIISSHILPEIEVTCDRVLIINQGRVV 215
>gi|114567549|ref|YP_754703.1| ABC transporter ATP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338484|gb|ABI69332.1| ABC transporter ATP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (242 aa)
Score = 296, Expect = 7.6e-25, Identities = 64/212 (30%), Positives = 121/212 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E+  + K Y   +   +D+++  V  GE   F+G NGAGKTT IK I G      GSI I+G D K+  LE++ +  ++P++    SR++  +YL + A + ++ S+      + +L++F M         ++S G K+KI++  AL +NP + I+DEP   LDP++  D  +++ E     K++F S+H+L   +   + + I++ G++++
  S:     1 MIEICGVSKSYNRGQVKAVDDVSLTVQDGEIFGFLGPNGAGKTTLIKMITGILNADRGSIKINGRDIKDSPLEAKMQFSFVPDDPNIFSRLTGIEYLNFMADVYQVSSEIRVERIQKLLERFEMSTAAADLIQSYSHGMKQKIVVIGALLHNPPVWILDEPMTGLDPRSSYDLKEMMREHADAGKTVFFSTHVLEVAEKVCDRLAIINKGRMIF 214
>gi|160933580|ref|ZP_02080968.1| hypothetical protein CLOLEP_02434 [Clostridium leptum DSM 753] >gi|156867457|gb|EDO60829.1| hypothetical protein CLOLEP_02434 [Clostridium leptum DSM 753] (362 aa)
Score = 295, Expect = 7.6e-25, Identities = 72/211 (34%), Positives = 125/211 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV NL+K+Y  K    +++++F V  GE   F+G NGAGK+TT+  I G   + +G++ I G  I    + +++K+GY+PE       ++   YL +   L K+K  +    AE +    ++  ++++   N S G K+++ LAQAL  NP++LI+DEPT  LDPK  I+  +++  L K H ++ +SSH+L E+    + V +++ G IV
  S:     1 MIEVKNLKKRYGNKL--AVNDVSFTVENGEILGFLGPNGAGKSTTMNIITGYLSSTEGTVTIDGCEILEDPIGAKSKIGYLPEFPPLYPDMTVIKYLEFMYDLKKVKLPKKAHIAE-VCDLVKITHVKDRVIKNLSKGYKQRVGLAQALLGNPELLILDEPTVGLDPKQIIEIRNLIKSLGKKH-TVILSSHVLPEVQATCDRVIVINKGSIV 209
>gi|147920227|ref|YP_686006.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110621402|emb|CAJ36680.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (316 aa)
Score = 295, Expect = 7.9e-25, Identities = 65/214 (30%), Positives = 125/214 (58%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           + + ++E  NL K Y   +   ++NL+F V  GE   F+G NGAGK+TT+K ++G  +   G+  ++G D  +  LE R   G +P+   F    +++  L +  +L  I  KE +      L K  + D +++  + FS G K+++ +AQ + ++P +++ DEPTA +DP+   DF +++ E++   K+IF++SH++ E++   + + I+ NG++
  S:     1 MGQAVIETQNLTKLY--DQKAVVNNLSFTVDAGEIFGFLGPNGAGKSTTMKMLLGLVQPTSGTGKVAGHDIIHDVLEVRKACGVLPDPYGFYENQTAWQNLKFYCELYDIHGKELEEKVNKTLDKVGLHDAKHKKVHKFSKGMKQRLGVAQVIVHDPQVMMFDEPTAGIDPQGAEDFRNLMLEMKAKGKTIFLTSHVMPEVEAICDRIGIIVNGEM 214
>gi|163762879|ref|ZP_02169943.1| response regulator receiver protein [Bacillus selenitireducens MLS10] >gi|160356812|gb|EDP83461.1| response regulator receiver protein [Bacillus selenitireducens MLS10] (248 aa)
Score = 295, Expect = 8.3e-25, Identities = 67/211 (31%), Positives = 112/211 (53%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LLE+  L   Y  K  P + ++ F V+P E    +G NGAGK+TTIK I+G      G+I ++G  +       R ++ YIPE       ++ +++L  TA    I  KE    AE++LK++RM  ++   P+ FS G ++K+++  A    P + + DEP   LDP     F D +  L++    I +S+HIL+  + Y +    L +G+++
  S:     4 LLEIEGLTGGYQ-KNRPVLHDVGFTVHPNEMVGLIGLNGAGKSTTIKHILGLMDPHSGTIRLNGKSVSEDVKGFRQELAYIPEMPMLYEELTLWEHLELTAMAYGISEKEMTQRAEALLKEYRMTKMKQWFPSQFSKGMRQKVMIMCAFMVEPQLYVADEPFVGLDPIGIKSFLDRMVALREEGCGILMSTHILATAERYCDRFIFLHHGRMI 215
>gi|186683085|ref|YP_001866281.1| ABC transporter related [Nostoc punctiforme PCC 73102] >gi|186465537|gb|ACC81338.1| ABC transporter related [Nostoc punctiforme PCC 73102] (326 aa)
Score = 295, Expect = 8.9e-25, Identities = 63/205 (30%), Positives = 121/205 (59%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+   +H  +++++ ++  GE +  +G NGAGKTT I+ +  +     G IYI+G     D  N + + ++GY+P++      ++ +DYL Y A+L +++          +L+  ++ + R+   +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F +I+  LQ+   ++ ISSH+LS+L     +V I++ G +V
  S:    22 LTKQF--DRHVAVNDVDLEIQAGEVYGLIGPNGAGKTTLIRMLATAEEPTTGEIYINGDRLLRDKSNPKLKRRLGYLPDDYPLYEDLTVWDYLDYFARLYRLREPRRTQRLHEVLELIQLGNKRHSQISTLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMHFREIIKALQEAGMTVIISSHVLSDLAELCTSVGIMELGFLV 228
>gi|116749190|ref|YP_845877.1| ABC transporter related [Syntrophobacter fumaroxidans MPOB] >gi|116698254|gb|ABK17442.1| ABC transporter related [Syntrophobacter fumaroxidans MPOB] (316 aa)
Score = 295, Expect = 9.4e-25, Identities = 71/213 (33%), Positives = 122/213 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++E   L K +YG   P I +++F+V  GE   F+G NGAGK+TTI+ +        G+  ++G+D   K+LE R  +GY+PE+      ++   +L + A   K++++  K   + ++    +  + N+   + S G ++++ LAQAL NNP +L++DEPT  LDP   I+   ++ EL   H +I +SSHIL E+      V I++ G+I+ T
  S:     1 MIEAEGLTK-FYGSL-PAIRDVSFQVEKGEVVGFLGPNGAGKSTTIRILTCYMPPTTGAARVNGLDCFEKSLEVRRVVGYLPESVPLYGEMTVTRFLRFAAAAKKVEARAIKKEIDRVVDVCALEKVSNRIIGHLSKGYRQRVGLAQALLNNPPVLVLDEPTIGLDPGQIIEIRKLIQELGGEH-TILLSSHILPEVAQICQRVMIINKGQIIAT 212
>gi|196180371|gb|EDX75362.1| ABC transporter, ATP-binding protein [Microcoleus chthonoplastes PCC 7420] (288 aa)
Score = 295, Expect = 9.6e-25, Identities = 67/212 (31%), Positives = 122/212 (57%)
  Q:    55 PLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESI-LKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P++    LRK Y       +K  ++ N +  V PGE    +G NGAGKTT +K ++G  R   G  ++ G    +   + ++GY+PEN +F   ++ +++L  TA L +I KS++ +   + + L        + +    +S G  ++I +AQAL N+PD++ +DEP + LDP  R    +I+  L++  K+IF +SH+LS+++   + + IL  G+++
  S:    18 PVVATSELRKVYRTGFWLNQKIESLTNCSLSVAPGETFGLLGPNGAGKTTLLKILLGIVRPTSGRGWLMGKPIGDRGVKQRIGYLPENPYFYDYLTGWEFLQLTAGLFQIPKSRQRQRIPQLLELVGLSKSAAKKKQLRQYSKGMLQRIGMAQALINDPDVVFLDEPMSGLDPMGRYQIREIILSLKEQGKTIFFNSHVLSDVEKICDRIAILAQGELI 236
>gi|57867303|ref|YP_188941.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis RP62A] >gi|57637961|gb|AAW54749.1| ABC transporter, ATP-binding protein [Staphylococcus epidermidis RP62A] (246 aa)
Score = 295, Expect = 9.9e-25, Identities = 70/200 (35%), Positives = 121/200 (60%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YGKK P I +LNF++  GE    +G NGAGK+TTIK ++G     +G + IS I  N+++E+ R K+ YIPE+      ++  +++  TA   ++  +EA   A+ +LK FR+ +     P++FS G K+K+++  A   +P++ I+DEP   LDP       D++ E +  ++++ +S+HIL+  + Y +   IL+ G+IV
  S:    12 YGKK-PVIKDLNFELEKGEIVGLIGLNGAGKSTTIKHMLGLINPMEGKLSISNIKINEDIENYRRKLSYIPESPVIYDELTLEEHIEMTAMAYQLSREEAMRRAKPLLKVFRLENELKVFPSHFSKGMKQKVMIICAFIVDPELYIIDEPFLGLDPLGIQSMLDLMVEKRNENRTVLMSTHILATAERYCDRFIILEKGEIV 212
>gi|73669964|ref|YP_305979.1| ATP-binding protein [Methanosarcina barkeri str. Fusaro] >gi|72397126|gb|AAZ71399.1| ATP-binding protein [Methanosarcina barkeri str. Fusaro] (318 aa)
Score = 294, Expect = 1.0e-24, Identities = 66/210 (31%), Positives = 125/210 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +EV +L K++       +++++F V  GE   F+G NGAGKTTTI+ + G  R   G+  I G  I++  + +R  MG + EN+     ++++  + ++A+L  +  KE +  A  +LKKF +++ RN   + FS G K+++ LA  L N+P +L +DEPT+ LD ++ +   +++ +L     ++F+++H + E ++  + V I++ G IV
  S:     4 IEVSHLIKKF--GSLTALNDISFSVGEGETFGFLGPNGAGKTTTIRILTGVSRPTSGTATIFGHDIEHDTIAARQSMGIVSENSNVYDDLTAWQNMMFSAELYHVGRKEREKKANELLKKFELYERRNDKAHGFSKGMKRRLTLAMGLVNSPRLLFLDEPTSGLDVQSNLIIREVVDDLVLEGVTVFLTTHNIEEANVMCDRVAIINKGYIV 213
>gi|115713716|ref|XP_001184310.1| PREDICTED: similar to ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus] >gi|115767844|ref|XP_790915.2| PREDICTED: similar to ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus] (624 aa)
Score = 294, Expect = 1.0e-24, Identities = 69/225 (30%), Positives = 117/225 (52%)
  Q:    40 ERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           E  I V+  D   +K  + + NL K Y GK+ P +D L+  +  GE    +G NGAGKTTT   + G  R   G+ Y+ G D   +  + + ++GY P+      R++  + L   A+L  I S +     +  +    +   +++    +S G K+K+  A AL  NP I+++DEPT+ +DPKAR   +D L  + +  +SI ++SH + E +     + I+ NG+
  S:   287 EEKILVDNTDPHDSKYAVIIKNLAKVYRGKRTPAVDKLSVTIPKGECFGLLGVNGAGKTTTFGMLTGDVRMSAGTAYMGGYDIQTQRRKVQQRIGYCPQFDALVERLTGREVLMLFARLRGIPSNQMISVVDHTIDHLNLNKWQDKLCGTYSGGNKRKLSTAVALVGNPPIVLLDEPTSGMDPKARRYLWDSLTSIMEGGRSIILTSHSMEECEALCTRLAIMVNGQ 513
>gi|81428549|ref|YP_395549.1| putative drug ABC exporter, ATP-binding subunit [Lactobacillus sakei subsp. sakei 23K] >gi|78610191|emb|CAI55240.1| Putative drug ABC exporter, ATP-binding subunit [Lactobacillus sakei subsp. sakei 23K] (313 aa)
Score = 294, Expect = 1.0e-24, Identities = 62/218 (28%), Positives = 124/218 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           ++EV N++K++  KK   + +++F V  GE    +G NGAGKTT +K +    R  +G I ++G +  +++ ++R +     +       +S+ D L    +LN + S+ +++ A+ +L  F +  L NQ+   FS G ++++ LA +L   P IL +DEPT  LDP+ RI  +  +  L     ++F+++  L E D +++ + ++D+G+++ +   N+
  S:     6 VIEVRNVQKKFGQKK--VVQDISFNVKKGEIFGLLGPNGAGKTTLLKMMTTLLRPDEGQITLNGFNTLSQSRQARQQFSVTNQTAAIDQDLSARDNLRLFGRLNGLSSQASRIRADELLTAFDLTQLANQALATFSGGMRRRLDLAVSLVGRPKILFLDEPTTGLDPRTRIQMWQAIQALVAQGSTVFLTTQYLEEADQFADHIALIDHGQLIASGTPNE 223
>gi|160892077|ref|ZP_02073080.1| hypothetical protein BACUNI_04539 [Bacteroides uniformis ATCC 8492] >gi|156858555|gb|EDO51986.1| hypothetical protein BACUNI_04539 [Bacteroides uniformis ATCC 8492] (247 aa)
Score = 294, Expect = 1.0e-24, Identities = 67/211 (31%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ + +L KQY   +   +D +   +  GE    +G NGAGK+TTI  ++G      GS+ I GID+    +E + K+GY+PE+  F   ++  + L YTA+LN I   EAK+ A  +++   +     +    +S G ++++ LA  L  NP+I+I+DEPT+ +DP    +F +++ +L +K   ++  SSH L ++    + V + ++GK+V
  S:     5 VIALTDLTKQY--GRFTAVDRICLTIRKGEIFGLLGPNGAGKSTTILMMLGLTEPTSGSVEICGIDSTRHPIEVKRKIGYLPEDVGFYDDMTGSENLIYTARLNGISDAEAKVKALELMEHVGLAGQMKKKTGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGVQEFIELIRQLSRKEGLTVLFSSHHLDQVQKVCDRVGLFNSGKLV 216
>gi|154340914|ref|XP_001566410.1| ABC transporter, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134063733|emb|CAM39919.1| ABC transporter, putative [Leishmania braziliensis] (1867 aa)
Score = 294, Expect = 1.0e-24, Identities = 69/216 (31%), Positives = 119/216 (55%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSN--AVTILDNGKIVYTQKRNKN 274
           V +L K+Y G  H  + N++  V  GE    +G NGAGKTT +  + G      G ++++    +++ESR+ +GY P+     S +S+ ++L+  A+L  IK K  K     +LK+  ++  RNQS  + S G K+++ LA AL  +   +++DEPT+ +D  AR    DIL  L    KS+ +++H L E++  ++  A  +  N + + T +  KN
  S:  1542 VQHLNKRYIGASHAAVHNISLGVKRGEVMGLLGLNGAGKTTVVSILAGEEVATAGEVFVNHHPVQSIESRSFVGYCPQYEALLSNLSAEEHLWLYARLRSIKEKHIKAEVHMLLKELGLYPFRNQSAASLSGGNKRRLSLAIALVGHTKSVLLDEPTSGMDAVARAQTCDILRRLAA-DKSVVLTTHRLDEVEALADRAAFVVRGNLRCIGTPQELKN 1758
Score = 247, Expect = 3.5e-19, Identities = 54/196 (27%), Positives = 103/196 (52%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           G +   +D + F +  GE    +G NGAGK+T +    G      G +++ G D +    E R  +GY P+     S ++  +++ + A++    S   +   E +L    + + R+   +  SSGQ++++ +A A+  +  +L +DEPT+ +D K R   +D L    ++H+S+ IS+H+L E D  ++ V I++ G
  S:   682 GDRIVALDGVTFAMRTGEVSVLLGPNGAGKSTIMGMATGMVNPTSGDVFVRGYDARTHLDECRQSIGYCPQRDIVWSLLTVEEHITFYARMKGSNSVNVQDKVEYVLDLVDLQEKRHCKASKLSSGQRRRLCVAIAMVGDSSVLFLDEPTSGMDIKGRKIVYDALNR-TRVHRSVLISTHLLDEADRIADRVLIINKG 878
>gi|126650794|ref|ZP_01723010.1| YhcH [Bacillus sp. B14905] >gi|126592459|gb|EAZ86477.1| YhcH [Bacillus sp. B14905] (306 aa)
Score = 294, Expect = 1.0e-24, Identities = 73/215 (33%), Positives = 129/215 (60%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +T+P++++ NL K   GK+   I  LN  +YPG+   F+G NGAGKTTTI+ + G     +G + I G+  +    E+ +K+G I EN      +S +  L + A+++K  +KE  +    ++K+  + +  ++    +S G ++++ LAQAL + P  LI+DEPT  LDP    +F   L ++  + + S+F+SSH+LSE++L  + V ++ NGK++
  S:     1 MTEPIVQLQNLSKTIRGKQ--LIQQLNIDLYPGQITGFLGPNGAGKTTTIRMMTGLMHPTEGKVIIDGLSLQEHYEEAISKVGVIVENPEMYKFMSGYKNLLHFARMHKNVTKERIM---EVVKQVGLENRIHEKVATYSLGMRQRLGLAQALLHRPKFLILDEPTNGLDPAGIREFRMYLRKIAAEDNVSVFVSSHLLSEIELMCDRVAVIQNGKLI 213
>gi|153939257|ref|YP_001390132.1| ABC transporter, ATP-binding protein [Clostridium botulinum F str. Langeland] >gi|152935153|gb|ABS40651.1| ABC transporter, ATP-binding protein [Clostridium botulinum F str. Langeland] (262 aa)
Score = 294, Expect = 1.1e-24, Identities = 71/221 (32%), Positives = 136/221 (61%)
  Q:    59 VVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K I+G  + ++G + I G  I  +N+E + K+GY+PEN      +++++Y+ +  ++  +K ++    A+ ++  F + +  +   +++S G ++K+L+  +L +NPDIL +DEP + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     8 VVSIRNLKMSYGSKE-VLKGINLDVNKGEIIGYIGPNGAGKSTTVKIILGLVKGYEGEVKILGNNISYENVEYKHKIGYVPENGEIYDNLTAYEYITFLGEIYGMKLEDVNNKAKKLMSLFGIEEAYHSRISSYSKGMRQKLLIISSLIHNPDILFLDEPLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIAADGTFEELKKKNMEGSL 235
>gi|91773667|ref|YP_566359.1| ABC transporter, ATPase subunit [Methanococcoides burtonii DSM 6242] >gi|91712682|gb|ABE52609.1| ABC transporter, ATPase subunit [Methanococcoides burtonii DSM 6242] (305 aa)
Score = 294, Expect = 1.1e-24, Identities = 88/290 (30%), Positives = 152/290 (52%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV-------YTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEKYYLSIEDLYKK 344
           P++   ++RK++   +   +D++ F V  GE   F+G NGAGKTTT++ I        G++ + G+D  +   E + KMG +P+        + ++ L+  ++   I   EAK   E +LK   + + R+    + S G K++++LA++L N P +LI+DEPT  LDP++R   +D L  L+K   +I +++H L E     + + I+DNGKI+         QK   +   E      ++   EG K   YEV  +N  IY     + L E  D ++S+  L        ++ED++ K
  S:     6 PVIAGKDVRKEF--GEFTAVDSVAFSVNEGELFGFLGPNGAGKTTTMRLIQCISPMTSGTLEVFGMDVNSHQREIKFKMGVVPQENNLDPDFTVYENLFVFSRYFDIPEDEAKKRVEELLKFVHLEEKRDTMTESLSGGMKRRLVLARSLINKPRLLILDEPTVGLDPQSRHLMWDKLKGLKKQGVTIVLTTHYLEEASQLCDRLVIMDNGKILVEGSPTDLIQKYIGSAIVETENDPAILSCLEGHK-ATYEVLGDNVQIY----TDNLQETTDHILSECKLKSVTARAATLEDVFLK 297
>gi|196188868|gb|EDX83832.1| ABC transporter, ATP-binding protein [Synechococcus sp. PCC 7335] (349 aa)
Score = 294, Expect = 1.1e-24, Identities = 65/213 (30%), Positives = 121/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV  L K Y       I ++ F+V PGE   F+G NGAGKTTT++ + G      G+  ++G D   +++  R ++GY+PE       ++   +L++ A++  + + +      S + +  + + R       S G K+++ +AQA+ +NP ++++DEPT  LDPK  ID  +++  L   H +I +S+HIL E+ +  + +TI++ G+I+ T
  S:     1 MIEVEKLSKAY--GSTLAIKDVTFEVAPGEILGFLGPNGAGKTTTMRILTGYLPATGGTARVAGKDVHTESMAVRQRIGYLPEAPPLYPEMTVEGFLHFVARIKGMSAGDRPSKVSSAIVRCNLEEKRQVMIRKLSKGFKQRVGIAQAIVHNPPVIVLDEPTVGLDPKQIIDVRNLIKSLAGEH-TIILSTHILPEVSMTCDRITIINQGEIIAT 212
>gi|170758889|ref|YP_001786575.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A3 str. Loch Maree] >gi|169405878|gb|ACA54289.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A3 str. Loch Maree] (307 aa)
Score = 294, Expect = 1.1e-24, Identities = 78/212 (36%), Positives = 123/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G I I+G D +    +   K+G + E   F   +S +  L   A L  +  K        +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTLGKIIINGYDMRKDSEKAIEKIGAMVEAPSFYGGLSGYKNLILMANLYGVPKKRVG----EVLQMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGNL 212
>gi|118443740|ref|YP_877393.1| multidrug ABC transporter ATPase [Clostridium novyi NT] >gi|118134196|gb|ABK61240.1| ABC-type multidrug transport system, ATP-ase compoment CAC0241 [Clostridium novyi NT] (313 aa)
Score = 294, Expect = 1.1e-24, Identities = 63/211 (29%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE  N+ K+Y   +H  IDN +  V  GE    +G NGAGKTT I  I+G  +++ G + + G D     +  ++++G  P+       +++++ + +  +L  +K KE K   +  L+   +WD R   P  +S G K+++ +A A+ + P ++IMDEPT  +DP++R    + + +L K+  +I  +SH + E++   + + I+D GK++
  S:     5 ILEAKNIVKRY--GEHLAIDNASLSVREGEIFGLLGPNGAGKTTLINIIVGLLKSYSGEVNVFGKDLVKDEMYIKSQIGIAPQEAALFHDLTAYENVTFFGRLYGLKGKELKDGVKEALEFTELWDRRKDYPKQYSGGMKRRLNIACAIVHKPKLIIMDEPTVGIDPQSRKHILNSIKKLNKMGSTIIYTSHYMEEIEDLCDEIVIMDKGKVI 215
>gi|159905170|ref|YP_001548832.1| daunorubicin resistance ABC transporter ATPase subunit [Methanococcus maripaludis C6] >gi|159886663|gb|ABX01600.1| daunorubicin resistance ABC transporter ATPase subunit [Methanococcus maripaludis C6] (324 aa)
Score = 294, Expect = 1.1e-24, Identities = 86/259 (33%), Positives = 149/259 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQ-KLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRIKLVE-----DF------EGDKVGKYEVNSNNEI--IYEFKDKNEL 315
           +EV NL K++    +  +DN++F V  GE  AF+G NGAGK+TTI  +    +   G+  ISG D      + R  +G + +++   +++++++ LY   K+        K   E +L    + D +++   NFS G  +++ +A++L + P++L +DEPT  LDP+ R   ++ + ++Q K + +IF+++H + E +L ++ V I+DNGKI+     N  K   G  C  IK  E     D       E  +V  Y  N+++EI  I+EF  KN L
  S:     4 IEVKNLVKKF--DTNTAVDNVSFSVKKGEIFAFLGPNGAGKSTTINMLTTLLKATSGTALISGFDASKDPKKVRKTIGIVFQDSTLDNQLTAYENLYIHGKIYGYGGDVLKNRIEELLDFVELLDFKDKVVKNFSGGMVRRLEIARSLIHEPEVLFLDEPTIGLDPQTRSHIWEYIQKMQAKNNMTIFLTTHYMDEAELLADKVAIIDNGKIIAEGTVNELKKIVGHDCISIKFEEIPKNLDLKNCELKEEGRVHCYTENADSEIPKIFEFAQKNGL 278
>gi|153011659|ref|YP_001372873.1| ABC transporter related [Ochrobactrum anthropi ATCC 49188] >gi|151563547|gb|ABS17044.1| ABC transporter related [Ochrobactrum anthropi ATCC 49188] (310 aa)
Score = 294, Expect = 1.2e-24, Identities = 65/193 (33%), Positives = 110/193 (56%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F ++ GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +       +L++  +    N+    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F+++L EL+    +I +SSH L+EL+     V I + GKI+
  S:    20 ISDASFSLHAGESIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPATGAFAARLRLGYLPEHVSFNLALTGAETLGFYARLKRMPVAQNV----ELLERVGLAHAANRRVGTYSKGMRQRLGLAQALLGQPSVLLLDEPTTGLDPALRQSFYEVLEELRSKGTTILMSSHALTELETKVGRVIIANKGKII 210
>gi|169190658|ref|ZP_02850579.1| ABC transporter related [Paenibacillus sp. JDR-2] >gi|169002654|gb|EDS49534.1| ABC transporter related [Paenibacillus sp. JDR-2] (320 aa)
Score = 294, Expect = 1.2e-24, Identities = 64/210 (30%), Positives = 119/210 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +E   L K Y   +     ++  ++  GE   F+G NGAGK+T +K ++G     +G   + G    ++E+R ++GY+PE   +P  +S  + +++ AKL  +K  EAK     +L +  +          +S G ++++ LA AL  +PDI+ +DEP + LDP  R +  ++L  L++  K+IF++SH+L +++L  + V +L+NG+I+
  S:     5 IETFGLTKNYGNGR--GCHDVTLRIPAGEAFGFLGPNGAGKSTIVKMLVGLTTPTEGKALLFGQPAGSVEARRRIGYLPELFRYPGWLSGEEAMHFHAKLCGMKGAEAKSRINRLLDEVGIGQRGKDRIKGYSKGMQQRLGLACALLADPDIVFLDEPASALDPVGRHEVRELLQRLRREGKTIFLNSHLLEDVELLCDHVALLNNGRIL 212
>gi|99082365|ref|YP_614519.1| ABC transporter related [Silicibacter sp. TM1040] >gi|99038645|gb|ABF65257.1| ABC transporter related [Silicibacter sp. TM1040] (309 aa)
Score = 294, Expect = 1.2e-24, Identities = 67/217 (30%), Positives = 121/217 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI---KSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           +L + +LRK Y G     +  +N  +  GE  A +G NGAGKTT I +I G      GS+ + G  I+     +R  +G +P+       +  F+ +  + + ++    K K   L  E ILKK  +WD R       S G K+++L+A+ALS+ P +L +DEPTA +D + R D +D++ EL++   +I +++H + E +  ++ V ++  G+I+  ++++
  S:     4 ILSITDLRKSYAGG-FEALKGVNLDIEEGEILALLGPNGAGKTTLISTICGISTASSGSVTVGGHCIERAYRAAREMIGLVPQEI----NLEPFETVMNSVRFSRGLFGKPKNDALI-EEILKKLSLWDKRKSQIKELSGGMKRRVLIAKALSHEPRVLFLDEPTAGVDVELRKDMWDVVRELRESGVTIILTTHYIEEAEAMADRVAVIAAGEILLVEEKS 219
>gi|167766600|ref|ZP_02438653.1| hypothetical protein CLOSS21_01106 [Clostridium sp. SS2/1] >gi|167711723|gb|EDS22302.1| hypothetical protein CLOSS21_01106 [Clostridium sp. SS2/1] (295 aa)
Score = 294, Expect = 1.3e-24, Identities = 68/210 (32%), Positives = 120/210 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L++ +L KQ+  K    ++++N  + PG +   +GANGAGKTT ++ I       +G++Y  G D + L    R+K G++P++  +    +  DYL Y A L  I ++        +L    + D++ +  +N S G K+++ +AQA+ N+P+IL+MDEPTA LDP  R+   + + E     + + IS+HI+S+++  S    I+  G+IV
  S:     3 LKIEHLSKQF--KDKTAVNDVNLTLTPGVW-GLLGANGAGKTTLMRMIADIMTPTNGAVYYDGKDIRELGEVYRSKFGFLPQDFGYHRDFTVKDYLEYMAALKDIPTRATTQKINHLLDILSLSDVKKKKISNLSGGMKRRVGIAQAMLNDPEILVMDEPTAGLDPGERVRLRNFISEFSH-DRIVLISTHIVSDIEYISTRNAIMKAGEIV 210
>gi|67920729|ref|ZP_00514248.1| ABC transporter [Crocosphaera watsonii WH 8501] >gi|67856846|gb|EAM52086.1| ABC transporter [Crocosphaera watsonii WH 8501] (340 aa)
Score = 294, Expect = 1.3e-24, Identities = 73/233 (31%), Positives = 132/233 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK---NENGEMCYRIKLVED 288
           ++EV +L K Y       +++++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   ++LE R  +GY+PE       ++   +L + A++  +  K  +   +  L++ ++ D R       S G K+++ +AQA+ ++P ++I+DEPT  LDPK  I+  +++  L   H ++ +S+HIL E+ +  + VTI++ GK+V T   N    +   +  Y I++V D
  S:     1 MIEVEHLSKIY--GSTAAVEDVDFSVEKGEILGFLGPNGAGKTTTMRILSGFIPATAGTAKIAGYDVHEQSLEVRRNIGYLPETPPLYPDMTVEGFLQFVARIKGVARKNRQSRVDWSLERCQLEDKRKVLIRKLSKGYKQRVGIAQAIVHDPPVIILDEPTVGLDPKQIIEVRNLIKSLAGEH-TLLLSTHILPEVSMTCDRVTIINGGKVVATDTPNNLMSHLTAKGGYEIEIVGD 235
>gi|153940801|ref|YP_001390538.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum F str. Langeland] >gi|152936697|gb|ABS42195.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum F str. Langeland] (304 aa)
Score = 294, Expect = 1.3e-24, Identities = 77/212 (36%), Positives = 124/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVEKDSEKAIEKIGTMVEAPSFYGGLSGYKNLILMANLYGVPKKR----VDEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|150403090|ref|YP_001330384.1| daunorubicin resistance ABC transporter ATPase subunit [Methanococcus maripaludis C7] >gi|150034120|gb|ABR66233.1| daunorubicin resistance ABC transporter ATPase subunit [Methanococcus maripaludis C7] (324 aa)
Score = 293, Expect = 1.3e-24, Identities = 92/285 (32%), Positives = 165/285 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRIKLVE---DFEGDK--------VGKYEVNSNNEI--IYEFKD------------KNELAELIDKLISKEILVKFEKYYLSIEDL 341
           +EV NL K++    +  ++N++F V  GE  AF+G NGAGK+TTI  +    R+  GS  ISG D      + R  +G + +++   +++++++ LY   K+   K ++ K   + +L    + ++++    NFS G  +++ +A++L + P++L +DEPT  LDP+ R   ++ + ++QK +  +IF+++H + E +L ++ V I+DNGKI+     N  K   G  C  IK  E   D +  K        V  Y  N+++EI  I+EF              K  L ++  KL  +EI  + E   +S+  L
  S:     4 IEVKNLVKKF--DTNTAVNNVSFNVKKGEIFAFLGPNGAGKSTTINMLTTLLRSTSGSALISGFDASKDPKKVRKTIGIVFQDSTLDNQLTAYENLYIHGKIYGYKGEDLKKRIDELLYFVELLEVKDTVVKNFSGGMVRRLEIARSLIHEPEVLFLDEPTIGLDPQTRSHIWEYIQKMQKKNNMTIFLTTHYMDEAELLADKVAIIDNGKIIAEGTVNELKKIVGHDCISIKFEEIPKDLDSKKCELKEDGRVHYYTENADSEIPKIFEFAQEHGLKIQEISYKKPNLNDVFIKLTGREIRAERENSKISMRPL 316
>gi|42521775|ref|NP_967155.1| Nod factor export ATP-binding protein I [Bdellovibrio bacteriovorus HD100] >gi|39574305|emb|CAE77809.1| Nod factor export ATP-binding protein I [Bdellovibrio bacteriovorus HD100] (308 aa)
Score = 293, Expect = 1.3e-24, Identities = 63/218 (28%), Positives = 123/218 (56%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           T   +E+ +L K+Y  K    +D +N ++Y GE    +G NGAGK+TT+K +  S     G +Y+ G++ K    E ++++G +P+        +  + L   A  + I   EA L A+++L+  ++ + +++S    S G K+++ +A+ L N+P+++ +DEPT  LDP+AR+  +D    L+    ++ +++H + E +   + V I+D G+I+   K
  S:     3 TNVAIEIKDLTKKYDDKI--AVDGINLEIYKGECFGLLGPNGAGKSTTMKMMYCSALVSSGELYVLGLNVKKNYREIKSRIGVVPQEDGLDPDFTVLENLLVYASFHNIPVAEADLRAQALLRLMKLEEYQDRSVETLSGGMKRRLAIARGLINSPEVVFLDEPTTGLDPQARVWIWDFFKHLKSEKSTLVLTTHYMEEAEQMCDRVAIIDGGRILTVGK 220
>gi|47551267|ref|NP_999814.1| ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus] >gi|22218268|gb|AAM94613.1| ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus] (1764 aa)
Score = 293, Expect = 1.3e-24, Identities = 69/225 (30%), Positives = 117/225 (52%)
  Q:    40 ERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           E  I V+  D   +K  + + NL K Y GK+ P +D L+  +  GE    +G NGAGKTTT   + G  R   G+ Y+ G D   +  + + ++GY P+      R++  + L   A+L  I S +     +  +    +   +++    +S G K+K+  A AL  NP I+++DEPT+ +DPKAR   +D L  + +  +SI ++SH + E +     + I+ NG+
  S:  1427 EEKILVDNTDPHDSKYAVIIKNLAKVYRGKRTPAVDKLSVTIPKGECFGLLGVNGAGKTTTFGMLTGDVRMSAGTAYMGGYDIQTQRRKVQQRIGYCPQFDALVERLTGREVLMLFARLRGIPSNQMISVVDHTIDHLNLNKWQDKLCGTYSGGNKRKLSTAVALVGNPPIVLLDEPTSGMDPKARRYLWDSLTSIMEGGRSIILTSHSMEECEALCTRLAIMVNGQ 1653
Score = 233, Expect = 1.3e-17, Identities = 58/209 (27%), Positives = 109/209 (52%)
  Q:    57 LEVVNLRKQYYGK--KHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           + + NL K Y         +DNL+  ++ G+  A +G NGAGKTTT+  + G Y    G   ++G  I +     R  +G  P++     R++  ++L +  +L      +A      +++  ++ D  N      S G K+K+  A AL    +I+I+DEPT+ +DP AR   +D+L +  K  +++ +++H + E DL  + + I+ +G++
  S:   516 ITISNLTKVYKSSVGSKLAVDNLSVSMFKGQITALLGHNGAGKTTTMSILTGLYTPSSGKALVNGHSILDDMEGVRQSLGLCPQHNVLFDRLTVKEHLKFFIRLKGKSGPDADAEINQMIEDLQLVDKTNTLSTKLSGGMKRKLSCAIALIGGSEIVILDEPTSGMDPYARRATWDLLLKY-KAGRTMVLTTHFMDEADLLGDRIAIMADGQL 727
>gi|148657315|ref|YP_001277520.1| ABC transporter related [Roseiflexus sp. RS-1] >gi|148569425|gb|ABQ91570.1| ABC transporter related [Roseiflexus sp. RS-1] (337 aa)
Score = 293, Expect = 1.4e-24, Identities = 61/193 (31%), Positives = 112/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +D+LN  V  GE    +G NGAGKTTTI  ++G      GS+ + G+D   + L  + ++GY+P+   F   +++ + L Y AKLN I+ +E +      L++  + D+ ++    FS G ++++ +A+ L   P +++MDEPT  LDP+A  +F +++  L+    +I +SSH+L ++    + V +   G++V
  S:    41 VDSLNLTVRRGEIFGLLGPNGAGKTTTILMLLGLTEPTAGSVRVLGLDPTRQPLSIKARVGYLPDQVGFYDGLTARENLIYIAKLNGIRGREMQERIRESLEQVGLSDVADRQVRTFSRGMRQRLGVAEVLLKRPQLIVMDEPTLALDPEAVREFLELIRRLKSDGITIMLSSHLLHQVQAVCDRVGLFHKGRMV 235
>gi|17228465|ref|NP_485013.1| ABC transporter ATP-binding protein [Nostoc sp. PCC 7120] >gi|17130316|dbj|BAB72927.1| ABC transporter ATP-binding protein [Nostoc sp. PCC 7120] (316 aa)
Score = 293, Expect = 1.4e-24, Identities = 64/205 (31%), Positives = 119/205 (58%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+  ++H  +++++ ++  GE +  +G NGAGKTT I+ +  +     G IYI+G    +D  N   +  +GY+P++      ++ +DYL Y A+L +++          +L+  ++ + R    +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F  I+  LQ+   +I ISSH+LS+L     +V I++ G +V
  S:    12 LTKQF--ERHIAVNDVDLEIQMGEVYGLIGPNGAGKTTLIRMLAAAEEPTTGEIYINGEHLRLDKSNPTLKRHLGYLPDDYPLYEDLTVWDYLDYFARLYRLREPRRTQRLHEVLELIQLENKRKSQISTLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFRQIIKALQEAGMTIVISSHVLSDLAELCTSVGIMELGFLV 218
>gi|16800745|ref|NP_471013.1| hypothetical protein lin1677 [Listeria innocua Clip11262] >gi|16414164|emb|CAC96908.1| lin1677 [Listeria innocua] (306 aa)
Score = 293, Expect = 1.4e-24, Identities = 75/243 (30%), Positives = 143/243 (58%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKN-ENGEMCYRIKLVEDFEGDKV 294
           +T+ +L++ ++ K+  G+K+  + +++F ++ GE    +G NGAGKTT I+SI+G  R  +G++YI+G  ID     + +++G I EN  F   +S +  L   A++++    +  +    I++  ++ D  NQ    +S G ++++ +AQAL +NP +LI+DEPT  LDP+   +F  ++ +L     S+ ISSH+LSE+   ++   I++ G + +T+K +   EN    Y++K+ +      V
  S:     1 MTETVLKLEHVTKKI-GQKN-IVHDISFDIHKGEVFGLLGPNGAGKTTIIRSIVGLIRRSEGTVYINGKNIDTDFKAAISEVGAIIENPEFYMYMSGWANLKQFARMSQKNITDDHI--REIVELVKLSDAINQKVKTYSLGMRQRLGVAQALLHNPALLILDEPTNGLDPQGMAEFRALIRDLATNGTSVLISSHLLSEIQQITDRFAIINKGVLTHTEKMSDVLENHVAVYQLKVTDSVAAKTV 242
>gi|148379172|ref|YP_001253713.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A str. ATCC 3502] >gi|153933603|ref|YP_001383549.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A str. ATCC 19397] >gi|148288656|emb|CAL82737.1| putative ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152929647|gb|ABS35147.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A str. ATCC 19397] (307 aa)
Score = 293, Expect = 1.4e-24, Identities = 77/212 (36%), Positives = 124/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVEKDSEKAIEKIGTMVEAPSFYGGLSGYKNLILMANLYGVPKKR----VDEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|145953655|ref|ZP_01802663.1| hypothetical protein CdifQ_04003658 [Clostridium difficile QCD-32g58] >gi|168697716|ref|ZP_02729993.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-37x79] >gi|168725760|ref|ZP_02758037.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-76w55] >gi|168731918|ref|ZP_02764195.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-97b34] >gi|196161319|ref|ZP_03121880.1| ABC transporter, ATP-binding protein [Clostridium difficile CIP 107932] (290 aa)
Score = 293, Expect = 1.5e-24, Identities = 70/211 (33%), Positives = 125/211 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + V NL K++ GKK   +DN+N ++  G F   +G NGAGKTT ++ +       +GSI++ G+  +N  E R  +GY+P++      ++ +  + Y A L+ I  ++ +     +L K  + + +N    + S G  +++ +AQAL +NP +LI+DEPTA LDP+ RI F ++L E+    + + +S+HI+ +++     V ILD+GK++Y
  S:     5 IAVSNLSKRF-GKKQ-ALDNINLEIDSGMF-GLLGRNGAGKTTFMRILATLLSKTEGSIHMCGVPIENTKEIRNMVGYLPQDFSMYPNMTVYKAMDYLAVLSDIPLRKRRKIIAKLLSKVNLTNYQNVKVKSLSGGMNRRLGIAQALIHNPRVLIVDEPTAGLDPEERIRFRNLLCEIAN-DRIVILSTHIVGDIEATCENVAILDSGKVIY 212
>gi|149197263|ref|ZP_01874315.1| putative ABC transporter ATP-binding protein [Lentisphaera araneosa HTCC2155] >gi|149139809|gb|EDM28210.1| putative ABC transporter ATP-binding protein [Lentisphaera araneosa HTCC2155] (376 aa)
Score = 293, Expect = 1.6e-24, Identities = 92/313 (29%), Positives = 163/313 (52%)
  Q:    52 LTKPLLEVVNLRK---QYYGK-KHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEI--LVKFEKYYLSIEDLYKKYVIYGSVDTKETGNLDKERK 364
           +++ ++EV NL K    ++G+ K   ++ LNF++  G+    +G NG+GK+TTIK ++G      G + I G    NL+ + ++GY+PE T     ++  + L + A L KI   + K   + +++   +   R +    FS G  ++I LAQAL N+PD++I+DEPT+ LDP    +  D++  L K  K++ +SSH+L++++       I+DN  ++Y      +   E   +       E DK         + + +E KD +EL   I K ++KE+   V  E    S+ED++ + +     D+  T   D   K
  S:     1 MSETVVEVSNLNKVFKDFWGRPKAKAVNGLNFEIKKGQVFGLLGPNGSGKSTTIKMLLGLLFPSVGKVKIFGEKPSNLDVKKRIGYLPEETTLYRYLNPEEILDFYASLFKIPKADRKKRVDQLIEMVGLTHARKRPVGEFSKGMARRIGLAQALINDPDLIILDEPTSGLDPVGCREVKDLIRLLAKRGKTVILSSHLLADVE------DIVDNVVVMYGGHVRSSGRLESLLQ-------ETDK---------HTLTFETKD-DELLAKIRKFVTKELGDDVDLEHPKRSLEDMFLQVITEAKEDSITTSGADYSGK 296
>gi|183599070|ref|ZP_02960563.1| hypothetical protein PROSTU_02516 [Providencia stuartii ATCC 25827] >gi|188021287|gb|EDU59327.1| hypothetical protein PROSTU_02516 [Providencia stuartii ATCC 25827] (918 aa)
Score = 293, Expect = 1.6e-24, Identities = 62/193 (32%), Positives = 122/193 (63%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           +D++NFK+  GE   F+G+NG GK+TT+K + G  +  +G  ++ G  ID K++E+R ++GY+ +     S +S    L   AKL  I   + K   + + ++F + D+R+  P++   G ++++ LA A+ + P++LI+DEPT+ +DP AR  F++++ +L +    +IFIS+H ++E +   + ++++  GK++
  S:   291 VDHVNFKIPKGEIFGFLGSNGCGKSTTMKMLTGLLQASEGQAWLFGQEIDPKDIETRKRVGYMSQAFSLYSELSVEQNLVLHAKLFHIAEDQIKQRIDEMCQRFDLDDVRDTMPDDLPLGIRQRLSLAVAVIHRPEMLILDEPTSGVDPVARDMFWNLMVDLSRRDGVTIFISTHFMNEAE-RCDRISLMHAGKVL 485
Score = 190, Expect = 1.3e-12, Identities = 51/204 (25%), Positives = 111/204 (54%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESR----TKMGYIPE----NTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL--QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           Q+YG  +  +D++   +   +    +G +G GK++ I  I G+     G + + G D  + E R     K+ Y+P+    N +    +S ++ + +  +L     +E +   + +L+   +   +++     S G K+K+ L  AL ++PD+LI+DEPT  +DP +R  F+D++  +  ++ + S+ +++  + E + +   V  +D+GK++ T
  S:    18 QHYGD-NCALDDITLSIPARKMVGLIGPDGVGKSSLISLIAGAREIQQGKVIVLGSDMADKEHRREVCPKIAYMPQGLGKNLY--HTLSVYENVDFFGRLFGQSKEERQYRIDDLLESTGLAPFKDRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLSRAQFWDLIERIRERQTNMSVLVATAYMEEAERFDWLVA-MDDGKVMAT 227
>gi|186681061|ref|YP_001864257.1| ABC transporter related [Nostoc punctiforme PCC 73102] >gi|186463513|gb|ACC79314.1| ABC transporter related [Nostoc punctiforme PCC 73102] (334 aa)
Score = 293, Expect = 1.6e-24, Identities = 69/221 (31%), Positives = 123/221 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           ++EV +L K Y     P I ++ F V PGE    +G NGAGKTTT++ + G     +G+  I+G D    +L  R ++GY+PE       ++   +L++ A++  + + +      + +K+  + D R       S G ++++ +AQA+ ++P  +I+DEPT  LDP+  I+  +++  L   H +I +S+HIL E+ +  + V I++ GK+V T   N  EN
  S:     1 MIEVEHLSKIY--GSTPAITDVTFSVEPGEILGLLGPNGAGKTTTMRILAGYLPATNGNARIAGYDVHENSLAVRQRIGYLPETPPLYPDMTVEGFLHFVAQIKGVPAGDRPNKVTAAIKRCNLEDKRRVIIRKLSKGYRQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIEVRNLIKSLAGTH-TIILSTHILPEVSMTCSRVAIINRGKVVAT---NTPEN 217
>gi|148643543|ref|YP_001274056.1| multidrug ABC transporter, ATPase component [Methanobrevibacter smithii ATCC 35061] >gi|148552560|gb|ABQ87688.1| multidrug ABC transporter, ATPase component [Methanobrevibacter smithii ATCC 35061] (312 aa)
Score = 293, Expect = 1.6e-24, Identities = 63/215 (29%), Positives = 130/215 (60%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++ L+E+ N+ K+Y       ++NL+ ++  GE   F+G NGAGK+T+I  ++G  +   G+I  +G D+  L+ + ++G  P++    + ++ F+ LY   K+  I  K  K     IL+K  + D +++  ++ S G K+++ +A A  +NP I+++DEP+  LDP++R   +D +   ++L  ++ +++H++ E D+ S+ V I+D+GK++
  S:     1 MSETLIELRNVVKKY--DDVAVVNNLSLEIKKGEIFGFLGPNGAGKSTSINMMVGLLKPTSGNILFNGKDSSYLDEK-EIGICPQDVVLWNNLTCFENLYMIGKMYDIPKKLLKERILKILEKLHLTDKKDELISSLSGGMKRRMNIAMATIHNPSIVVLDEPSEGLDPQSRRLLWDYILHQKELGHTVILTTHLMDEADMLSDRVAIIDHGKLL 212
>gi|146297244|ref|YP_001181015.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410820|gb|ABP67824.1| ABC transporter related [Caldicellulosiruptor saccharolyticus DSM 8903] (309 aa)
Score = 293, Expect = 1.6e-24, Identities = 69/213 (32%), Positives = 127/213 (59%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +L+V+NL K +   K   +  ++F+V P   H F+G NGAGKTTT+K + G     +G I    +D   NKN+  + ++GY+P+N  F   ++  +YL    ++   +S+  K   E +L+  ++  +  +  + FS G  +++ +A A+ N P +L++DEPTA+LDP+ R +  + +  L++   ++F S+HIL++++   + VTIL  GKI+ +
  S:     1 MLKVINLHKSF--GKVKALKGISFEVKPATVHGFLGPNGAGKTTTMKILSGLISFDEGIILFENLDYKTNKNVIVK-QIGYLPQNPVFYGYLTPVEYLSLIGQICNFESRSIKKRTEEVLEIVKLSSVSKRKISTFSGGMLQRLGIAVAIFNKPKLLLLDEPTASLDPEGRAEVLEHIRSLKEEGITVFFSTHILNDVERICDYVTILHEGKIIVS 213
>gi|168714715|ref|ZP_02746992.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-63q42] (305 aa)
Score = 293, Expect = 1.7e-24, Identities = 93/291 (31%), Positives = 162/291 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSP--NNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN------------SNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G  +   G+I + G  +      S   +GY+P+   F + +   +YL    ++  +  KE ++ +E +L    +  LRN+      FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I  +   ++ ++     R+ L+E    D++ K++ +            +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     3 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLKPDSGTIDVCGEKVTYGKTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKKEIQIRSEELLS---LVGLRNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRL-LLEFASNDEIQKFKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 304
>gi|126732356|ref|ZP_01748156.1| ABC transporter related protein [Sagittula stellata E-37] >gi|126707225|gb|EBA06291.1| ABC transporter related protein [Sagittula stellata E-37] (312 aa)
Score = 293, Expect = 1.7e-24, Identities = 63/217 (29%), Positives = 125/217 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           ++E+  ++K+Y G     +  ++  +  GE  A +G NGAGKTT I +I G     DG+I I G D       +R+ +G +P+           + + ++  L  +K+ +A L  E IL+K  +WD R+ +    S G K+++L+A+ALS+ P +L +DEPTA +D + R D ++++ +L++   +I +++H + E +  ++ V +++ G+I+  + ++
  S:     3 MVEIDGVKKRYDGG-FEALKGVDLTIEEGEILALLGPNGAGKTTLISAICGITIPTDGTIRIGGHDVVTDYRAARSLVGLVPQEINLEPFEKVMNTVRFSRGLFGLKNDDALL--EDILRKLSLWDKRDSAVKELSGGMKRRVLIAKALSHEPRVLFLDEPTAGVDVELRRDMWEVVADLKRQGVTIILTTHYIEEAEAIADRVGVINKGRILLVEDKD 218
>gi|153937709|ref|YP_001387098.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A str. Hall] >gi|152933623|gb|ABS39122.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum A str. Hall] (307 aa)
Score = 292, Expect = 1.7e-24, Identities = 77/212 (36%), Positives = 124/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVEKDSEKAIEKIGTMVEAPSFYGGLSGYKNLILMANLYGVPKKR----VDEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|153810215|ref|ZP_01962883.1| hypothetical protein RUMOBE_00596 [Ruminococcus obeum ATCC 29174] >gi|149833394|gb|EDM88475.1| hypothetical protein RUMOBE_00596 [Ruminococcus obeum ATCC 29174] (295 aa)
Score = 292, Expect = 1.7e-24, Identities = 71/212 (33%), Positives = 121/212 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           LE+  L K++ G K   +D++   +  G  +  +G NGAGKTT ++ +    +   GSI   G D   L  E R  +GY+P+   F    S  DYL Y A +  ++   A+     +L++  +  ++N+     S G K++  +AQA+ NNP ILI+DEPTA LDP  RI F +++ EL +  + + +S+HI+S+++  +N V ++ +GKI ++
  S:     3 LELKKLTKEFQGFK--AVDDITLTMSNG-VYGLLGVNGAGKTTLMRMLCTLIKPTSGSILCDGKDIFALDGEYRRILGYLPQEFGFYPEFSVHDYLMYIASIKGMRISIARKRVTELLRQVGLAKMQNRKMKKLSGGMKRRAGIAQAMLNNPKILILDEPTAGLDPNERIRFRNLISELSQ-DRLVLLSTHIVSDIEYIANQVLLMKDGKISHS 212
>gi|167364513|ref|ZP_02298657.1| ABC transporter related [Rhodopseudomonas palustris TIE-1] >gi|192290738|ref|YP_001991343.1| ABC transporter related [Rhodopseudomonas palustris TIE-1] >gi|192284487|gb|ACF00868.1| ABC transporter related [Rhodopseudomonas palustris TIE-1] (301 aa)
Score = 292, Expect = 1.8e-24, Identities = 65/193 (33%), Positives = 112/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE--SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +++F + PG   A VG NGAGKTT IK ++G  R   GSI + G +    E   R  +G++PEN  F + ++  + L + A+L    +++      ++L +  + +   +    +S G ++++ LAQAL   P +L++DEPT  LDP  R+ F++IL EL++   ++ ISSH L EL+  +  V I++ G +V
  S:    20 LHDVSFALEPGRLSALVGHNGAGKTTLIKLMLGLIRPDGGSIRVLGENPAAGEFAGRRCLGFLPENVAFNAALTGRETLAFYARLKGCDARQGA----ALLDRVGLGEASRRLVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRLTFYEILDELRRDGATVLISSHALDELEGRAEQVLIMNRGILV 210
>gi|39935132|ref|NP_947408.1| putative NosF protein (an ABC transporter) [Rhodopseudomonas palustris CGA009] >gi|39648983|emb|CAE27504.1| putative NosF protein (an ABC transporter) [Rhodopseudomonas palustris CGA009] (301 aa)
Score = 292, Expect = 1.8e-24, Identities = 65/193 (33%), Positives = 112/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE--SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +++F + PG   A VG NGAGKTT IK ++G  R   GSI + G +    E   R  +G++PEN  F + ++  + L + A+L    +++      ++L +  + +   +    +S G ++++ LAQAL   P +L++DEPT  LDP  R+ F++IL EL++   ++ ISSH L EL+  +  V I++ G +V
  S:    20 LHDVSFALEPGRLSALVGHNGAGKTTLIKLMLGLIRPDGGSIRVLGENPAAGEFAGRRCLGFLPENVAFNAALTGRETLAFYARLKGCDARQGA----ALLDRVGLGEASRRLVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRLTFYEILDELRRDGATVLISSHALDELEGRAEQVLIMNRGILV 210
>gi|77408761|ref|ZP_00785491.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae COH1] >gi|77414453|ref|ZP_00790604.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae 515] >gi|77159498|gb|EAO70658.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae 515] >gi|77172606|gb|EAO75745.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae COH1] (241 aa)
Score = 292, Expect = 1.8e-24, Identities = 70/194 (36%), Positives = 107/194 (55%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + N++F+V  GE    +G NGAGK+TTI  IIG  R + G I I GI    N+ L  R K+G+IPE       ++  ++L   A    I + E    A+ +L+ FR+ D  +  P +FS G K+K+++  A   +P + I+DEP   LDP A  D  ++L E +   KSI +S+H+L   +   +   IL  G+I
  S:    15 PVLKNISFEVNDGELVGLIGLNGAGKSTTINEIIGILRPYQGDITIDGISLEANQEL-YRKKIGFIPETPSLYEELTLREHLETVAMAYDIATDEVMARAQKLLEMFRLTDKLDWFPMHFSKGMKQKVMIICAFVVSPSLFIVDEPFLGLDPLAISDLINLLAEEKAKGKSILMSTHVLDSAEKMCDRFVILHKGEI 210
>gi|153871942|ref|ZP_02000977.1| ABC-type multidrug transport system, ATPase component [Beggiatoa sp. PS] >gi|152071592|gb|EDN69023.1| ABC-type multidrug transport system, ATPase component [Beggiatoa sp. PS] (322 aa)
Score = 292, Expect = 1.8e-24, Identities = 66/211 (31%), Positives = 123/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ NL KQ+       +D+++F+V  GE   F+G NGAGK+TT+K I G      G++ + G D   K+LE + ++GY+PE       +++ +YL + A++   + +E +      + +  +  + +Q  +  S G K+++ LAQA+ ++P++LI+DEPT  LDP  + +   ++  + +  K I +S+HIL E+    +   I+ NGKI+
  S:     4 MVEIKNLCKQF--GPFTAVDDISFQVKKGEVLGFLGPNGAGKSTTMKMITGFLTPTSGTVIVDGHDIVQKSLEVKQRIGYLPEGAPAYPDMTAANYLDFIAQVRGFRGQEKRNRIADTVTRVNLEGVLHQPFDTLSKGFKRRVGLAQAILHDPEVLILDEPTDGLDPNQKYEVRTLIKNMAQ-EKVIILSTHILEEVHAVCSRAIIIANGKIL 213
>gi|167455740|ref|ZP_02321961.1| ABC transporter related [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417834|gb|EDR84535.1| ABC transporter related [Anaeromyxobacter dehalogenans 2CP-1] (318 aa)
Score = 292, Expect = 1.8e-24, Identities = 63/198 (31%), Positives = 118/198 (59%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDG--SIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
            +K   +D L+ +V PGE   FVG NGAGKTTTIK ++G      G  SI+   I ++  ++R  +GY+PE+  +   ++  + L++ AKL+ +   E +   + +L+   +    ++    +S G ++++ +AQAL  +P ++++DEP + LDP  R D  D++ EL++  K++F S+HIL +++   + V ++  GK+
  S:    18 ARKVTAVDALDLEVAPGEIFGFVGPNGAGKTTTIKMLMGLIYPTSGRASIFDDPIPSRRAKAR--IGYLPEHPAYYEFLTGREALHFFAKLSDVPGAERERRCDELLELVGLSAAADRQIRKYSKGMQQRLGIAQALVGDPALVVLDEPMSGLDPVGRKDVRDLILELKRRGKTVFFSTHILPDVESLCDRVGVILRGKL 215
>gi|160882787|ref|ZP_02063790.1| hypothetical protein BACOVA_00748 [Bacteroides ovatus ATCC 8483] >gi|156111811|gb|EDO13556.1| hypothetical protein BACOVA_00748 [Bacteroides ovatus ATCC 8483] (247 aa)
Score = 292, Expect = 1.8e-24, Identities = 67/208 (32%), Positives = 118/208 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           + +L KQY       +D++   +  GE    +G NGAGK+TTI  ++G      G++ I GI++    +E + K+GY+PE+  F   ++  + L YTA+LN I  KEAK  A  ++K+  + D   +    +S G ++++ LA  L  NP+I+I+DEPT+ +DP    +F +++  L K    ++  SSH L ++    + V +  NG+++
  S:     8 LTDLTKQY--GNFTAVDHIRLNIRKGEIFGLLGPNGAGKSTTILMMLGLTEPTSGTVEICGINSTTHPIEVKRKIGYLPEDVGFYDDMTGPENLIYTARLNGISDKEAKTKAMELMKRVGLEDQLAKKTGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGVQEFIELIRWLSKEEGLTVLFSSHHLDQVQKVCDRVGLFSNGQLL 216
>gi|196125737|ref|ZP_03117486.1| ABC transporter, ATP-binding protein [Clostridium difficile ATCC 43255] (305 aa)
Score = 292, Expect = 1.9e-24, Identities = 93/291 (31%), Positives = 161/291 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSP--NNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN------------SNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G  +   G+I + G  +      S   +GY+P+   F   +   +YL    ++  +  KE ++ +E +L    +  LRN+      FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I  +   ++ ++     R+ L+E    D++ K++ +            +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     3 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLKPDSGTIDVCGEKVTYGKTSSNRHVGYLPDVPEFYDYMRPLEYLSLCGEITGLSKKEIQIRSEELLS---LVGLRNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRL-LLEFASNDEIQKFKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 304
>gi|158522081|ref|YP_001529951.1| ABC transporter-related protein [Desulfococcus oleovorans Hxd3] >gi|158510907|gb|ABW67874.1| ABC transporter-related protein [Desulfococcus oleovorans Hxd3] (316 aa)
Score = 292, Expect = 2.0e-24, Identities = 69/210 (32%), Positives = 114/210 (54%)
  Q:    60 VNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQ 269
           VN   +YYG     ++ ++ K+  GE    +G NGAGKTTT++ + G  R   G I ++G+   N     K  MGY+PE       +  +DYL Y A +  I+ +E       +     +  + +Q     S G ++++ LA A+ ++P+IL++DEPT+ LDP   ++  DI+ +  K  K+I  S+HILSE +   + + I+D G+IV  Q
  S:     5 VNQLTRYYGDL-CAVNGISLKIEKGEIVGLLGPNGAGKTTTLRMLTGFLRPTSGDITVNGLSIHNDMPAIKRLMGYLPEAAPVYDDMLVYDYLVYVADVRGIRREEQSDRISRVAGMCGLQPVMHQPVAELSKGFRQRVGLAHAMIHDPEILVLDEPTSGLDPNQIVEIRDIIRQAGK-EKTIIFSTHILSEAEATCDRIVIIDKGRIVADQ 214
>gi|189023051|ref|YP_001932792.1| Copper transport ATP-binding protein NOSF [Brucella abortus S19] >gi|189021625|gb|ACD74346.1| Copper transport ATP-binding protein NOSF [Brucella abortus S19] (331 aa)
Score = 292, Expect = 2.0e-24, Identities = 64/193 (33%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F++  GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +A    +++L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL  L++   +I +SSH L+EL+     V I + GK++
  S:    41 ISDASFRLMAGENIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETLGFYARLKQVPFGQA----DALLERVGLAHAADRRVGTYSKGMRQRLGLAQALLGQPAVLLLDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVI 231
>gi|62317798|ref|YP_223651.1| copper ABC transporter, ATP-binding protein [Brucella abortus bv. 1 str. 9-941] >gi|62197991|gb|AAX76290.1| copper ABC transporter, ATP-binding protein [Brucella abortus biovar 1 str. 9-941] (316 aa)
Score = 292, Expect = 2.0e-24, Identities = 64/193 (33%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F++  GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +A    +++L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL  L++   +I +SSH L+EL+     V I + GK++
  S:    26 ISDASFRLMAGENIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETLGFYARLKQVPFGQA----DALLERVGLAHAADRRVGTYSKGMRQRLGLAQALLGQPAVLLLDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVI 216
>gi|83269779|ref|YP_419070.1| ABC transporter ATPase [Brucella melitensis biovar Abortus 2308] >gi|82940053|emb|CAJ13092.1| ATP/GTP-binding site motif A (P-loop):ABC transporter:AAA ATPase [Brucella melitensis biovar Abortus 2308] (316 aa)
Score = 292, Expect = 2.0e-24, Identities = 64/193 (33%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F++  GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +A    +++L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL  L++   +I +SSH L+EL+     V I + GK++
  S:    26 ISDASFRLMAGENIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETLGFYARLKQVPFGQA----DALLERVGLAHAADRRVGTYSKGMRQRLGLAQALLGQPAVLLLDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVI 216
>gi|15922045|ref|NP_377714.1| ABC transporter ATP-binding protein [Sulfolobus tokodaii str. 7] >gi|15622833|dbj|BAB66823.1| 298aa long hypothetical ABC transporter ATP-binding protein [Sulfolobus tokodaii str. 7] (298 aa)
Score = 292, Expect = 2.1e-24, Identities = 86/272 (31%), Positives = 141/272 (51%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDF-------EGDKVGKYEVNSNNEIIYEFK-DKNELAELIDKLISKEI 327
           ++++ N+ K +  +K   +DN++F V  GE   FVG NGAGKTTTI+  +G+     G +YI G      K + SR  +G++PE   F   + + DY  Y A    I +KEA    + + ++  +         N+S G KK+  LA +L +NP   + DE    LDP+    F D+  ++++  K+I  SSHIL+E++  ++ V  +  GKIV     ++         +++V          E  K G+ EVN N  II + K D   ++ ++ K    EI
  S:     1 MIQIENVSKNFGKRK--VLDNVSFSVNNGEIVGFVGLNGAGKTTTIRIAVGTISPNSGDVYIDGYSITREKKIASRN-IGWVPEFPIFEQDVKALDYFVYIAGYYGISAKEATELGKKLFEEVGLSGREKDKLANYSQGMKKRFALAVSLISNPKNFLFDEVLNGLDPQGIQFFRDMALKMKREGKAILFSSHILAEVEAIADKVVFIHKGKIVKVSTIDEIRRSLTSKSLRVVLSNITKEAIEEASKFGEVEVNGNVIIIKDCKADLTHVSNVMSKYQVLEI 280
>gi|89098680|ref|ZP_01171562.1| ABC transporter, ATP-binding protein [Bacillus sp. NRRL B-14911] >gi|89086642|gb|EAR65761.1| ABC transporter, ATP-binding protein [Bacillus sp. NRRL B-14911] (311 aa)
Score = 292, Expect = 2.1e-24, Identities = 66/211 (31%), Positives = 122/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+++L K+Y   K   +++LN ++  G    FVG NGAGK+TT   +        G+ Y++G  + ++    R ++GY+P+      ++ + +YL++      I   E +     +L    +   R+   +  S G K+++ LA++L ++P++LI+DEP + LDP+AR++  +IL EL+ + K+I ISSHIL EL    + + I+D G +V
  S:     1 MIEIIDLTKRY--GKFTALNSLNLQIEKGSVFGFVGQNGAGKSTTFSILATLLAPTSGTAYVNGYNVADEPKMVRRQIGYMPDFFGVYDQLKAEEYLHFYGASYGIDFNEREKLIPQLLDLVNLEHKRDSYVDLLSRGMKQRLCLARSLIHDPEVLILDEPASGLDPRARVEMREILKELKDMGKTILISSHILPELAEMCDTIGIIDQGMLV 211
>gi|196164807|ref|ZP_03125338.1| ABC-type multidrug transport system (daunorubicin resistance), ATPase component [Clostridium difficile QCD-23m63] (252 aa)
Score = 292, Expect = 2.1e-24, Identities = 70/237 (29%), Positives = 132/237 (55%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVED 288
           ++  LLE+ NL K+Y  K+  +I++  FK+  G+   F+GANGAGK+T+I  +        GSIY  G D KN ++  ++ +G +P+       +S++D + +   L   K  E K   +  L+   +W+   + P+ FS G K+++ +A A++++P ILIMDEPT  +DP++R    + +  +     ++  +SH + E++   N + ++D G I+    ++  +N  + +  K +ED
  S:     1 MSNILLEIKNLSKKYNNKEVVSIES--FKLLEGDILGFIGANGAGKSTSINMLTTIVSPDSGSIYYKGKDIKNQQNIFKSSLGVVPQELAIYEDLSAYDNVKFFCSLYGFKGNELKERTKDALEFVGLWESHKEFPSKFSGGMKRRLNIACAIAHSPKILIMDEPTVGIDPQSRNKILEAIKCINTNGTTVIYTSHYMEEIETLCNRIALIDKGIIIEDLDKSLYKNKYLEFGCKTLED 237
>gi|171912119|ref|ZP_02927589.1| putative ABC transporter ATP-binding protein [Verrucomicrobium spinosum DSM 4136] (295 aa)
Score = 292, Expect = 2.1e-24, Identities = 61/197 (30%), Positives = 111/197 (56%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           +  L+F+V  GE +  +G NG GK+TT+K ++G  +   G   I G D++ + SR  +G++PEN +F   +S  + L +  +L  ++  E K   E++L+   +     +    +S G  +++ L QAL + P +LI+DEPTA +DP       D++ EL++   +I ++SH+L ++    + V I+ NG++V   K
  S:    35 VKQLSFEVSAGEVYGLIGPNGCGKSTTMKVMLGLLKATQGRATIFGRDSEEVASRQDVGFLPENPYFYKHLSGRETLNFYGRLCGLRGAELKDRTEAMLELTGLTHAAERRVGGYSKGMLQRVGLGQALIHEPRLLILDEPTAGVDPVGSRRIRDLILELKQRGITIVVTSHLLEQMQEVCDRVGIMSNGRMVSEGK 231
>gi|172038416|ref|YP_001804917.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] >gi|171699870|gb|ACB52851.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] (326 aa)
Score = 292, Expect = 2.1e-24, Identities = 67/220 (30%), Positives = 126/220 (57%)
  Q:    47 QEDIDLTKPLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESI-LKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           QE  +   P+++  NL K Y       +K  ++++ +F VY GE    +G NGAGKTT +K ++G  R   G   + G    NL  + K+GY+PEN ++   ++++++L + A L +I KS + +   E + L        + +    +S G  +++ +AQAL N+P+++  DEP + LDP  R    +I+  L++  K+IF +SH+L++++   + + +L  G ++
  S:    10 QEPKNELMPVVQTWNLSKVYRTGFWMNQKLRSLNDCSFSVYKGETFGLLGPNGAGKTTLLKMLLGIVRPTSGRAVLLGYPVGNLSVKQKIGYLPENAYYYDYLTAWEFLEFVAGLFQIPKSVQKRRIPELVDLVGLAQKTAKKKQLRQYSKGMLQRVGMAQALINDPEVVFFDEPMSGLDPLGRYQVREIVLSLKEQGKTIFFNSHVLTDIEKICDRIALLARGDLL 236
>gi|146092943|ref|XP_001466583.1| ABC transporter [Leishmania infantum] >gi|134070946|emb|CAM69622.1| ABC transporter, putative [Leishmania infantum] (1866 aa)
Score = 292, Expect = 2.1e-24, Identities = 64/209 (30%), Positives = 115/209 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           + V +L K+Y G +H  + +++F V  GE    +G NGAGKTTT+  + G      G  +++    +++ESR  +GY P+     S +S+ ++L+  A+L  IK K  +     +LK+  ++  RNQ   + S G K+++ LA AL  +   +++DEPT+ +D  AR    DI+  L    KS+ +++H L E++  ++ V  +  G +
  S:  1539 IAVQHLSKRYLGAEHAALQDISFGVKEGEVMGLLGLNGAGKTTTVSILAGEVVATSGEAFVNHYAVQSMESRPFVGYCPQYDALLSNLSAEEHLWLYARLRSIKEKHIRGEVHVLLKELGLYPFRNQPAASLSGGNKRRLSLAIALVGHTTSVLLDEPTSGMDAVARAQTCDIVRRLTA-QKSVVLTTHRLDEVEALADRVAFVVRGNL 1746
Score = 222, Expect = 2.3e-16, Identities = 50/196 (25%), Positives = 101/196 (51%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           G +   +D + F +  GE    +G NGAGK+T +    G     +G +Y+ G + +    E R  +GY P+       ++  +++ + A++    S   +   + ++    + + R+   +  SSGQ++++ +A A+  +  +L +DEPTA +D K R   ++ L    +  +S+ IS+H+L E D  ++ V I++ G
  S:   681 GDRIVALDGVTFAMRTGEVSVLLGPNGAGKSTIMGVATGMVNPTNGDVYVRGYNARTHLDECRQNIGYCPQRDIVWPLLTVEEHITFYARMKGSHSVNVQEKVDYVVDLLDLHEKRHCKASKLSSGQRRRLCVAIAMVGDSAVLFLDEPTAGMDIKGRKIVYEALNR-TRTQRSVLISTHLLDEADRIADRVLIVNKG 877
>gi|156741650|ref|YP_001431779.1| ABC transporter related [Roseiflexus castenholzii DSM 13941] >gi|156232978|gb|ABU57761.1| ABC transporter related [Roseiflexus castenholzii DSM 13941] (338 aa)
Score = 292, Expect = 2.1e-24, Identities = 66/211 (31%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E  +L K  +G  H  + +++  V PGE  A +G NGAGKTTT++ +    R  +G   ++G D   +  + R  +G + E      R+   +YL +   L  + + E+   AE +L++F +W+ RN+  ++FS G K+K+ L +AL ++P +L +DEPT  +DP +     D + EL+   ++I +++H L+E +  ++ + I+ NG IV
  S:     1 MIEARHLHK-VFGAFH-AVRDVSLTVDPGEVVALLGPNGAGKTTTVRMLGAILRPSEGYARVAGYDVVEQARDVRRVVGLLTEFPGLYLRMRPQEYLCFFGALQGMSATESARRAEQLLRQFGLWEARNKRLDSFSKGMKQKVALIRALIHDPPVLYLDEPTTAMDPHSARQVRDAMLELRAAKRTILLTTHNLTEAEELADRIVIIRNGSIV 211
>gi|189465680|ref|ZP_03014465.1| hypothetical protein BACINT_02040 [Bacteroides intestinalis DSM 17393] >gi|189433944|gb|EDV02929.1| hypothetical protein BACINT_02040 [Bacteroides intestinalis DSM 17393] (249 aa)
Score = 292, Expect = 2.2e-24, Identities = 62/208 (29%), Positives = 122/208 (58%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           + +L K+Y       +D+++  +  GE    +G NGAGK+TTI  ++G      G + I GID+    +E + ++GY+PE+  F   ++  + L YTA LN +  +EA+  A+ ++++  + +  N+    +S G ++++ LA  L  NP+I+I+DEPT+ +DP    +F +++  L ++H  ++  SSH L ++    + V + ++GK++
  S:     8 LTDLTKKY--GNFTAVDHISLSICKGEIFGLLGPNGAGKSTTILMMLGLTEPTSGKVEICGIDSTTNPIEVKKRIGYLPEDLGFYDEMTGLENLVYTALLNGLSKREAEEKAKELMQRVGLSEQANKKTGKYSRGMRQRLGLADVLIKNPEIIILDEPTSGIDPAGIQEFIELIRNLSRVHSLTVLFSSHNLDQVQKACDRVGLFNHGKLL 216
>gi|32035420|ref|ZP_00135391.1| COG1131: ABC-type multidrug transport system, ATPase component [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207752|ref|YP_001052977.1| putative ABC transporter ATP-binding protein [Actinobacillus pleuropneumoniae L20] >gi|165975722|ref|YP_001651315.1| ABC-2 type transport system ATP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149535|ref|YP_001968060.1| putative ABC transporter ATP-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126096544|gb|ABN73372.1| putative ABC transporter ATP-binding protein [Actinobacillus pleuropneumoniae L20] >gi|165875823|gb|ABY68871.1| ABC-2 type transport system ATP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914666|gb|ACE60918.1| putative ABC transporter ATP-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (302 aa)
Score = 291, Expect = 2.2e-24, Identities = 72/210 (34%), Positives = 117/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHPT----IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LE+ NL K Y     PT    +  ++  V  G+F+A +G NGAGK+TTI  I        GS+ + G  +D + ++ + ++G +P+   F       D L   A    I  KEA + AE+ LKK  +W+ R+      S G K+++++A+AL +NP +LI+DEPTA +D + R   +D L EL +   +I +++H L E +     + I+ NG +V
  S:     4 LEITNLIKTY-----PTGVQAVKGIDLIVEQGDFYALLGHNGAGKSTTIGIISSLVNKTSGSVKVFGYDLDTQKIQLKQQIGLVPQEFNFNQFEKVIDVLTQQAGYYGISQKEATVSAETWLKKLDLWEKRHHLTRELSGGMKRRVMIARALMHNPKLLILDEPTAGVDIELRRSLWDFLRELNQQGTTIILTTHYLEEAENLCRHIGIIQNGLLV 214
>gi|116623605|ref|YP_825761.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116226767|gb|ABJ85476.1| ABC transporter related [Solibacter usitatus Ellin6076] (328 aa)
Score = 291, Expect = 2.3e-24, Identities = 66/211 (31%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V  L K+Y   +   +D+++F+V  G+   F+G NGAGKTTT++ +        G+  I+G D      E + ++GY+PE       +   +YL +  ++  I   + K   + ++ +  + D+  +     S G ++++ +AQA+ +NPD+LI+DEPT+ LDPK  I+  ++L +L   H +I +S+HILSE++     V I+  GK+V
  S:     1 MIKVEGLTKRY--ARTVAVDDISFEVEKGQIVGFLGPNGAGKTTTMRVLTCFLPPSSGTANIAGFDVLENPQEVKKRIGYLPETPPVYPEMEVSEYLDFVGQIKGIPGGDIKRKRDEVIGRCSLGDVSKKLIGKLSKGYRQRVGIAQAIIHNPDVLILDEPTSGLDPKQIIEIRELLRQLAGDH-TIILSTHILSEVEHSCERVIIISQGKLV 210
>gi|148378770|ref|YP_001253311.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|153933039|ref|YP_001383158.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|153935025|ref|YP_001386706.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. Hall] >gi|148288254|emb|CAL82328.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152929083|gb|ABS34583.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|152930939|gb|ABS36438.1| ABC transporter, ATP-binding protein [Clostridium botulinum A str. Hall] (262 aa)
Score = 291, Expect = 2.3e-24, Identities = 70/221 (31%), Positives = 136/221 (61%)
  Q:    59 VVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K ++G  + ++G + I G  I  +N+E + K+GY+PEN      +++++Y+ +  ++  +K ++    A+ ++  F + +  +   +++S G ++K+L+  +L +NPDIL +DEP + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     8 VVSIRDLKMTYGSKE-VLKGINLDVNKGEIIGYIGPNGAGKSTTVKIMLGLVKGYEGEVKIFGNNISYENVEYKHKIGYVPENGEIYDNLTAYEYITFLGEIYGMKLEDVNNKAKKLMSLFGIEEAYHSRISSYSKGMRQKLLIISSLIHNPDILFLDEPLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIAADGTFEELKKKNMEGSL 235
>gi|148558676|ref|YP_001257315.1| copper ABC transporter, ATP-binding protein [Brucella ovis ATCC 25840] >gi|148369961|gb|ABQ62833.1| copper ABC transporter, ATP-binding protein [Brucella ovis ATCC 25840] (331 aa)
Score = 291, Expect = 2.3e-24, Identities = 64/193 (33%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F++  GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +A    +++L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL  L++   +I +SSH L+EL+     V I + GK++
  S:    41 ISDASFRLMAGENIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETLGFYARLKQVPFGQA----DTLLERVGLAHAAHRRVGTYSKGMRQRLGLAQALLGQPAVLLLDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVI 231
>gi|28210363|ref|NP_781307.1| transporter [Clostridium tetani E88] >gi|28202800|gb|AAO35244.1| transporter [Clostridium tetani E88] (262 aa)
Score = 291, Expect = 2.3e-24, Identities = 71/221 (32%), Positives = 135/221 (61%)
  Q:    59 VVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K ++G  + ++G + I G  I N N+E + K+GY+PEN      +++++Y+ +  ++  ++ +E    A+ ++  F +    +   +++S G ++K+L+  +L +NPDIL +DEP + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     8 VVSIRDLKMSYGSKE-VLKGINLDVKKGEIIGYIGPNGAGKSTTVKIMLGLVKGYEGEVKIFGNNISNDNVEYKRKIGYVPENGEIYDNLTAYEYVTFLGEIYDMELEEINNKAKKLMSLFGIEKSYHSRISSYSKGMRQKLLIISSLIHNPDILFLDEPLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIAADDTFEELKKKNMEGSL 235
>gi|157964002|ref|YP_001504036.1| ABC transporter related [Shewanella pealeana ATCC 700345] >gi|157849002|gb|ABV89501.1| ABC transporter related [Shewanella pealeana ATCC 700345] (244 aa)
Score = 291, Expect = 2.4e-24, Identities = 63/211 (29%), Positives = 118/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   +++L+F    G+    +G NGAGKTT ++++ G  +  +G   I GID     + ++ ++G  P+      R++  +Y+ Y A+LN +  KEAKL   +++++  + D+ ++    FS GQ+ K  LAQA+ + P  +I+DEPT  LD  +     DIL +L+     +  SSH++ E+    + V ++  G++V
  S:     1 MIQVSNLSKRIGDVQ--ALNDLSFSALDGQITGLLGPNGAGKTTCLRTVFGLLKPDNGIAEIDGIDIAKSPVAAKQQLGLFPDPFGLYERLTPREYISYFAELNGLTRKEAKLATSNVIERLHLADIADRQCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGLDVMSTRVLRDILRDLKNQGHCVLFSSHVMQEVAALCDQVIVMAEGRVV 211
>gi|76802043|ref|YP_327051.1| ABC-type transport system ATP-binding protein [Natronomonas pharaonis DSM 2160] >gi|76557908|emb|CAI49492.1| ABC-type transport system ATP-binding protein [Natronomonas pharaonis DSM 2160] (311 aa)
Score = 291, Expect = 2.4e-24, Identities = 67/211 (31%), Positives = 116/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++EV +LRK+Y G     ++   F V  GE    +G NGAGKTTT+K+I G      G++ I+G    + E+R ++G++PE +     +S   YL + A L  +  + A    E+ L +  +   R ++  + S G K+K+ +A++L N+PD+L+ DEP + LDP       +   EL +  +++  S+H L  ++   + V I++ GKIV
  S:     1 MIEVRDLRKEYGG--FAAVEGSTFSVDSGEVFGVIGPNGAGKTTTLKAIAGLLEPTSGTVAINGEPADSRETRRRLGFLPEESPLYEEMSPRSYLRFFADLYDVPREVANQRIENTLDRLELAH-RERALGDMSKGMKRKVAIARSLVNDPDVLVYDEPASGLDPLTTNYIIEFTKELAEEGRTVVFSAHNLYHVEEVCDRVAIMNEGKIV 208
>gi|119509138|ref|ZP_01628289.1| ABC transporter ATP-binding protein [Nodularia spumigena CCY9414] >gi|119466304|gb|EAW47190.1| ABC transporter ATP-binding protein [Nodularia spumigena CCY9414] (339 aa)
Score = 291, Expect = 2.4e-24, Identities = 74/243 (30%), Positives = 129/243 (53%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI---DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY----TQKRNKNENGEMCYRIKLVEDFEGDKVGKY 297
           P + + NL+K Y       + +++F+V PGE    +G NGAGKTTT++++        G I +SGI   DN  + +R K+GY+ +       ++  + L   A L  I    AK   + +L    + +  N+    +S G +K++ LA  L + PD+L++DEPT  LD  +RI  +D L +L+    ++ I+SH L E+D  ++ V I+D G ++     +Q ++K     +  RI+     E  +  K+
  S:     3 PAVLIENLQKSYGAVV--AVKDVSFQVEPGEIFGLLGPNGAGKTTTLRALCTLITPDAGKIEVSGISVIDNPRI-ARQKLGYVAQEVALDKVLTGKELLQLQAALYHIPRAVAKQRIDMVLDLLGLQEYANKKTGTYSGGLRKRLDLAAGLLHAPDVLVLDEPTVGLDIDSRIVVWDFLRQLRASGTTVLITSHYLEEIDALADRVAIIDRGVVIAAGTPSQLKDKVGGDRITLRIREFSPIEEAEKAKH 249
>gi|22536556|ref|NP_687407.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae 2603V/R] >gi|25010433|ref|NP_734828.1| ABC transporter ATP-binding protein [Streptococcus agalactiae NEM316] >gi|76788566|ref|YP_329093.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae A909] >gi|76798058|ref|ZP_00780315.1| ABC transporter, ATP-binding protein SP0522 [Streptococcus agalactiae 18RS21] >gi|77406365|ref|ZP_00783427.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae H36B] >gi|77411666|ref|ZP_00788006.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae CJB111] >gi|22533390|gb|AAM99279.1|AE014208_19 ABC transporter, ATP-binding protein [Streptococcus agalactiae 2603V/R] >gi|23094786|emb|CAD46004.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563623|gb|ABA46207.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae A909] >gi|76586617|gb|EAO63118.1| ABC transporter, ATP-binding protein SP0522 [Streptococcus agalactiae 18RS21] >gi|77162310|gb|EAO73281.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae CJB111] >gi|77175034|gb|EAO77841.1| ABC transporter, ATP-binding protein [Streptococcus agalactiae H36B] (241 aa)
Score = 291, Expect = 2.4e-24, Identities = 70/194 (36%), Positives = 108/194 (55%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-----RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + N++F+V  GE    +G NGAGK+TTI  IIG  R + G I I GI   +LE+     R K+G+IPE       ++  ++L   A    I + E    A+ +L+ FR+ D  +  P +FS G K+K+++  A   +P + I+DEP   LDP A  D  ++L E +   KSI +S+H+L   +   +   IL  G+I
  S:    15 PVLKNISFEVNDGELVGLIGLNGAGKSTTINEIIGILRPYQGDITIDGI---SLEADQELYRKKIGFIPETPSLYEELTLREHLETVAMAYDIATDEVMARAQKLLEMFRLTDKLDWFPMHFSKGMKQKVMIICAFVVSPSLFIVDEPFLGLDPLAISDLINLLAEEKAKGKSILMSTHVLDSAEKMCDRFVILHKGEI 210
>gi|146283035|ref|YP_001173188.1| ABC transporter ATP-binding protein [Pseudomonas stutzeri A1501] >gi|145571240|gb|ABP80346.1| probable ATP-binding component of ABC transporter [Pseudomonas stutzeri A1501] (307 aa)
Score = 291, Expect = 2.5e-24, Identities = 65/211 (30%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ NL K++   +H  +DNL+F+V  GE   F+G NGAGK+TT+K + G      G+  I G D   + L+++  +GY+PE       ++   +L + A++   +  + +   ++ + +  +  +  QS    S G K+++ LAQA+ ++PD+LI+DEPT  LDP  +     ++  L +  K + IS+HIL E+        ++ NG++V
  S:     1 MIEISNLTKRF--AQHTAVDNLSFQVQRGEVLGFLGPNGAGKSTTMKMLTGFLAPTSGTARILGHDIRTQTLQAQRLIGYLPEGAPCYGDMTVRGFLEFIAEVRGFRGADKRQRVDAAVAQVELQKVLGQSIETLSKGFKRRVGLAQAILHDPDVLILDEPTDGLDPNQKHQVRQLIQGLAQ-DKIVIISTHILEEVSAVCTRAVVIANGRLV 210
>gi|17989316|ref|NP_541949.1| copper transport ATP-binding protein NOSF [Brucella melitensis 16M] >gi|17985183|gb|AAL54213.1| COPPER TRANSPORT ATP-BINDING PROTEIN NOSF [Brucella melitensis 16M] (331 aa)
Score = 291, Expect = 2.5e-24, Identities = 64/193 (33%), Positives = 113/193 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I + +F++  GE  A VG NGAGKTT IK ++G  R   G++ + G D       +R ++GY+PE+  F   ++  + L + A+L ++   +A    +++L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL  L++   +I +SSH L+EL+     V I + GK++
  S:    41 ISDASFRLMAGENIALVGHNGAGKTTMIKLMLGLIRPTKGAVRVLGEDPAAGAFAARLRLGYLPEHVSFNMALTGAETLGFYARLKQVPFGQA----DALLERVGLAHAAHRRVGTYSKGMRQRLGLAQALLGQPAVLLLDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVI 231
>gi|127514330|ref|YP_001095527.1| ABC transporter-related protein [Shewanella loihica PV-4] >gi|126639625|gb|ABO25268.1| ABC transporter-related protein [Shewanella loihica PV-4] (322 aa)
Score = 291, Expect = 2.5e-24, Identities = 63/214 (29%), Positives = 122/214 (57%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++P++ +  + K+Y   K   ++ ++F+++PGE     G NGAGKTT +K I+G     DG + + G D    +  E+R ++GY+PEN  F  +++  + L Y A+L  +     K   E +L++  +    ++    +S G ++++ LAQA   +P +L++DEPT  LDP A  +F+  + +L+    SI + SH+L  ++ + +   I+  G+++
  S:     7 SRPIVSLSGVAKRY--AKVSALERIDFELFPGEVMGLFGHNGAGKTTIMKLILGIIPASDGQVKVFGQDPLSKQAFEARKQVGYLPENVSFYDQLTGREVLRYFARLKSV----PKQAIEQLLEQVGLTHAMDRQVKTYSKGMRQRLGLAQAFLGSPKLLLLDEPTVGLDPIATQEFYASVDKLKSEGASIILCSHVLPGVEQHIDRALIISGGRLL 217
>gi|164690686|dbj|BAF98636.1| putative ABC transporter [Streptomyces argenteolus] (344 aa)
Score = 291, Expect = 2.5e-24, Identities = 63/213 (29%), Positives = 117/213 (54%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           KP++EV  L K+Y G     +  ++F V   E  A +G NGAGKTTT+  +        G   ++GID  ++ + +R  +  +P+       +S    L + A  + + +  A+  A+ +L++F + D  +   +  S GQ +++L+A+AL +NP +L +DEPT  LDP  R+  ++ + EL+    ++ +++H + E    S+ V I+D GK++
  S:    15 KPMIEVEQLVKRYSGASTDAVAGVSFAVRQSEIFALLGPNGAGKTTTVGMLTTRVVPTGGKARLAGIDVVDQPVRARAALAVVPQRINLDRSLSIRQNLLFHAAYHGVPTGVARSRAQHLLERFELTDHADHKADLLSGGQAQRVLVARALMHNPQVLFLDEPTTGLDPAVRLFVWESIRELRDQGVAMVLTTHDMREAAELSDRVAIMDGGKLL 229
>gi|89895539|ref|YP_519026.1| hypothetical protein DSY2793 [Desulfitobacterium hafniense Y51] >gi|89334987|dbj|BAE84582.1| hypothetical protein [Desulfitobacterium hafniense Y51] (289 aa)
Score = 291, Expect = 2.5e-24, Identities = 62/207 (29%), Positives = 118/207 (57%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           YGKK P    ++  +  G  +  +GANGAGKTT ++ + G      G+I  + +D  + + R  +GY+P++  +    S+ ++L Y A L  +    A+  +  +L++  +     Q    FS G K+++ +AQ+L N+P +LI+DEPTA LDPK R+ F +++  L    + I +S+HI+S+++  +  + I+  G++++   R++
  S:    12 YGKK-PACHCISLTLRQG-IYGLLGANGAGKTTLMRMLCGVLAPTSGTIRFNTLDVSHEDYRDALGYLPQDFGYYPEFSALEFLLYMAALKGLPKPRAEKRSWELLEEVSLTPAAKQKIKTFSGGMKQRLGIAQSLLNDPRLLILDEPTAGLDPKERVRFRNLISRLGT-ERIILLSTHIVSDVEHIAGTILIMKEGRLLHQGTRDQ 215
>gi|146284241|ref|YP_001174394.1| ABC transporter, ATP-binding protein [Pseudomonas stutzeri A1501] >gi|145572446|gb|ABP81552.1| ABC transporter, ATP-binding protein [Pseudomonas stutzeri A1501] (341 aa)
Score = 291, Expect = 2.6e-24, Identities = 77/292 (26%), Positives = 160/292 (54%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEA--KLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRIKLVEDFEG--DKVGKYEV---NSNNEIIYEFKDKNE---LAELIDKLISKEILVK-FEKYYLSIEDLYKKYV 346
           P++ +  L K Y    HP +  ++ ++  GE  A +G NGAGKTT I  I G      G + + G D       +R+K+G +P+  F       F+ ++ T + ++    +A    F E +L+   +WD RN      S G K+++++A+ALS+ P IL +DEPTA +D + R D ++++  L++   +I +++H + E +  ++ + ++  G+I+  + ++   ++ G+    + L        +++  Y +   ++ N++++ F  ++E   +AEL+ +L +  I  K  +    S+E+++   V
  S:    37 PVIAIEQLTKTY-ASGHPALKRIDLEIRKGEIFALLGPNGAGKTTLISIICGIVNPGGGRVVVDGHDIVQDYRAARSKIGLVPQELFN----EGFESVWATVRFSRGLFGKAPDDSFLEKLLRDLSLWDKRNARILELSGGMKRRVMIAKALSHEPSILFLDEPTAGVDVELRRDMWEMVRGLRERGVTIILTTHYIEEAEEMADRIGVISKGEIILVEDKHVLMHKLGKKQLTLHLQRPLTAIPEELAGYPLELTDAGNQLVFTFDAQHEDTGIAELLKRLAAHGIDFKDLQSSQSSLEEIFVNLV 338
>gi|77166102|ref|YP_344627.1| ABC transporter, ATPase subunit [Nitrosococcus oceani ATCC 19707] >gi|76884416|gb|ABA59097.1| ABC transporter, ATPase subunit [Nitrosococcus oceani ATCC 19707] (317 aa)
Score = 291, Expect = 2.7e-24, Identities = 66/213 (30%), Positives = 120/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           L+    L + Y G  H  + N++F V  GE   F+G NGAGKTTT++ + GS     G + I+  D  +K  +++  +GY+PE       ++  +YL + A+LN+I   +      S + +  +  +  +   N S G ++++ +AQA+ ++P ++I+DEPT  LDP    +  +++ EL + H S+ +S+HIL E+    + V I++ G++V T
  S:     6 LIRAEQLYRYYSG--HCAVKNVSFDVRRGEILGFLGPNGAGKTTTMQILAGSLAPSSGQVRINDFDLLDKPKQAKQGLGYLPETPPLYRELTVTEYLAFCARLNRIPRNQQAGAIASAINRCGLKKVSKRLIGNLSKGYQQRVGIAQAIIHSPSVIILDEPTVGLDPIQIREIRELIRELAQKH-SVILSTHILPEVQAICDRVQIINQGELVLT 217
>gi|27467035|ref|NP_763672.1| ABC transporter ATP-binding protein [Staphylococcus epidermidis ATCC 12228] >gi|27314577|gb|AAO03714.1|AE016744_117 ABC transporter (ATP-binding protein) [Staphylococcus epidermidis ATCC 12228] (301 aa)
Score = 291, Expect = 2.7e-24, Identities = 72/206 (34%), Positives = 125/206 (60%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           L K Y GKK   +++L+  V P      +G NG+GK+T +  I    +   G++ I+GI+ KN +  R  +GY+P++  F   +   + LYY   L+KI  K+   + + IL+K  + D +N+   + S G KK++ +AQA+ ++P ++I+DEPTA LDP+ R+   ++L +L + +K + IS+HI+S+++   N + ILD G +VY
  S:     9 LSKSYDGKKD-ALNSLDL-VIPNGMFGILGRNGSGKSTLMNIIATILQPSKGTVTINGIEIKNSQKIRQMIGYLPQDFDFYPNMKVSEVLYYLGFLSKINQKDFDKYVDLILRKVNLIDYKNKKVKSLSGGMKKRLGIAQAILHDPKVIIVDEPTAGLDPEERVRLRNLLSDLAE-NKIVIISTHIVSDIESTCNKIAILDKGSLVY 212
>gi|194306051|dbj|BAG55485.1| putative ABC transporter, ATP-binding protein [uncultured bacterium] (254 aa)
Score = 291, Expect = 2.7e-24, Identities = 68/215 (31%), Positives = 127/215 (59%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +PL+E ++L + +       +DN++F V  GE   F+G NGAGKTTT+K + G  R   GS  I+G D  + ++ +++ +GY+P+      ++ + ++L +  ++ ++   +A+   E +L  F + D      ++FS G ++K+ +A AL +NP +L MDEPT  LDP++     D+L E +   +++F SSHIL  ++   + V I++ G+I+
  S:     1 MPQPLIEAIDLTRTF--GDFTAVDNISFTVNEGEIVGFLGPNGAGKTTTLKLLTGLLRPTAGSARIAGYDIASDSVAAKSNLGYVPDEPNLYEKLKAVEFLRFMGRIYRVPQAQAETHIEHMLTLFDLTDSAGSLLDSFSHGMQQKVAIAGALIHNPQVLFMDEPTVGLDPRSARIVKDLLIERRNRGQTVFFSSHILEIVEAMCDRVIIINKGRII 215
>gi|126179357|ref|YP_001047322.1| ABC transporter-related protein [Methanoculleus marisnigri JR1] >gi|125862151|gb|ABN57340.1| ABC transporter-related protein [Methanoculleus marisnigri JR1] (303 aa)
Score = 291, Expect = 2.7e-24, Identities = 69/212 (32%), Positives = 116/212 (54%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENT-FFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKL 285
           +D+L  ++  GE    +G NGAGK+TTI  ++G  +   G+  I G +     +E + K+GY+PE+  F+P R +  + L Y A+   +   E K   + +L    + D        +S G ++++ LA+AL N P ++I+DEPTANLDP+  +D+  I+  L     ++ +SSHILSE+     +V IL  GK++ +  R       M  R+ +
  S:    17 VDDLCLEIPAGEVFGLLGPNGAGKSTTILMLVGLIQPTSGACSIDGTEVAAHPIEVKKKIGYMPEDVGFYPDRTAE-ENLDYAARFYGLSEAERKRRVDDLLALVGL-DGVGTKVGGYSKGMRQRLGLARALVNEPAVVILDEPTANLDPRGVLDYRRIVRSLADRGTTVLVSSHILSEVSKVCTSVGILARGKLIASGDREMLSRAAMQDRVTI 229
>gi|157377591|ref|YP_001476191.1| ABC transporter-related protein [Shewanella sediminis HAW-EB3] >gi|157319965|gb|ABV39063.1| ABC transporter-related protein [Shewanella sediminis HAW-EB3] (244 aa)
Score = 291, Expect = 2.7e-24, Identities = 67/211 (31%), Positives = 115/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   +D+L+F    G+    +G NGAGKTT ++++ G  +   GS  I GID     +E++ ++G  P+      R+S  +Y+ Y A+LN +   +AK     +L +  M D+ ++    FS GQ+ K  LAQA+ + P  +I+DEPT  LD  +     D+L EL+     +  SSH++ E+    + V ++  GK+V
  S:     1 MIKVANLSKRI--GEVQALDDLSFIAKDGQITGLLGPNGAGKTTCLRTVFGLLQADMGSAEIDGIDVAKSPIEAKQQLGLFPDPFGLYERLSPREYVSYFAELNGLSRVDAKAATAKVLSQLHMDDIADRRCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGLDVMSTRVLRDLLKELKAHGHCVLFSSHVMQEVAALCDQVIVMAQGKVV 211
>gi|159896959|ref|YP_001543206.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] >gi|159889998|gb|ABX03078.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] (317 aa)
Score = 291, Expect = 2.8e-24, Identities = 63/210 (30%), Positives = 121/210 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG-IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ V+L ++Y   K+  ++ LN K+  G    F+G NGAGKTTT++ + G      G +++ G +  K   +   +GY+P+       +  ++YL + A+ + I+  + K   + +L    + + RN    + S G ++++ LA AL ++P IL++DEP + LDP+AR++  ++L  L+ + K+I +SSHIL+EL+       I+  G+++
  S:     6 IQTVDLLRRY--GKYTAVNKLNLKITLGSIFGFLGPNGAGKTTTLRMLAGLLEPSSGQVFLHGQLIQKTSTAAAIVGYMPDFFGVYDDLRVWEYLDFYARCHGIEPAKRKSTVDGLLDLVDLSEKRNAFVQHLSRGMQQRLCLAHALVHDPKILLLDEPASGLDPQARVELRELLRTLRDMGKTIILSSHILNELEDICTDFGIMARGELL 214
>gi|196239874|ref|ZP_03138645.1| ABC transporter related [Cyanothece sp. PCC 7425] >gi|196216133|gb|EDY10781.1| ABC transporter related [Cyanothece sp. PCC 7425] (325 aa)
Score = 291, Expect = 2.8e-24, Identities = 65/212 (30%), Positives = 122/212 (57%)
  Q:    55 PLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWD--LRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P+++V+ L+K Y       +K  ++   +  VY GE    +G NGAGKTT +K ++G  R   G  ++ G    +   + ++GY+ E+ +F   ++ +++L + A L +I S   K     +L    +     R +    +S G  +++ +AQAL N+PD++ +DEP + LDP  R  F +I+  L+K  K+IF +SH+L+++++  + V IL  G+++
  S:    17 PVVQVIGLQKNYRTGFWLNQKVTSLKGCSLTVYQGETFGLLGPNGAGKTTLLKILLGITRPSGGRGFLFGQPLGDRAVKQRIGYLAESPYFYDYLTGWEFLEFIAGLFRIPSAVRKKRIPELLDMVGLAQSAARKKQMRRYSKGMLQRVGMAQALINDPDLVFLDEPMSGLDPLGRYHFREIILLLKKQGKTIFFNSHVLADVEMICDRVAILAKGELI 235
>gi|147921295|ref|YP_684891.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110620287|emb|CAJ35565.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (321 aa)
Score = 290, Expect = 3.0e-24, Identities = 72/205 (35%), Positives = 119/205 (58%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSP---NNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L K Y G+  P + +L+ KV       F+G NGAGK+TTIK ++G  +   GS  + G+D    + E R ++GY+P+N  +   +++ + L +TA         A+L    + +  RM  L +++      FS G+ +++ +AQA  NNPD+LI+DEP A+LDP  R D  +++  L K   +IF S+HIL ++   S+ V IL+ G ++
  S:    14 LTKSYNGR--PVLKSLDLKVPRNSIFGFLGPNGAGKSTTIKLLLGLIKPTAGSGTVFGLDIARDSAEIRRRIGYLPQNPRYYDYMTARETLRFTAGF--FYKGPAELVERRVDETLRMTGLDDKADRKIKGFSGGELQRLGIAQAQINNPDLLILDEPAASLDPMGRRDVLEVMRSL-KNRTTIFYSTHILDDVQRVSDTVAILNKGTLI 218
>gi|134095759|ref|YP_001100834.1| ribosome-associated ATPase [Herminiimonas arsenicoxydans] >gi|133739662|emb|CAL62713.1| ABC transporter, putative monosaccharide-transporting ATPase [Herminiimonas arsenicoxydans] (931 aa)
Score = 290, Expect = 3.2e-24, Identities = 60/195 (30%), Positives = 119/195 (61%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +D++NF++  GE   F+G+NG GKTTT+K + G     +G  ++ G  +D  ++ +R ++GY+ ++    S +S    L   A+L  +   E    A+ +L +F + +  +  PN    G ++++ LA A+ + P++LI+DEPT+ +DP AR +F+ +L EL +  + +IFIS+H ++E +   + ++++  GK++ +
  S:   289 VDHVNFRIRRGEIFGFIGSNGCGKTTTMKVLTGLLAASEGRAWLFGHEVDPHDIATRRRVGYMSQSFSLYSELSVMQNLVLHARLFNVPEAEVAARAQQMLTRFGLEEEIDALPNKLPLGMRQRLSLAVAMVHGPELLILDEPTSGVDPVARDNFWRLLIELSRRDRVTIFISTHFMNEAE-RCDRISLMHAGKVLVS 485
Score = 162, Expect = 2.2e-09, Identities = 50/218 (22%), Positives = 111/218 (50%)
  Q:    51 DLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT----KMGYIPE---NTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL--QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           D+  P++ + ++  +Y   K   + +++  +        +G +G GK++ +    G+ +   GS  + G D +    R     ++ Y+P+      +P+ +S  + L + A+L    + E +   +S+ +   ++    +     S G K+K+ L  AL ++PD+LI+DEPT  +DP AR  F+ ++  +  Q+   S+ +++  + E   +   V  +D G+++ T
  S:     3 DMALPVIRLADIGLRY--GKTVALADISLDIPAQCMVGLIGPDGVGKSSLLALAAGARKMQQGSADVLGGDMRRKRHRDAVCPRIAYMPQGLGKNLYPT-LSVEENLQFFARLFGHDAAERRRRIDSLTRSTGLFPFLTRPVGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWSLIAGIRQQRPQISVIVATAYMDEAQGFDWLVA-MDGGRVLAT 225
>gi|167751068|ref|ZP_02423195.1| hypothetical protein EUBSIR_02053 [Eubacterium siraeum DSM 15702] >gi|167655986|gb|EDS00116.1| hypothetical protein EUBSIR_02053 [Eubacterium siraeum DSM 15702] (315 aa)
Score = 290, Expect = 3.3e-24, Identities = 65/210 (30%), Positives = 117/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LE+  L K Y  K    +D+    +  G  +  +G NGAGK+T I  + G  +   GSI  +  D  + +  +++G++P+N  F    ++ + + Y+  L  +K    K +A+ ILK+  ++D RN+     S G K+++ +AQAL   P ++I DEPTA LDPK RI F +++  L    K + +++HI++++   +  V ++D GK++
  S:    32 LEINQLTKSY-SKGKKALDSFTLTLEKG-VYGILGPNGAGKSTLINCVTGIIKPDSGSIAFT--DGNSHDYMSRLGFLPQNQDFYPNFTARELILYSMALKNVKVDNPKAYADGILKRVNLYDDRNKKVGAHSGGMKQRLGIAQALVGEPKVVIFDEPTAGLDPKERIRFRNVISSLAN-DKIVILATHIVTDIAFIAKNVVLIDGGKMI 236
>gi|16077355|ref|NP_388168.1| hypothetical protein BSU02860 [Bacillus subtilis subsp. subtilis str. 168] >gi|2415737|dbj|BAA22247.1| YcdI [Bacillus subtilis] >gi|2632572|emb|CAB12080.1| ycdI [Bacillus subtilis subsp. subtilis str. 168] (231 aa)
Score = 290, Expect = 3.3e-24, Identities = 71/208 (34%), Positives = 122/208 (58%)
  Q:    57 LEVVNLRKQYYGKKH-PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE-SRTKMGYIPE-----NTFFPSRISSF--DYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLH-KSIFISSHILSELDLYSNAVTILDNGK 264
           + +V+L+   +G  H P +D ++  +  GEF    G NGA K+T IK ++G  + ++G++ IS    +N E  R  +GY+P+     N  FPS +        Y   K  K  ++E  L  E  LK   MWDLR++   + S GQK+KI +A+ L++NPD+L++DEPT  +D  +R  F++ +  L K H +++ + +H  +E+  + + V  L+ G+
  S:     1 MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTLIKVMLGMLKPWEGTVTIS---KRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKGKWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDEPTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGE 215
>gi|167760376|ref|ZP_02432503.1| hypothetical protein CLOSCI_02750 [Clostridium scindens ATCC 35704] >gi|167662049|gb|EDS06179.1| hypothetical protein CLOSCI_02750 [Clostridium scindens ATCC 35704] (235 aa)
Score = 290, Expect = 3.4e-24, Identities = 62/206 (30%), Positives = 120/206 (58%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           L KQY  K    +D ++  ++ G  +  +GANGAGKTT ++ + G  R   G++    +D    + R ++GY+P++  +    +  D+L Y A L  +    A+     +L +  + ++ ++    +S G K+++ +AQAL ++P ILI+DEPTA LDPK R+ F D++  L K    + +S+HI+S+++  ++ + ++ +G+I++
  S:     8 LSKQY--KNKIAVDRISLTLHQG-VYGLLGANGAGKTTLMRMLCGILRPTSGTVMFENMDVSTEDYRKELGYLPQDFGYYPNFTGRDFLMYMAVLKGMTKSRAQKRCAKLLDEVGLKEMGDKKIKTYSGGMKQRLGIAQALLSHPRILILDEPTAGLDPKERVRFRDMIAALGK-ESIVILSTHIVSDIEHIADRILLMKDGQIIF 209
>gi|126657710|ref|ZP_01728864.1| ABC transporter [Cyanothece sp. CCY0110] >gi|126620927|gb|EAZ91642.1| ABC transporter [Cyanothece sp. CCY0110] (326 aa)
Score = 290, Expect = 3.4e-24, Identities = 67/220 (30%), Positives = 126/220 (57%)
  Q:    47 QEDIDLTKPLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESI-LKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           QE  +   P+++  NL K Y       +K  ++++ +F VY GE    +G NGAGKTT +K ++G  R   G   + G    NL  + K+GY+PEN ++   ++++++L + A L +I KS + +   E + L        + +    +S G  +++ +AQAL N+P+++  DEP + LDP  R    +I+  L++  K+IF +SH+L++++   + + +L  G ++
  S:    10 QEQQNELMPVVQTWNLSKVYRTGFWMNQKLRSLNDCSFSVYKGETFGLLGPNGAGKTTLLKMLLGIVRPTTGRAVLLGYPVGNLSVKQKIGYLPENAYYYDYLTAWEFLEFVAGLFQIPKSIQKRRIPELVDLVGLAQKTAKKKQLRQYSKGMLQRVGMAQALINDPEVVFFDEPMSGLDPLGRYQVREIVLSLKEQGKTIFFNSHVLTDIEKICDRIALLARGDLL 236
>gi|90406879|ref|ZP_01215071.1| putative ATP-binding component of a transport system [Psychromonas sp. CNPT3] >gi|90312116|gb|EAS40209.1| putative ATP-binding component of a transport system [Psychromonas sp. CNPT3] (306 aa)
Score = 290, Expect = 3.4e-24, Identities = 71/210 (33%), Positives = 118/210 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLE-SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++ N++K Y G     +  L+ +V  G+F+A +G NGAGK+TTI  I        G++ + G D +  LE +++++G +P+   F         L   A    IK KEA L A+  LK+  +WD RNQ     S G K+++++A+AL + P +LI+DEPTA +D + R   +  L EL     +I +++H L E ++    + I+DNG +V
  S:     4 IDLNNIKKVYKGGVE-ALKGLSLQVEEGDFYALLGPNGAGKSTTIGIIASLVNKSSGTVSVFGYDLDSQLELAKSQIGLVPQEFNFNPFEPPIQILVNQAGYYGIKRKEALLRAQKYLKQLGLWDKRNQPARELSGGMKRRLMIARALMHEPRLLILDEPTAGVDIEVRRTMWAFLQELNSNGVTIILTTHYLEEAEMLCRNIGIIDNGHLV 214
>gi|116754529|ref|YP_843647.1| daunorubicin resistance ABC transporter ATPase subunit [Methanosaeta thermophila PT] >gi|116665980|gb|ABK15007.1| daunorubicin resistance ABC transporter ATPase subunit [Methanosaeta thermophila PT] (309 aa)
Score = 290, Expect = 3.4e-24, Identities = 62/210 (29%), Positives = 121/210 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++V +L K++       +D+++F V  GE   F+G NG+GK+TTI+ + G+ R  +G+  I G D     + +RT +G++PE       ++++  L +  +L  I  +E +  A  +LK+F ++D R      FS G ++++LL  AL N+P +LI+DEP + LD ++     +++ EL +   ++F+++H + +     + V I++ G I+
  S:     4 IQVSDLTKRF--GSFTAVDHISFSVAEGEIFGFLGPNGSGKSTTIRMLTGTVRPDEGTAAIMGYDICKHPIRARTSIGFVPEMANAYVELTAWRNLMFMGELYGIPRRERERRASELLKRFGLYDRRGDQVRAFSKGMRQRLLLCMALINDPPVLILDEPASGLDVESSRLIKEVIRELNREGTTVFLTTHDIEDASQLCDKVAIINRGVII 213
>gi|118728013|ref|ZP_01576592.1| ABC transporter related [Clostridium cellulolyticum H10] >gi|118662616|gb|EAV69298.1| ABC transporter related [Clostridium cellulolyticum H10] (236 aa)
Score = 290, Expect = 3.5e-24, Identities = 75/217 (34%), Positives = 119/217 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSK-EAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           ++ + NL K Y   K   +D ++    PGE    +G NGAGK+TTIKSI G  + F+G I I G  NK L+++   GYIPE       ++  ++  + AK  K++S  E K  A +I ++  ++D +++     S G  +K+ +A AL   P  ++ DEP   LDPKA  +   IL EL+   KSI +S+HI+  ++   +   I++ GKIV    +N
  S:     1 MIAINNLTKSY--SKFKAVDGVSLTAKPGEITILLGPNGAGKSTTIKSIAGLLK-FEGEITIWGCPNKTLDAKKVFGYIPETPALYDLLTPMEHAEFIAKAYKLESGWEDK--ARAIFERLEIYDKKDKYIRELSKGMTQKLSIALALLIEPKAVLFDEPLVGLDPKAINEVLKILVELRSQEKSILVSTHIIDTINDVWDRAYIMNKGKIVSEITKN 213
>gi|89053237|ref|YP_508688.1| ABC transporter related [Jannaschia sp. CCS1] >gi|88862786|gb|ABD53663.1| ABC transporter related [Jannaschia sp. CCS1] (310 aa)
Score = 290, Expect = 3.5e-24, Identities = 69/235 (29%), Positives = 129/235 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFE 290
           +L V  L K Y G     +D ++  +  GE  A +G NGAGKTT I +I G  +   G + + G D +    E+R  +G +P+       +  F+ +  T + ++        + + E IL++  +WD ++ +    S G K+++L+A+ALS+ P +L +DEPTA +D + R D ++I+ EL++   +I +++H + E +  ++ V ++  GKI+  ++++      G+   RI L E  E
  S:     4 ILTVDRLTKIYDGG-FTALDTVSLDIAEGEILALLGPNGAGKTTLISTICGIVQPTSGKVSVGGHDTQTGYREARKLIGLVPQEI----NLEPFEKVINTVRFSRGLFGKPRDEAYLEKILRQLSLWDKKDNAIRELSGGMKRRVLIAKALSHEPRVLFLDEPTAGVDVELRRDMWEIVRELKESGVTIILTTHYIEEAEAMADRVGVIAGGKILLVEEKSALMARMGQKELRIDLAEPIE 239
>gi|119512883|ref|ZP_01631948.1| ABC transporter-like protein [Nodularia spumigena CCY9414] >gi|119462465|gb|EAW43437.1| ABC transporter-like protein [Nodularia spumigena CCY9414] (331 aa)
Score = 290, Expect = 3.7e-24, Identities = 68/221 (30%), Positives = 121/221 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNEN 276
           ++EV +L K Y     P I+++ F V PGE   F+G NGAGKTTT++ + G     +G   I+G D    +L  R ++GY+PE       ++   +L++ A++  I + +      + + +  + D         S G ++++ +AQA+ ++P  +I+DEPT  LDP+  I+  +++  L   H +I +S+HIL E+ +  + V I++ G +V T   N  EN
  S:     1 MIEVEHLSKTY--GSTPAINDVTFSVEPGEILGFLGPNGAGKTTTMRILAGYLPATEGKARIAGFDVNEDSLAVRQRIGYLPETPPLYPEMTVEGFLHFVARIKGISAGDRTEKVTAAITRCNLEDKSKVIIRKLSKGYRQRVGIAQAIVHDPPAIILDEPTVGLDPRQIIEVRNLIKSLAGTH-TIILSTHILPEVSMTCSRVAIINKGNLVAT---NTPEN 217
>gi|188585535|ref|YP_001917080.1| ABC transporter related [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350222|gb|ACB84492.1| ABC transporter related [Natranaerobius thermophilus JW/NM-WN-LF] (260 aa)
Score = 290, Expect = 3.8e-24, Identities = 69/223 (30%), Positives = 126/223 (56%)
  Q:    44 RVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           +++QE       +++V  L KQY G     +DN++F+V  GE  AF+G NGAGK+T IK +    R   G I ++G +    E R +  MG + ++      +++++ LYY   L  +   E K   +++L    +W+ RN     FS G K+++ + +AL + P ILI+DEPT+ LD + R   ++ + E+ + +  ++F+++H L E +  +  + I+D G+I+
  S:     5 QLDQEANSENNKIIQVNQLVKQYEGGV-TAVDNISFQVDEGEIFAFLGPNGAGKSTAIKILTTVSRPTSGEILVNGYNTAKEEHRVRDAMGVVFQDHTLDKELTAYENLYYHTVLYGVPKNERKDRIQTMLDNVGLWERRNSLVKTFSGGMKRRVEIVRALLHYPKILILDEPTSGLDAQTRFFLWNHIDEINRDYNITVFLTTHNLEEAEKVAENIAIIDQGQIL 229
>gi|147919980|ref|YP_686266.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] >gi|110621662|emb|CAJ36940.1| ABC-type transport system, ATPase component [uncultured methanogenic archaeon RC-I] (308 aa)
Score = 290, Expect = 3.8e-24, Identities = 69/211 (32%), Positives = 117/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++  +L K Y G K   +D+++  V  GE   F+G NGAGKTTTI  ++G      G  +I  ID   K LE++   GY+P+   F + +S+   L Y ++   +    +      +L++  + D   +    +S G K+++ LAQAL N+P  + +DEPT  LDP+  I F +I+ E+    +++F SSH+L+E+    N + I+  G+IV
  S:     4 MIKTESLTKVYDGVK--AVDSVSLSVGGGEVFGFLGPNGAGKTTTIGMMVGLIEPSGGKCWIDDIDVTRKPLEAKRITGYLPDGVGFYANLSARQNLKYFSRFYGMTDTASDARITELLRRVGL-DKVEKPVGGYSRGMKQRLGLAQALLNDPKYVFLDEPTNGLDPEGVIQFRNIIKEMAAEGRTVFFSSHVLNEVQQVCNTIGIISKGRIV 213
>gi|52140671|ref|YP_086159.1| ABC transporter, ATP-binding protein [Bacillus cereus E33L] >gi|51974140|gb|AAU15690.1| ABC transporter, ATP-binding protein [Bacillus cereus E33L] (243 aa)
Score = 289, Expect = 3.8e-24, Identities = 65/217 (29%), Positives = 119/217 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           +LE++N  K Y G K   +D+LN  V  G+   F+G NGAGK+TTIKS++G     +G I++ G  +    +  +  M YIP+N     +++   YL + A + K+ +++ +   +     F +        +++S G K+K+ +  A+ + P +L++DEP   LDPKA +    I+ EL +   +IF S+H+L   +   N + +++ GK+  + + N
  S:     6 MLEIINFSKTYKGGKK-AVDHLNITVKAGDIFGFIGHNGAGKSTTIKSLVGVIDFEEGEIFVDGHSVKKDPIACKRVMAYIPDNPDLYEQLTGIQYLNFVADVFKVSARDREEQIQKYGNAFEITPYLGDLISSYSHGMKQKVAIISAVLHKPKLLVLDEPFVGLDPKASVVLKGIMKELCEKGSAIFFSTHVLDVAEKLCNKIAMINRGKLALSGEVN 223
>gi|51892954|ref|YP_075645.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] >gi|51856643|dbj|BAD40801.1| ABC transporter ATP-binding protein [Symbiobacterium thermophilum IAM 14863] (263 aa)
Score = 289, Expect = 3.8e-24, Identities = 64/214 (29%), Positives = 118/214 (55%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           T+P + + NL K Y G  HP +  LN  V PGE   F+G NGAGKTTT+K ++G      G + I G D       ++  +GY+P+       +++ ++L++ A L  +   E K  AE +L+   +    ++   +FS G K+K+ +A AL + P +L++DE T  LD +A  +  D++    +   ++ +++H+LS  +  S+ + ++  G+++
  S:     7 TEPAILLENLTKSYNG--HPAVQGLNLAVRPGEIFGFLGPNGAGKTTTMKMMVGLLPPTSGRVVILGHDVWRNPGPAKRAIGYVPDTPILHELLTAREFLWFMADLYGMSRAEGKARAEELLQMMGLTPQADRLIRDFSLGMKRKMAIATALLHRPRVLLLDEVTNGLDARAAREVKDLIRAWARAGVAVVLTTHVLSVAEELSDRIGLIHRGRLI 220
>gi|23098344|ref|NP_691810.1| ABC transporter ATP-binding protein [Oceanobacillus iheyensis HTE831] >gi|22776570|dbj|BAC12845.1| ABC transporter ATP-binding protein [Oceanobacillus iheyensis HTE831] (302 aa)
Score = 289, Expect = 3.9e-24, Identities = 82/260 (31%), Positives = 147/260 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYE--VNSNNEIIYEFKDKNEL 315
           LL V  L K Y  K+   I+ ++FKV      A +G NGAGKTTT+K + G  ++  G I       K  + R  +GY+P+   F S ++ +++L Y AKL  +    AK  A  +L+K  ++D +++   ++S G K+++ +AQA+ + P +L++DEP ++LDP  R +   ++ EL+K   +IF S+HIL + +  S+ + +L  GK++ +   +  ++      IKL  +F+ D +  Y+  V+  + +   + DKN+L
  S:     3 LLTVNKLTKTY--KEKTIINQIDFKVPDNACVALIGPNGAGKTTTLKMLAGLLQSSSGEIIFHNRPKKG-DFRNYIGYLPQYPTFYSWMTGYEFLVYCAKLCLLSPTAAKSRANELLQKTGIFDAKDKRIASYSGGMKQRLGIAQAIIHQPKLLLLDEPVSSLDPIGRKEILLLMEELKK-EMTIFFSTHILRDAEEVSDELILLHQGKVIESGSISNLQDTYQTSMIKL--EFQ-DSLEMYQEKVSQLSNVSDTYIDKNKL 257
>gi|167622002|ref|YP_001672296.1| ABC transporter related [Shewanella halifaxensis HAW-EB4] >gi|167352024|gb|ABZ74637.1| ABC transporter related [Shewanella halifaxensis HAW-EB4] (244 aa)
Score = 289, Expect = 3.9e-24, Identities = 63/211 (29%), Positives = 116/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   +++L+F    G+    +G NGAGKTT ++++ G  +  +G   I GID     + ++ ++G  P+      R++  +Y+ Y A+LN +  KEAK+    ++ K  + D+ ++    FS GQ+ K  LAQA+ + P  +I+DEPT  LD  +     DIL +L+     +  SSH++ E+    + V ++  G++V
  S:     1 MIQVSNLSKRIGDVQ--ALNDLSFSALDGQITGLLGPNGAGKTTCLRTVFGLLKPDNGIAEIDGIDIAKSPVAAKQQLGLFPDPFGLYERLTPREYISYFAELNGLSRKEAKIATSKVIDKLHLADIADRQCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGLDVMSTRVLRDILRDLKNQGHCVLFSSHVMQEVAALCDQVIVMAEGRVV 211
>gi|146308094|ref|YP_001188559.1| ABC transporter related [Pseudomonas mendocina ymp] >gi|145576295|gb|ABP85827.1| ABC transporter related [Pseudomonas mendocina ymp] (307 aa)
Score = 289, Expect = 4.0e-24, Identities = 64/211 (30%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++++ NL K++   +H  +D+L+F+V PGE   F+G NGAGK+TT+K + G      G+  I G D   + LE++ ++GY+PE       ++   +L + A++   +  E K   +  +++  +  +  QS    S G K+++ LAQA+ ++P +LI+DEPT  LDP  +     ++  L +  K + IS+HIL E+        ++  G+++
  S:     1 MIDIRNLTKRF--AQHTAVDDLSFQVQPGEVLGFLGPNGAGKSTTMKMLTGFLAPTSGTASILGCDIQTQTLEAQRQIGYLPEGAPCYGDMTVRGFLDFIAEVRGFRGSEKKQRVQRAVEQVELEKVLEQSIETLSKGFKRRVGLAQAILHDPRVLILDEPTDGLDPNQKHQVRQLIQGLAR-DKIVIISTHILEEVTALCTRAVVIAQGRLL 210
>gi|186681014|ref|YP_001864210.1| ABC transporter related [Nostoc punctiforme PCC 73102] >gi|186463466|gb|ACC79267.1| ABC transporter related [Nostoc punctiforme PCC 73102] (339 aa)
Score = 289, Expect = 4.1e-24, Identities = 72/242 (29%), Positives = 130/242 (53%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI---DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY----TQKRNKNENGEMCYRIKLVEDFEGDKVGK 296
           P + + NL+K+Y       + +++F+V PGE    +G NGAGKTTT++++        G I +SGI   DN  + +R ++GY+ +       ++  + L   A L  +    AK   E++L    + +  N+    +S G +K++ LA  L + PD+L++DEPT  LD + R   +D L +L+    ++ I+SH L E+D  ++ V I+D G ++     +Q ++K     +  RI+     E  ++ K
  S:     3 PAVLIQNLQKRY--GTVVAVQDVSFQVEPGEIFGLLGPNGAGKTTTLRALCTLTTPDAGKIEVSGISVLDNPRV-ARQRLGYVAQEVAIDKVLTGKELLQLQAALYHLPRAVAKQRIETVLDLLGLQEYANKKTGTYSGGLRKRLDLAAGLLHAPDVLVLDEPTVGLDIETRFVVWDFLRKLRASGTTVVITSHYLEEIDALADRVAIIDRGVVIASGTPSQLKDKVGGDRITLRIREFSPIEEAEIAK 248
>gi|90421954|ref|YP_530324.1| ABC transporter related [Rhodopseudomonas palustris BisB18] >gi|90103968|gb|ABD86005.1| ABC transporter related [Rhodopseudomonas palustris BisB18] (301 aa)
Score = 289, Expect = 4.2e-24, Identities = 70/205 (34%), Positives = 116/205 (56%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE--SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           V ++ K+Y   +   + +++F++ PG   A VG NGAGKTT IK ++G  R   G I +   D    E   R  +GY+PEN  F + ++  + L + A+L +I    A   A  +L++  +    ++    +S G ++++ LAQAL   P +L++DEPT  LDP  R  F++IL EL+    ++ ISSH L+EL+  +  V I++ G
  S:     7 VSHVEKRYRAVR--ALRDVSFELLPGRLSALVGHNGAGKTTLIKLMLGLIRAEHGDIRVLDEDPAAGEFAGRRLLGYLPENVAFNAALTGRETLAFYARLKQI----APASAWPLLERVGLAPAADRKVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLDPALRQTFYEILDELRDDGATVLISSHALNELEDRAEHVLIMNRG 207
>gi|120554373|ref|YP_958724.1| ABC transporter related [Marinobacter aquaeolei VT8] >gi|120324222|gb|ABM18537.1| ABC transporter related [Marinobacter aquaeolei VT8] (306 aa)
Score = 289, Expect = 4.2e-24, Identities = 66/220 (30%), Positives = 125/220 (56%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           +P + V +L K  Y      + ++N ++YPGE  A +G NGAGKTT I  I G     DG +  +G D   +  ++R  +G +P+     S  + +D + ++  L     K A +  E +LK   +WD RN    + S G K+++++A+ALS+ P IL +DEPTA +D + R D ++++ +L++   +I +++H + E +  ++ + ++  G+I+  + +N+
  S:     2 QPDISVKHLNK-IYEDGFQALKDVNLEIYPGEIFALLGPNGAGKTTLISIICGIVNKSDGEVKAAGHDIVKQYRKAREAIGLVPQELNTDSFETVWDAVSFSRGLFGKAPKPAHI--EKVLKDLSLWDKRNNRIMSLSGGMKRRVMIAKALSHEPRILFLDEPTAGVDVELRRDMWEMVRKLRENGTTIILTTHYIEEAEEMADRIGVIRQGEIILVEDKNR 220
>gi|119945162|ref|YP_942842.1| ABC transporter for copper ATP-binding protein [Psychromonas ingrahamii 37] >gi|119863766|gb|ABM03243.1| ABC transporter for copper ATP-binding protein [Psychromonas ingrahamii 37] (303 aa)
Score = 289, Expect = 4.3e-24, Identities = 74/211 (35%), Positives = 117/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLE---SRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LLE VN   Q     H    N++ K+  GE     G NGAGKTT +K I+G  +   G + + G+D +N +   SR K+GY+PEN  F  +++ F+ L Y A+L   KS   K   E +L+K  +    N+    +S G ++++ LAQA   +P +L++DEPT  LDP A  +F+  + +L+    +I + SHIL  ++ + +   IL  G+ V
  S:     7 LLEQVNKNYQQLAALH----NIDLKLSAGEVLGLFGHNGAGKTTMMKLILGIIKAGSGKVAVFGVDPQNKKAWSSRKKIGYLPENVSFYDQLTGFEVLTYFARL---KSANKKQVVE-LLEKVGLSFAENRPVKTYSKGMRQRLGLAQAFLGDPKLLLLDEPTVGLDPTATKEFYTSVDQLKSNGATIILCSHILPGIEQHIDRAMILSGGESV 212
>gi|168185609|ref|ZP_02620244.1| ABC-type multidrug transport system, ATP-ase compoment [Clostridium botulinum C str. Eklund] >gi|169296494|gb|EDS78627.1| ABC-type multidrug transport system, ATP-ase compoment [Clostridium botulinum C str. Eklund] (310 aa)
Score = 289, Expect = 4.4e-24, Identities = 61/211 (28%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDG--SIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE  N+ K+Y   +H  IDN +  V  G+    +G NGAGKTT I  I+G  +++ G  S++   +    +  ++++G  P+       +++++ + +  +L  +K K+ K   +  L+   +WD R   P  +S G K+++ +A A+ + P ++IMDEPT  +DP++R    + + +L K+  +I  +SH + E++   N + I+D GK++
  S:     2 ILEAKNIVKRY--GEHLAIDNASLSVMEGQIFGLLGPNGAGKTTMINIIVGLLKSYSGEISVFQKNLLRDEMYIKSQIGIAPQEAALFHDLTAYENVTFFGRLYGLKGKKLKDGVKEALEFTELWDRRKDYPKQYSGGMKRRLNIACAIVHKPKLIIMDEPTVGIDPQSRKHILNSIKKLNKMGSTIIYTSHYMEEIEELCNEIVIMDKGKVI 212
>gi|158335487|ref|YP_001516659.1| ABC transporter, ATP-binding protein [Acaryochloris marina MBIC11017] >gi|158305728|gb|ABW27345.1| ABC transporter, ATP-binding protein [Acaryochloris marina MBIC11017] (316 aa)
Score = 289, Expect = 4.4e-24, Identities = 83/290 (28%), Positives = 160/290 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG---IDNK-NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK----RNKNENGEMCYR----IKLVEDFEGDKVGKYEVN---SNNEIIYEFK-DKNELAELIDKLISKEI-LVKFEKYYLSIEDLYKK 344
           P++    L KQ+       ++ ++ +V  GE +  +G NGAGKTT I+ +  +     GSI I+G   I N+ N + + ++G++P++      +  +DYL Y A+L  ++  +     + +L    + + R+   +  S G K+++ LA+ + + P +L++DEP + LDP AR+ F   L  LQ+   +IFISSHILS+L+ +  ++ I+  G++V + +     N+++  ++       +  VE F  D    +E       ++I   F    +++  L+  LIS    ++ F +   S+ED++ K
  S:     5 PVIATQQLTKQF--GDSIAVNQVDLQVQQGEIYGLIGPNGAGKTTLIRMLATAEEPTLGSIAIAGQTLIQNQPNPDIKRRIGFLPDDFPLYDDLLVWDYLEYFARLYYLQEPDLSNRLKEVLALVDLDNKRHSPISTLSRGMKQRLSLARTIIHKPTLLLLDEPVSGLDPVARVQFRQTLKTLQQQGLTIFISSHILSDLEDFCTSIGIMQMGQLVESSELRALYNRDQTQQLIISTVTDLAPVETFLQDHAFVHECKVLPDKHQIAVTFSGTDDDIVALLRSLISHNFPIIDFHRTQESLEDIFIK 309
>gi|159040948|ref|YP_001540200.1| daunorubicin resistance ABC transporter ATPase subunit [Caldivirga maquilingensis IC-167] >gi|157919783|gb|ABW01210.1| daunorubicin resistance ABC transporter ATPase subunit [Caldivirga maquilingensis IC-167] (334 aa)
Score = 289, Expect = 4.4e-24, Identities = 69/210 (32%), Positives = 117/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHP--TIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ +NL K+Y     P   +D++NF V  GE   F+G NGAGKTTTIK +    R  +G+  ++G D   +  + R  +G +P+       ++ ++ L   A L  I  KEAK  A  +L    +    ++    +S G ++++ +A  L N P IL +DEPT  LD + R   +  + +L ++L  +IF+++H L E D Y + + I+D+GKI+
  S:     7 IKAINLTKRY----GPILAVDHINFDVKYGEVFGFLGPNGAGKTTTIKMLTTVTRPTEGTALVNGYDIVKQPAKVRESIGVVPQEYTSDEDLTGWENLMLIASLYGIPKKEAKERATELLNLVELSHAADRKVETYSGGMRRRLEIAMGLINTPKILFLDEPTLGLDAQTRAAIWSYVYKLKEQLGTTIFVTTHYLEEADQYCDRIAIIDHGKIL 217
>gi|154249400|ref|YP_001410225.1| ABC transporter related [Fervidobacterium nodosum Rt17-B1] >gi|154153336|gb|ABS60568.1| ABC transporter related [Fervidobacterium nodosum Rt17-B1] (295 aa)
Score = 289, Expect = 4.4e-24, Identities = 76/216 (35%), Positives = 123/216 (56%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSI-YISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAK-LFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++P+L+V NL+K Y G K   +D ++F+++PGE  + +G NGAGKTTTI+ I G     +G I Y    +  N + + ++G   +  F+      F+ L     L    S   K L  + IL  F + + +     + S GQK+++ +A A  N+PDI+ +DEPT  LDP AR   +DI+ + + L KSI +++H + E  + S+ V I+D GKI+ T
  S:     6 SEPVLKVSNLKKYYPGVK--AVDGVSFELFPGEIISVLGPNGAGKTTTIEIIEGLRVKDEGEIIYFGKYNEINDKIKDRIGVCFQENFY------FEELTVVEILKLFSSLYTKCLPIDEILNTFELNEKKKTRVKHLSGGQKQRLAVALAFVNDPDIVFLDEPTVGLDPHARRHLWDIILKFKLLGKSIILTTHYMDEAQILSDRVYIIDYGKIIAT 215
>gi|196166272|ref|ZP_03126803.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-23m63] (305 aa)
Score = 289, Expect = 4.5e-24, Identities = 92/291 (31%), Positives = 156/291 (53%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY--TQKRNKNENGEMCYRIKLVEDFEGDKVG---------KYEVNSNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G      G+I + G  +      S   +GY+P+   F + +   +YL    ++  +  +E K+ +E +L    + + + +    FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I    T    K+ +G+    ++   + E  K           KY   +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     3 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLEPDSGTIDVCGEKVTYGGTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKQEIKIRSEELLSLVGLGNEKRRI-GGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRLLLEFASNDEIQKFKSSGDIKSLLKYSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 304
>gi|168178169|ref|ZP_02612833.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] >gi|182671259|gb|EDT83233.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] (262 aa)
Score = 289, Expect = 4.7e-24, Identities = 72/228 (31%), Positives = 138/228 (60%)
  Q:    52 LTKPLLEVVNLR--KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI----VYTQKRNKNENGEM 279
           + KP   VV++R  K  YG K   +  +N  V  GE   ++G NGAGK+TT+K ++G  + ++G + I G  I  +N+E + K+GY+PEN      +++++Y+ +  ++  ++ KE    A+ ++  F + +  +   +++S G ++K+L+  +L +NPDIL +DE  + LD  + + F ++L +L    K+IF SSHI+  ++  S+ + +L+NG+I     + + + KN  G +
  S:     1 MDKPNDVVVSIRNLKMSYGSKE-VLKGINLDVNKGEIIGYIGPNGAGKSTTVKIMLGLVKGYEGEVKIFGNNISYENVEYKHKIGYVPENGEIYDNLTAYEYITFLGEIYGMELKEVNNKAKKLMSLFGIKEAYHSRISSYSKGMRQKLLIISSLIHNPDILFLDESLSGLDANSVLVFKEVLSKLASEGKTIFYSSHIMEVVEKISSRIILLNNGQIAADGTFEELKKKNMEGSL 235
>gi|148257268|ref|YP_001241853.1| copper ABC transporter, ATP-binding protein NosF [Bradyrhizobium sp. BTAi1] >gi|146409441|gb|ABQ37947.1| Copper ABC transporter, ATP-binding protein NosF [Bradyrhizobium sp. BTAi1] (306 aa)
Score = 289, Expect = 4.7e-24, Identities = 66/207 (31%), Positives = 116/207 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           + + ++ K Y   K   +  ++F +  GE  A +G NGAGKTT +K ++G  R   G+I + G +       SR ++GY+PEN  F + +S  +   + A+L +   +EA     ++L    + D   +  N +S G ++++ LAQAL   P +L++DEPT  LDP+ R  F+D++ +L     ++ +SSH L+EL+  +  V I++ G
  S:     5 IHIADVIKHY--NKVEAVRGVSFDLAAGEMVALIGHNGAGKTTLMKMMLGLIRPTRGTIAVLGENPAAGEFSSRRQLGYLPENVAFDAALSGRETQAFYARLKREPVQEAL----ALLDIVGLGDAAKRRVNTYSKGMRQRLGLAQALIGRPRVLLLDEPTTGLDPELRQTFYDVIQKLAAEGTTVLLSSHALTELEERAGRVIIMNRG 207
>gi|196183489|gb|EDX78472.1| ABC transporter, ATP-binding protein [Microcoleus chthonoplastes PCC 7420] (340 aa)
Score = 289, Expect = 4.8e-24, Identities = 64/203 (31%), Positives = 112/203 (55%)
  Q:    64 KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           K+YYG     + +++  V PGE    +G NGAGKTTTI+ +    +   G I +SGI         R ++GY+ +       ++  + L   A L  + S   K    ++++   + D  ++    +S G +K++ LA  L + PD+L++DEPT  LD ++R+  ++ L +LQK   +IFI+SH L E+D+ ++ V I+D G ++
  S:    11 KKYYGDVE-AVKDISLNVEPGEIFGLLGPNGAGKTTTIRCLCTLSKPDAGKIEVSGISAIANPRAVRRRIGYVAQEVALDKVLTGRELLQLQADLYHLPSNVGKERVNTMIEVLGLQDYADKKTGTYSGGIRKRLDLASGLLHKPDVLVLDEPTVGLDIESRVVVWNFLRQLQKAGTTIFITSHYLEEVDILADRVAIIDKGVVI 214
>gi|169826897|ref|YP_001697055.1| ABC transporter ATP-binding protein [Lysinibacillus sphaericus C3-41] >gi|168991385|gb|ACA38925.1| Hypothetical ABC transporter ATP-binding protein [Lysinibacillus sphaericus C3-41] (311 aa)
Score = 289, Expect = 4.8e-24, Identities = 69/211 (32%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ +L K+Y       +D+LN  +  G    FVGANGAGK+TT   +        G   I+G  +  +  E R ++GY+P+      ++   +YL +      I+  E ++    +L+   +   R +  +  S G K+++ LA+AL ++P +LI+DEP + LDP+AR++  DIL  L+ + K+I ISSHIL EL    + + ++DNGK++
  S:     1 MIEIRDLTKRY--GSFTALDHLNLSLEEGIVFGFVGANGAGKSTTFSILATLLSPTSGDALINGKSVVKEPKEVRKQIGYMPDFFGVYDQLKVDEYLDFYGASYGIQLAERQVLIPQLLELVNLTSKRYEYVDLLSRGMKQRLCLARALIHDPKVLILDEPASGLDPRARVEMRDILRNLKSMGKTILISSHILPELAEMCDEIGVIDNGKLI 211
>gi|88809146|ref|ZP_01124655.1| putative multidrug efflux ABC transporter [Synechococcus sp. WH 7805] >gi|88787088|gb|EAR18246.1| putative multidrug efflux ABC transporter [Synechococcus sp. WH 7805] (348 aa)
Score = 288, Expect = 4.9e-24, Identities = 63/225 (28%), Positives = 129/225 (57%)
  Q:    46 NQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           N  +  +  P + + NL K Y  K    ++NL+  +  G F+A +G NGAGK++ I+ +     +  G ++I+GID   K  E+RT++GY+ + +     ++ +++L +TA L+ +  K  K   + ++++  M +   +    +S G ++++ L  AL + P I I+DEP+  LDP++R   +++L    +  +++ +S+H L E++  ++ + ILD+GK++   K
  S:     4 NHAEAGIDHPAISIKNLSKSY--KNTQALNNLSLNIPFGCFYALLGPNGAGKSSLIRILATLMGSDSGEVWINGIDALKKPREARTQIGYVAQESSLDKILTGYEHLTFTADLHHLPRKIKKERIDEVIEQLNMSEWVYRRTKTYSGGMRRRLELGCALLHKPKIFILDEPSVGLDPESRQLIWEVLKASVENGQTVLLSTHQLQEVEQLADQLAILDHGKLIAAGK 228
>gi|170076798|ref|YP_001733436.1| ABC transporter, ATP-binding protein [Synechococcus sp. PCC 7002] >gi|169884467|gb|ACA98180.1| ABC transporter, ATP-binding protein [Synechococcus sp. PCC 7002] (328 aa)
Score = 288, Expect = 5.0e-24, Identities = 65/201 (32%), Positives = 120/201 (59%)
  Q:    66 YYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI----KSKEAKLF------AESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +  K   ++ + + +V  GE    +G NGAGKTT +K ++G  R   G+  + G    + ++R ++GY+PEN +F   ++++++L +TA L +I    + K  KL       A+ + KK ++          +S G  +++ +AQAL N+PD++ +DEP + LDP  R    +I+  L+   K+IF +SHIL++++L  + + IL  G+I+
  S:    28 WLNKTGESLKSCSLEVLGGETFGLLGPNGAGKTTLLKILLGIIRPTAGNATLLGKPFGDRQTRQRIGYLPENAYFYDFLTAWEFLDFTAGLFQIPRGKRQKRIKLLLDTVGLAQEVAKKRQL--------RKYSKGMLQRVGMAQALINDPDLVFLDEPMSGLDPLGRYQVREIILSLKAQGKTIFFNSHILADVELICDRLAILSKGEII 230
>gi|160894854|ref|ZP_02075628.1| hypothetical protein CLOL250_02404 [Clostridium sp. L2-50] >gi|156863285|gb|EDO56716.1| hypothetical protein CLOL250_02404 [Clostridium sp. L2-50] (317 aa)
Score = 288, Expect = 5.0e-24, Identities = 100/292 (34%), Positives = 159/292 (54%)
  Q:    47 QEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQK-LHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCY-RIKLVEDFEG------DKVG--KYEVNSNNEIIYEFKDKNELAELIDKLISKEILVK--------FEKYYLSI 338
           +E  +L++ LLE  NL KQY    H  +D++N  +  G  + F+G NGAGKTT +K I G  +   G I + G   K+L+  R+++G + E       +++++ L    KL  IK K    + E IL+   + D+  +   +FS G K+++ +  AL   PD+L++DEP   LDP+   +  D +  LQK  + +I ISSHIL EL   +    I+ NG ++  Q+  + E    C  RI+L  D         D +G   Y+V ++ E I+ F+  NE A L  +L    I VK         E Y+L++
  S:     8 KEMKNLSEMLLETRNLTKQY--GHHKAVDSVNMHIKKGAIYGFIGRNGAGKTTCLKMISGLSKPTCGEIEMFGYKGKDLQKVRSRIGCLIEAPGLYGDMTAYENLNIKCKLFGIKKKS---YIEEILRIIGLEDVGKKKTKHFSLGMKQRLGIGLALVGEPDLLVLDEPINGLDPQGIAEIRDTIQRLQKEKNMTICISSHILEELSKIATDYGIIHNGSLL--QEITREELIRRCSERIELTLDHPKQAIPVMDSMGFTNYQV-TDKEHIHIFERLNESAALNMELAKSGIPVKGISITSEELETYFLNL 310
>gi|153870759|ref|ZP_02000090.1| ABC-type multidrug transport system, ATPase component [Beggiatoa sp. PS] >gi|152072776|gb|EDN69911.1| ABC-type multidrug transport system, ATPase component [Beggiatoa sp. PS] (323 aa)
Score = 288, Expect = 5.1e-24, Identities = 66/213 (30%), Positives = 121/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           L+ V NL + Y       ++N+ F+V  G+   F+G NGAGKTTT++ I G+     G I ++G D  +  L+++  +GY+PE       +   +YL + AKL+ I   E       ++++  +  + ++   N S G ++++ +AQA+ +NP ++I+DEPT  LDP    +   ++  L K H S+ +S+HIL E+    N V I+++G+++ +
  S:     6 LISVENLSRHY--GNFCAVNNIQFEVKRGQVLGFLGPNGAGKTTTMQMITGTLAPTTGQISVAGYDLLDHPLKAKAAIGYLPEQPPVYQEMQVEEYLRFCAKLHHIPRHEITSAVNRVIEQCGLNTMTHRLIGNLSKGYQQRVGIAQAIIHNPSVVILDEPTIGLDPIQIREIRTLIQNLGKEH-SVILSTHILPEVQAVCNHVQIINHGQLILS 217
>gi|150385060|ref|ZP_01923716.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] >gi|150258543|gb|EDM95811.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] (396 aa)
Score = 288, Expect = 5.2e-24, Identities = 64/215 (29%), Positives = 126/215 (58%)
  Q:    54 KPLLEVVNLRK---QYYGK-KHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +P++  V L K    ++G+ K   +++++F++  GE    +G NG+GK+TT+K ++G      G + + G   + +E++ ++GY+PE+++    +++ + L +   L  +   + +   + +L    M   R++    FS G  ++I LAQA+ N+P  LI+DEPT+ LDP    +  D++  L+K  K++ I+SH+LS+++   + V IL  GK+  T
  S:     6 EPIVRAVGLTKVFRDFWGRPKAKAVNDIDFEIGQGEVVGLLGPNGSGKSTTVKMLLGLLYPTGGRLTVLGRSPRAVETKREIGYLPEDSYLYKYLTAEETLDFFGSLFSLSRADRRNRIDQLLDMVGMSHARHRRVGEFSKGMARRIGLAQAMINDPAFLILDEPTSGLDPLGCKEVKDLILALKKRGKTVVITSHLLSDIEDVCDRVIILYGGKVRAT 224
>gi|91773992|ref|YP_566684.1| ABC transporter, ATPase subunit [Methanococcoides burtonii DSM 6242] >gi|91713007|gb|ABE52934.1| ABC transporter, ATPase subunit [Methanococcoides burtonii DSM 6242] (291 aa)
Score = 288, Expect = 5.2e-24, Identities = 93/269 (34%), Positives = 148/269 (55%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK----RNKNENGEMCYR--------IKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKE--ILVKFEKYYLSIEDLY 342
           ++N++  V     + F+G NGAGKTTTIK + G     DG I + G+D  +++ E +  MG +P+++ F    ++  ++ Y  +L  +  KEA + + ++L+K  +   +++    FS G KK++ +AQAL NNP ILI+DEPT  LDP       ++L E      +IFISSH L E+      V ILD GKI+   K    R+   NG +           I L+E  E   V K E+ S + +      K ++   I+KLI +    + K  +  LS+ED +
  S:     1 MENISLNVEKESIYGFLGKNGAGKTTTIKLLSGLLTPTDGKIIVDGMDMDSESREIKKIMGLVPQDSNFYDDRNALSHMIYYGRLKGLSKKEALVQSNALLEKVGLEKEKHKQVIYFSHGMKKRLGIAQALLNNPKILILDEPTNGLDPVGIRQIRELLCECNNSGITIFISSHNLLEIQEICTHVGILDKGKIIAENKIEEIRHFESNGVITVGLYNLAPKIINLIESLE--FVVKTELKSEHVLEIFVNSKGDVKPEINKLIVENGGNVFKLIENSLSLEDAF 283
>gi|88800426|ref|ZP_01115991.1| hypothetical NosF protein [Reinekea sp. MED297] >gi|88776873|gb|EAR08083.1| hypothetical NosF protein [Reinekea sp. MED297] (309 aa)
Score = 288, Expect = 5.2e-24, Identities = 71/211 (33%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQAL---------SNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L+E+  + K Y       +  ++  ++PGE  A +G NGAGKTT IK I+G  +   G + + G     L ++ ++GY+PEN  F   ++  + L Y A+LN +  K A+  + ++L +  +    ++   ++S G K+++ LAQAL            P +LI+DEPT  LDP A +DFF +L EL++    + I +H+L  L+ Y ++  IL+ G+ V
  S:     6 LIELSQVGKHY--DHTEVLQAVDLTLHPGEMLALMGHNGAGKTTLIKLILGLIQADVGQLSVLGC-APGLRNQ-QIGYVPENVSFYPMLTGRETLEYFARLNGLSRKAARQRSTALLDRVGLSPSADRRVKHYSKGMKQRLGLAQALLPSVHRGGSETAPSLLILDEPTVGLDPIATLDFFRLLAELREQGCGVIICTHVLPGLEPYLDSALILNRGRAV 221
>gi|167761434|ref|ZP_02433561.1| hypothetical protein CLOSCI_03844 [Clostridium scindens ATCC 35704] >gi|167661100|gb|EDS05230.1| hypothetical protein CLOSCI_03844 [Clostridium scindens ATCC 35704] (327 aa)
Score = 288, Expect = 5.2e-24, Identities = 71/211 (33%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ N+RK YYG K   +++++F++        +G NGAGK+T +  + G      G++ + G  ID    E + K+GY+PE       +S   +L Y AKL ++  K A    + I+K+  +  + N+   N S G ++++ +AQA+   P ILI+DEPT  LDP   ++F  +L E  K H  I ISSHIL+E+    + + IL+ G ++
  S:    15 MIELQNVRK-YYGNKL-ALNDVSFQIEDASIIGLLGKNGAGKSTLMNIMTGYLPATAGNVCVDGLSIDEAPQEVKGKIGYLPEKPPLYDTMSVRGFLEYVAKLKRVSGKNAASSIDDIIKRTGLDVVENRLIRNLSKGYQQRVGIAQAMVGEPKILILDEPTVGLDPSQVVEFRSLLKEYAKEH-VIIISSHILAEIAEICDRILILNKGSLI 224
>gi|157364713|ref|YP_001471480.1| ABC transporter related [Thermotoga lettingae TMO] >gi|157315317|gb|ABV34416.1| ABC transporter related [Thermotoga lettingae TMO] (294 aa)
Score = 288, Expect = 5.4e-24, Identities = 84/214 (39%), Positives = 124/214 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           LEV +L K YYGK    I+ +N +V  GE   F+G NGAGKTTTI+ I+       G+I I   D +    E R ++GYIP    F   ++  D+L YTA+  K   K    + E + + F + D++ +     S G KKK+ + QAL + P +LI+DEPT  LDP  +   F+IL E +K   ++F SSHILSE++   + V ++ +GKI+ T+K
  S:     4 LEVKDLTK-YYGKSR-GIEKVNLRVQEGEIFGFIGPNGAGKTTTIRLILRLIFPNHGTIKIFEKDLREYGEELRNEIGYIPGEVNFYPEVTVKDFLEYTARFYKTAEKS---YVEKLCRNFSI-DVKKRF-RELSMGNKKKVAIVQALMHKPKLLILDEPTNGLDPLIQNLLFEILKEERKKGVTVFFSSHILSEVEKLCDRVALIKDGKILRTEK 212
>gi|172038613|ref|YP_001805114.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] >gi|171700067|gb|ACB53048.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] (317 aa)
Score = 288, Expect = 5.5e-24, Identities = 65/206 (31%), Positives = 121/206 (58%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           NL KQ+  ++H  ++ L  +V PGE +  +G NGAGKTT ++ +        G I+I G     DN +   + K+GY+P++      ++ +DYL Y A+L  +K    +   + +L+  ++   ++ +    S G K+++ LA+ + ++P +L++DEP + LDP AR+ F +++  LQ +  ++ ISSH+LS+L     +V I++ G +V
  S:    12 NLTKQF--ERHVAVNKLELEVQPGEVYGLIGPNGAGKTTLMRMLAAVEEPTTGEIHIYGDRLLTDNSHPRLKQKLGYLPDDFPLYEDLNVWDYLDYFARLYHVKLPHRRRRIQEVLELVQLTSKKDSNIKTLSRGMKQRLSLARTILHDPLLLLLDEPVSGLDPIARMQFREVIKILQSVGMTVLISSHVLSDLAELCTSVGIMELGSLV 219
>gi|20090454|ref|NP_616529.1| ATP-binding protein [Methanosarcina acetivorans C2A] >gi|19915470|gb|AAM05009.1| ATP-binding protein [Methanosarcina acetivorans C2A] (318 aa)
Score = 288, Expect = 5.5e-24, Identities = 64/210 (30%), Positives = 124/210 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +EV +L K++       +++++F V  GE   F+G NGAGKTTTI+ + G  R   G+  I G D K+  + +R  +G + EN+     ++++  L ++A+L  +  KE +  A  +L+KF +++ RN     FS G K+++ LA  + N+P ++ +DEPT+ LD ++ +   +++  L +   ++F+++H + E ++  + V I++ G IV
  S:     4 IEVSHLIKKF--GSLTALNDISFSVGEGETFGFLGPNGAGKTTTIRILTGVSRPTSGTATIFGHDVKHDTIAARQSVGIVSENSNVYDDLTAWQNLMFSAELYHVGRKEREKKANELLRKFELYERRNDKVQGFSKGMKRRLTLAMGMVNSPRLIFLDEPTSGLDVQSNLIIREVISGLVREGVTVFLTTHNIEEANVMCDRVAIINKGNIV 213
>gi|163725261|ref|ZP_02132785.1| ABC transporter related [Desulfatibacillum alkenivorans AK-01] >gi|161401395|gb|EDQ25639.1| ABC transporter related [Desulfatibacillum alkenivorans AK-01] (314 aa)
Score = 288, Expect = 5.6e-24, Identities = 67/210 (31%), Positives = 116/210 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++E   L K ++G  H  +D ++F V  GE   F+G N AGK+TT++ + G      G+  I G D    +L +R KMGY+PEN      ++   +L + A++  +  +EA    E  + K  +  +R+Q     S G  +++  AQ++ ++P+ LI+DEPT  LDP  + +   ++ E+ + +K+I +S+HIL E+D       I+ NG I
  S:     1 MIEAKQLTK-FFGD-HKAVDEVSFTVEKGEILGFLGPNAAGKSTTMRMLTGYLPPSAGAAAIGGCDIVADSLNARRKMGYLPENAPVYEDMTVTGFLQFIARIRGLSGREADDAVERTIGKCFLEGVRHQMVGTLSKGFNQRVCFAQSILHDPEYLILDEPTDGLDPNQKHEVRSMIREMGR-NKAIILSTHILEEVDAVCTRAIIIANGVI 209
>gi|40645689|dbj|BAD06358.1| putative ABC transporter ATP-binding protein [Streptomyces azureus] (323 aa)
Score = 288, Expect = 5.6e-24, Identities = 62/193 (32%), Positives = 117/193 (60%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK----SIFISSHILSELDLYSNAVTILDNGKIV 266
           +D L+  V PG     VGANGAGK+T IK ++G     +G   + G+D   K  + R ++GY+PE+   P  +S+ +++ + A+++ +    A+      L+   +++ R +    +S+G K+++ LAQAL ++P ++ +DEPT  LDP  R    ++LG ++++H     S+ ++SH+L EL+   + V ++D GK++
  S:    19 LDRLSVDVGPG-VTGLVGANGAGKSTLIKILLGLSPATEGRAEVLGLDVATKGADIRERVGYMPEHDCLPPDVSATEFVVHMARMSGLPPTAARERTADTLRHVGLYEERYRPIGGYSTGMKQRVKLAQALVHDPQLVFLDEPTNGLDPVGRD---EMLGLIRRIHTDFGISVLVTSHLLGELERTCDHVVVIDGGKLL 213
>gi|126649843|ref|ZP_01722079.1| ABC transporter, ATP-binding protein [Bacillus sp. B14905] >gi|126593562|gb|EAZ87507.1| ABC transporter, ATP-binding protein [Bacillus sp. B14905] (311 aa)
Score = 288, Expect = 5.9e-24, Identities = 69/211 (32%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+ +L K+Y       +D+LN  +  G    FVGANGAGK+TT   +        G   I+G  +  +  E R ++GY+P+      ++   +YL +      I+  E ++    +L+   +   R +  +  S G K+++ LA+AL ++P +LI+DEP + LDP+AR++  DIL  L+ + K+I ISSHIL EL    + + ++DNGK++
  S:     1 MIEIRDLTKRY--GSFTALDHLNLSLEEGIVFGFVGANGAGKSTTFSILATLLSPTSGDALINGKSVVKEPKEVRKQIGYMPDFFGVYDQLKVDEYLDFYGASYGIQLAERQVLIPQLLELVNLTSKRYEYVDLLSRGMKQRLCLARALIHDPKVLILDEPASGLDPRARVEMRDILRNLKSMGKTILISSHILPELAEMCDEIGVIDNGKLI 211
>gi|14590767|ref|NP_142837.1| resistance ATP-binding protein [Pyrococcus horikoshii OT3] >gi|3257326|dbj|BAA30009.1| 324aa long hypothetical resistance ATP-binding protein [Pyrococcus horikoshii OT3] (324 aa)
Score = 288, Expect = 6.0e-24, Identities = 62/208 (29%), Positives = 123/208 (59%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           V NL K+Y       +  ++FKV  GE  AF+G NGAGKTTT+  +    +   G   ++G D   ++ E R K+G + ++      +++++ +Y   ++  +K +E K   E +LK   +W+ +++    FS G ++++ +A+AL + P++L +DEPT  LDP+ R   ++ +  +++ H  +IF+++H + E +  ++ + I+D+GKI+
  S:     9 VENLVKKY--GDFEAVRGISFKVRRGEIFAFLGPNGAGKTTTVHMLTTLLKPTSGRAIVAGHDVVKESREVRKKIGVVFQDPSVDRELTAWENMYIHGRIYGLKGQELKKKIEELLKFVELWEFKDRQVKYFSGGMQRRLEIARALIHEPEVLFLDEPTIGLDPQTRAHIWEYIKTMKEEHDMTIFLTTHYMDEAEQLADRIAIIDHGKII 217
>gi|186458529|ref|ZP_02968837.1| ABC transporter related [bacterium Ellin514] >gi|184204767|gb|EDU01818.1| ABC transporter related [bacterium Ellin514] (318 aa)
Score = 288, Expect = 6.0e-24, Identities = 70/213 (32%), Positives = 118/213 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN-KNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           P +  V L + Y       +++L+  V  G+   F+G+NGAGKTTT++ +        G   + G D  K+ ++ R  +GY+P+       +   +YL +     KI S + +     +L+   + + +       S G ++++ LA+ L ++P +L++DEP + LDP+ARI+   IL ELQ+L K+I ISSHILSEL    N V I++ GK++Y
  S:    10 PAVHTVGLSRTY--GSMVALNSLDLTVNRGDLFGFIGSNGAGKTTTLRILATFLAPSAGQAKVLGHDVVKDADAVRHVIGYMPDFFGVYKDMEVTEYLDFFGACYKIPSAQREKTVNDVLELVGLSEKKGALIGALSRGMQQRLGLARVLIHDPQVLLLDEPASGLDPRARIEMMAILQELQRLGKTIIISSHILSELQTLCNRVAIIERGKLIY 222
>gi|30019878|ref|NP_831509.1| ABC transporter ATP-binding protein [Bacillus cereus ATCC 14579] >gi|29895423|gb|AAP08710.1| Export ABC transporter ATP-binding protein [Bacillus cereus ATCC 14579] (313 aa)
Score = 288, Expect = 6.0e-24, Identities = 78/274 (28%), Positives = 150/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  LK   + D +   P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     5 LEIKNLTKKF--GNFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALKFVGLSDKQKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHCINHDIEIR 289
>gi|126700781|ref|YP_001089678.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] >gi|196127524|ref|ZP_03119273.1| ABC transporter, ATP-binding protein [Clostridium difficile ATCC 43255] >gi|115252218|emb|CAJ70058.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] (290 aa)
Score = 288, Expect = 6.1e-24, Identities = 69/211 (32%), Positives = 125/211 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + V NL K++ GKK   +DN+N ++  G F   +G NGAGKTT ++ +       +GSI++ G+  +N  E R  +GY+P++      ++ +  + Y A L+ I  ++ +     +L K  + + +N    + S G  +++ +AQAL +NP +LI+DEPTA LDP+ RI F ++L E+    + + +S+HI+ +++     V IL++GK++Y
  S:     5 IAVSNLSKRF-GKKQ-ALDNINLEIDSGMF-GLLGRNGAGKTTFMRILATLLSKTEGSIHMCGVPIENTKEIRNMVGYLPQDFSMYPNMTVYKAMDYLAVLSDIPLRKRRKIIAKLLSKVNLTNYQNVKVKSLSGGMNRRLGIAQALIHNPRVLIVDEPTAGLDPEERIRFRNLLCEIAN-DRIVILSTHIVGDIEATCENVAILNSGKVIY 212
>gi|149275928|ref|ZP_01882073.1| ABC-type multidrug transporter, ATP-binding protein; gliding motility-associated protein [Pedobacter sp. BAL39] >gi|149233356|gb|EDM38730.1| ABC-type multidrug transporter, ATP-binding protein; gliding motility-associated protein [Pedobacter sp. BAL39] (235 aa)
Score = 288, Expect = 6.4e-24, Identities = 66/202 (32%), Positives = 119/202 (58%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++YG +H  +D + F+  PG    F+G NGAGK+TT++ + G  +   G+  + G D +  +LE R  MGY+PENT   + +   ++L + A   +++  + K+     L    M   +++  +  S G K+++ LAQA+ ++P +LI+DEPT+ LDP    D  +++ +L K  K++ +S+HI+ E++   + V I+  GKIV
  S:    10 KHYGSQH-AVDGITFEARPGRILGFLGPNGAGKSTTMRMLTGYLKPSSGTASLCGFDTQTQSLELRKVMGYLPENTPLYADMYVKEFLLFVANTYQLQDPKQKVIQTIDLVGLGME--QHKKISMLSKGYKQRVGLAQAIIHDPKVLILDEPTSGLDPNQLSDIRELIRKLGK-DKTVVLSTHIMQEVEALCDDVIIIHKGKIV 209
>gi|187734519|ref|YP_001876631.1| ABC transporter related [Akkermansia muciniphila ATCC BAA-835] >gi|187424571|gb|ACD03850.1| ABC transporter related [Akkermansia muciniphila ATCC BAA-835] (311 aa)
Score = 287, Expect = 6.5e-24, Identities = 65/192 (33%), Positives = 107/192 (55%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           + N +F++  GE   F+G NGAGKTTT++ + G      G+  I+G D     LE+R  +GY+PE+          +YL + A+L  I S++       ++++  +  +R +     S G ++++ LA AL   PD+LI+DEPT  LDP       +++  L   H +I +S+HILSE+++  N V I+D G I
  S:    17 VKNASFQIEKGEIVGFLGPNGAGKTTTLRMLTGYLPPTSGTATIAGFDIVKNPLEARKHLGYLPEHVPLYDDQRVTEYLKFRARLKGISSRQIWPAVSKVVEQCGLDPVRRKMIRTLSKGYRQRVGLADALLGEPDLLILDEPTNGLDPNQIRQIRELIKGLAANH-TIILSTHILSEVEMICNKVIIIDQGTI 209
>gi|94968599|ref|YP_590647.1| ABC transporter, ATPase subunit [Acidobacteria bacterium Ellin345] >gi|94550649|gb|ABF40573.1| ABC transporter, ATPase subunit [Acidobacteria bacterium Ellin345] (309 aa)
Score = 287, Expect = 6.5e-24, Identities = 62/189 (32%), Positives = 111/189 (58%)
  Q:    77 LNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           L+  V   E   F+G NGAGKTTT+K ++       G   I G  +D+ NL  + ++GY PE  +F   +++ + L Y A+L  + +KE     E +L++  + D++      FS G  +++ +AQA+ ++P I+ +DEP + LDP  R +  D++ EL++  K+IF S+HILS+ +   + V +++ G++
  S:    29 LSLSVPEHEVFGFLGPNGAGKTTTLKLLMSLIYPTSGEARILGLPVDDPNL--KRQIGYSPEQPYFYDHLTAHELLKYYAQLTGVPAKEQSKKVEGVLERVGLRDIKKLQLRKFSKGMLQRVSIAQAIVHDPRIVFLDEPMSGLDPMGRREVRDLIQELKEEGKTIFFSTHILSDAETLCDRVAVVNKGEL 217
>gi|116624326|ref|YP_826482.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116227488|gb|ABJ86197.1| ABC transporter related [Solibacter usitatus Ellin6076] (254 aa)
Score = 287, Expect = 6.6e-24, Identities = 66/211 (31%), Positives = 116/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +LE  +L K + G   P +D ++F + PGE   ++G NGAGK+TT+K + G      G + + G D  ++L+  + ++GY+PE       +S  +YL    +L  I     +   + +L    +W  R+ +  ++S G ++KILL  AL ++P++LI+DEP + LD  A +    +L  L    + I  SSH+L  ++  ++ V IL  G++V
  S:     1 MLEAHHLTKTFVGP--PAVDGVSFAIRPGEILGYLGPNGAGKSTTVKMLTGLLEPTSGRVTLHGEDVRRDLKGFQRRLGYVPEEPHLYPHLSGREYLQLAGRLRGIPRCPLETKMDELLHLIGLWQDRHNTLASYSKGMRQKILLLAALLHDPELLILDEPFSGLDVNAAMILRSLLHSLAGRGRMILYSSHVLEVVEKVAHMVLILRKGQVV 211
>gi|177664045|ref|ZP_02939848.1| ABC transporter related [Cyanothece sp. PCC 8801] >gi|172076726|gb|EDT62137.1| ABC transporter related [Cyanothece sp. PCC 8801] (316 aa)
Score = 287, Expect = 6.6e-24, Identities = 66/205 (32%), Positives = 117/205 (57%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+   ++  ++ +  +V  GE +  +G NGAGKTT I+ +  +     G IY+ G     +N N   + ++GY+P++      ++ +DYL Y A+L  +KS   +   + +L+  ++   R+   N  S G K+++ LA+ + + P +L +DEP + LDP AR+ F +I+  LQ    +I ISSH+LS+L     +V I++ G +V
  S:    12 LTKQF--DRYVAVNQVELQVEIGEVYGLIGPNGAGKTTLIRMLSAAEEPTTGEIYLYGDRLLRNNSNPHLKQRLGYLPDDFPLYEDLNVWDYLEYFARLYYLKSPHRRRRLQEVLELVQLTSKRDSKINTLSRGMKQRLSLARTIIHEPMLLFLDEPVSGLDPIARMQFREIIKVLQTAGMTILISSHVLSDLAQLCTSVGIMELGSLV 218
>gi|116494023|ref|YP_805757.1| ABC-type metal ion transport system, ATPase component [Lactobacillus casei ATCC 334] >gi|116104173|gb|ABJ69315.1| ABC-type metal ion transport system, ATPase component [Lactobacillus casei ATCC 334] (293 aa)
Score = 287, Expect = 6.7e-24, Identities = 61/211 (28%), Positives = 121/211 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + +  L K+Y GK  P +D ++ ++  G  +  +G NGAGK+T +K +    +   G++ + G+  K  ++ R ++GY+P+   F + +   D + Y A L  + +++     + +L++  + D         S G  +++ +AQAL N P +LI+DEPTA LDP+ RI F ++L +     + + +S+HI+S+++  +N + ILD G++++
  S:     4 INIEGLTKRYRGKAAPALDQVSLEIETG-MYGLLGKNGAGKSTLMKILTTLEQPTAGTVEVCGVPIKAAKAIRQQIGYLPQRFGFYTNMRVVDAMTYLAVLANVPARDQSQRIQHLLEEVHLADKARTKIKALSGGMLQRLGIAQALVNRPKVLIVDEPTAGLDPEERIRFRNLLTDFAN-ERIVLLSTHIVSDIEATTNTIGILDQGRLLF 213
>gi|21222361|ref|NP_628140.1| ABC transporter ATP-binding protein [Streptomyces coelicolor A3(2)] >gi|3928732|emb|CAA22228.1| putative ABC transporter ATP-binding protein [Streptomyces coelicolor A3(2)] (320 aa)
Score = 287, Expect = 7.0e-24, Identities = 62/193 (32%), Positives = 117/193 (60%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK----SIFISSHILSELDLYSNAVTILDNGKIV 266
           +D L+  V PG     VGANGAGK+T IK ++G     +G   + G+D   K  + R ++GY+PE+   P  +S+ +++ + A+++ +    A+      L+   +++ R +    +S+G K+++ LAQAL ++P ++ +DEPT  LDP  R    ++LG ++++H     S+ ++SH+L EL+   + V ++D GK++
  S:    17 LDRLSVDVGPG-VTGLVGANGAGKSTLIKILLGLSPATEGRAEVLGLDVATKGADIRERVGYMPEHDCLPPDVSATEFVVHMARMSGLPPTAARERTADTLRHVGLYEERYRPIGGYSTGMKQRVKLAQALVHDPQLVFLDEPTNGLDPVGRD---EMLGLIRRIHTDFGISVLVTSHLLGELERTCDHVVVVDGGKLL 211
>gi|29345705|ref|NP_809208.1| ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] >gi|29337598|gb|AAO75402.1| ABC transporter ATP-binding protein [Bacteroides thetaiotaomicron VPI-5482] (297 aa)
Score = 287, Expect = 7.0e-24, Identities = 62/209 (29%), Positives = 125/209 (59%)
  Q:    59 VVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIK-SKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + NL K Y    H  + ++N ++  G F   +G NGAGK+T ++ ++       G + I G D   +  E R  +GY+P++  F ++  ++++L Y A+L+ +  S++ K   + +L+   ++D+R +  N  S G K+++ +AQAL ++P ++I+DEPT  LDP+ RI F ++L E+ +   +I +S+HI+ ++    N + +++ G++ +
  S:     5 IKNLNKIYPNGNH-ALKDVNLEIPAGMF-GLLGPNGAGKSTLMRILVALMEPTSGQVEICGYDLMKQRKEIRGILGYLPQDFRFFAKYKTYEFLDYAARLSGMTHSRQRKQAVDEMLENVGLFDVRERYANKLSGGMKRRLGIAQALIHHPKVIIVDEPTTGLDPEERIRFRNLLSEVSENDVTIILSTHIVGDISSTCNNMALMNRGQVSF 214
>gi|167767150|ref|ZP_02439203.1| hypothetical protein CLOSS21_01669 [Clostridium sp. SS2/1] >gi|167711125|gb|EDS21704.1| hypothetical protein CLOSS21_01669 [Clostridium sp. SS2/1] (290 aa)
Score = 287, Expect = 7.2e-24, Identities = 69/199 (34%), Positives = 115/199 (57%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESR--TKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           YG K+  + +LN +   G  +  +GANGAGKTT I  I G  +   G + + G D +++ ++   K+GY+P+   F       ++L Y   +  I  K+AK     I+ +  + D  N+     S G ++++ +AQA+ N+P ILI+DEPTA LDP  RI F +I+  + K ++ + IS+HI+S+++  +N V IL  GK+
  S:    12 YGNKY-ALKDLNIEFSDG-VYGILGANGAGKTTLISIITGILQQTSGQVKLDGSDIRDMGTKYLDKIGYLPQYPQFYPNFRVKEFLMYMCSIKDIPQKKAKEILPEIMVEVNLCDHINKKIKELSGGMRQRLGIAQAILNDPQILILDEPTAGLDPGERIRFRNIISNIAK-NRMVLISTHIVSDIEYIANQVVILQEGKL 209
>gi|75906416|ref|YP_320712.1| ABC transporter-like [Anabaena variabilis ATCC 29413] >gi|75700141|gb|ABA19817.1| ABC transporter-like [Anabaena variabilis ATCC 29413] (339 aa)
Score = 287, Expect = 7.2e-24, Identities = 65/212 (30%), Positives = 121/212 (57%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI---DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P + + NL+K+Y   +   + +++F+V PGE    +G NGAGKTTT++++        G I +SGI   DN  + +R ++GY+ +       ++  + L   A L  + +  AK   E++L    + +  N+    +S G +K++ LA  L ++PD+L++DEPT  LD ++R   ++ L +L+    ++ I+SH L E+D  ++ V I+D G ++
  S:     3 PAVLIQNLQKRYGTVE--AVKDVSFQVEPGEIFGLLGPNGAGKTTTLRALCTLTTPDAGKIEVSGISVLDNPRV-ARQRLGYVAQEVALDKVLTGKELLQLQAALYHLPNAVAKQRIETVLDLLGLQEYANKKTGTYSGGLRKRLDLAAGLLHSPDVLVLDEPTVGLDIESRFVVWEFLRKLRASGTTVVITSHYLEEIDALADRVAIIDRGVVI 214
>gi|171913444|ref|ZP_02928914.1| ABC transporter related protein [Verrucomicrobium spinosum DSM 4136] (308 aa)
Score = 287, Expect = 7.4e-24, Identities = 66/210 (31%), Positives = 117/210 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++V NL K Y GK    +D L+FKV PGE   F+G NGAGK+TT++ + G      G+  ++G D  ++++++R  +GY+PEN      +   +YL +   +  +     +     ++    + ++R +   N S G ++++ LA AL   P +LI+DEPT  LDP       ++L    K  ++I +S+HILS+++   + V +L  GK+
  S:     1 MIDVQNLTKTYVGKT--AVDGLSFKVEPGEVVGFLGPNGAGKSTTMRILTGFLSPTSGTARVNGFDVFHQSIDARRSLGYMPENAPLYMDMRVKEYLQFRGAIKGLGGSLLRKRVGEVMDACALTEVRRKIIANLSKGFRQRVALADALVGKPPLLILDEPTNGLDPNQIRHVRELLLAF-KGRQTILLSTHILSQVEQTCDRVLLLHQGKL 209
>gi|116624417|ref|YP_826573.1| ABC transporter related [Solibacter usitatus Ellin6076] >gi|116227579|gb|ABJ86288.1| ABC transporter related [Solibacter usitatus Ellin6076] (255 aa)
Score = 287, Expect = 7.4e-24, Identities = 63/211 (29%), Positives = 119/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +L+V  L K+Y  +    +D++ F V PG+   ++G NG+GK+TT+K + G      G I   G D ++  +  + ++GY+PE  F  S +S  ++L    +L ++   + +  A  +L+   +++ R    +++S G K+++L+A AL ++P++LI DEP + LD  + +   +++ EL +  K+I   SH+L   +     V +L  GKIV
  S:     1 MLDVRGLTKKY--RNRAVVDHVTFTVPPGQVTGYLGPNGSGKSTTVKMLAGLLPATSGQILWDGNDIRHDLIGFKRRLGYVPEEAFVYSHLSGLEHLELMGRLRQLPEAQVQRKAVELLRLLWLYEHRYTPISSYSKGMKQRVLIAGALLHDPELLIFDEPLSGLDIASAMLLHELIAELARSGKTILYISHVLEVTEKVCARVIMLYQGKIV 211
>gi|167751260|ref|ZP_02423387.1| hypothetical protein EUBSIR_02246 [Eubacterium siraeum DSM 15702] >gi|167655767|gb|EDR99896.1| hypothetical protein EUBSIR_02246 [Eubacterium siraeum DSM 15702] (349 aa)
Score = 287, Expect = 7.6e-24, Identities = 71/213 (33%), Positives = 121/213 (56%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + ++EV NL K+Y  K    + N++F     E   F+G NGAGK+TT+  + G   + +G   I+GID   + ++++  +GY+PE       ++  +YL +   L K K        E I    ++ D++++   N S G K+++ LAQAL  NP +LI+DEPT  LDPK  I+   ++ +L K H ++ +SSHIL E+    + + I++ G++V
  S:    21 QKMIEVKNLTKRYGSKT--AVSNVSFTAEESEILGFLGPNGAGKSTTMNILTGYLSSTEGEAKINGIDILEEPVKAKQMIGYLPEQPPLYLDMTVMEYLKFVYGLKKCKLPINSHLKE-ICNLVKITDVKDRVIKNLSKGYKQRVGLAQALVGNPPVLILDEPTVGLDPKQIIEIRALIKKLGKNH-TVILSSHILPEIQAVCDKIVIINRGRVV 231
>gi|118728478|ref|ZP_01577015.1| ABC transporter related [Clostridium cellulolyticum H10] >gi|118662136|gb|EAV68860.1| ABC transporter related [Clostridium cellulolyticum H10] (293 aa)
Score = 287, Expect = 7.6e-24, Identities = 85/248 (34%), Positives = 136/248 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN-KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN---KNENGEMCYRIKLV---EDFEGDKVGKYEVNSNN 303
           ++E+ NL K Y   K   I+N+NF V  GE   F+G NGAGK+TTI++++G     +GS  I G    ++ E R ++GY+P   F+   +   D L Y+A   K      K     I +  R+ DL   +   + S G KKK+ + Q L + P ++I+DEPT+ LDP  +  FF+++ E  +   ++F SSHILSE+    + V  + +GKI+  +K +   +N   ++    K +   E F+   V K E+  NN
  S:     3 VIEIKNLTKSY--GKARGINNINFSVEQGEIFGFIGPNGAGKSTTIRTLLGLIYPSEGSATIFGKSCVEHPEVRKEVGYLPSEVFYYDNMRVMDLLKYSASFYK------KDCTGRIQELARVMDLDLKKKIEDLSFGNKKKVGIVQGLLHEPKLIILDEPTSGLDPLMQQKFFELIAEENRKGATVFFSSHILSEVQKMCSRVAFIKDGKIIKLEKMSTLQENSYKKISIETKEIIPKEVFDIKGVSKLEIKGNN 250
>gi|149634201|ref|XP_001511114.1| PREDICTED: similar to ABC transporter [Ornithorhynchus anatinus] (855 aa)
Score = 287, Expect = 7.8e-24, Identities = 72/252 (28%), Positives = 132/252 (52%)
  Q:    14 SSLKSKQLEKKEKEYQMEMNAAH------EYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           S+ + K LEK E   +   +  H       +FER       ++    P + V NL K +     P +D LN   Y  +  AF+G NGAGKTTT+  + G +    G + I G D   +L+S R  +G+ P++      ++  +++ + A+L      EA L  E++L+   +   RN+   N S G ++K+ +A A      ++++DEPT+ +DP +R   +D+L + +   +++ +S+H + E D+  + + I+  GK+
  S:   240 STREEKNLEKTEPLTEETEDPEHPEGINDTFFER-------ELPGLVPGVTVQNLVKIFEPNSKPALDRLNITFYENQITAFLGHNGAGKTTTMSILTGLFPPTSGKVLIGGKDIETDLDSIRQSLGWCPQHNILFHHLTVAEHILFYAQLKGKSWDEALLETEAMLEDTGLHHKRNEEARNLSGGMQRKLSVAMAFVGEAKVVVLDEPTSGVDPYSRRSIWDLLLKYRP-GRTLIMSTHHMDEADMLGDQIAIISQGKL 491
Score = 115, Expect = 6.0e-04, Identities = 31/132 (23%), Positives = 66/132 (50%)
  Q:   132 GYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDL---RNQSPNNFSSGQKKKILLAQALSNNPDILIM------DEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           GY P+       ++  ++L+  A+L  +  +E  +      + FR W L    +     +S G K+K+  A AL   P ++++      DEPT  +DP +R   ++ +  + +  +++ ++SH + E +     + I+  G
  S:   571 GYCPQFDAIDDLLTGREHLHLYARLRGVPMEEIAMVRGWQTESFRAWGLGLHADHLAGTYSGGTKRKLSTAIALVGCPPLVLLIRAPTTDEPTTGMDPLSRRLLWNTIVNIIREGRAVVLTSHSMEECEALCTRLAIMVKG 711
>gi|16081807|ref|NP_394198.1| ATP-binding protein related resistance protein [Thermoplasma acidophilum DSM 1728] >gi|10640016|emb|CAC11868.1| ATP-binding protein related resistance protein [Thermoplasma acidophilum] (319 aa)
Score = 287, Expect = 7.9e-24, Identities = 74/212 (34%), Positives = 120/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYR------NFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           LLEV NL K Y G     + N + K+  G  HA +G NGAGK+TT+K I G         +F G+ Y    ++K+L  +  +GY+PE   FP   +  D +    ++  +   EA   A  I+    + +   +  ++ S G  +K+ +  AL ++PD++IMDEPTA LD  A  + F I+  L+   KSI ISSH L +++  S++VT++D+G +++
  S:     6 LLEVRNLSKIYPGGS--GVRNASIKIRYGSIHALLGNNGAGKSTTMKCITGLLEPDSIEISFRGTTY--PWNSKDL--KKHIGYVPELPAFPKVFTVHDCIVSYGRMMGLGKAEAVGRAMPIVSILGLEEHMKKRVSSLSRGMLQKLDIVIALLSDPDVIIMDEPTAGLDVSAVEELFGIIRSLRDRGKSILISSHQLRDIETISDSVTVMDSGHVIF 217
>gi|163942571|ref|YP_001647455.1| ABC transporter related [Bacillus weihenstephanensis KBAB4] >gi|163864768|gb|ABY45827.1| ABC transporter related [Bacillus weihenstephanensis KBAB4] (238 aa)
Score = 287, Expect = 7.9e-24, Identities = 66/217 (30%), Positives = 118/217 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           +LE++N  K Y G K   +D LN  V  G+   F+G NGAGK+TTIKS++G     +G I++ G   K   +  +  + YIP+N     +++   YL + A + K+ +K+ +   +     F +        +++S G K+K+ +  A+ + P +L++DEP   LDPKA +    I+ EL +   +IF S+H+L   +   N + +++ GK+  + + N
  S:     1 MLEIINFSKTYKGGKK-AVDQLNITVQAGDIFGFIGHNGAGKSTTIKSLVGVIDFEEGEIFVDGYSVKKDPIACKRVVAYIPDNPDLYEQLTGIQYLNFVADVFKVSAKDREKEIQKYGDAFEITPYLGDLISSYSHGMKQKVAIISAVLHKPKLLVLDEPFVGLDPKAAVVLKGIMKELCEKGSAIFFSTHVLDVAEKLCNKIAMINRGKLALSGEVN 218
>gi|91977836|ref|YP_570495.1| ABC transporter related [Rhodopseudomonas palustris BisB5] >gi|91684292|gb|ABE40594.1| ABC transporter related [Rhodopseudomonas palustris BisB5] (306 aa)
Score = 287, Expect = 7.9e-24, Identities = 61/217 (28%), Positives = 120/217 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           P++ V NL K Y G     ++++N  +  GE  A +G NGAGKTT I +I G     +G + + G D  +    +R  +G +P+     +  S +D + ++  L       A +  E +L+   +WD ++      S G K+++++A+ALS+ P IL +DEPTA +D + R   ++++  LQ    +I +++H + E +  ++ V +++NG+++  +++
  S:     3 PIISVSNLSKTY-GTGRKALNDVNLDIMAGEIFALLGPNGAGKTTLIGTICGLVNATEGKVTVDGHDIVDDYRAAREMIGLVPQELHTDAFESVWDTVSFSRGLFGKPKNPAHI--EKVLRDLSLWDRKDSRIITLSGGMKRRVMIAKALSHEPQILFLDEPTAGVDVELRKGMWEVVRALQATGVTIILTTHYIEEAEEMADRVGVINNGELILVEEK 218
>gi|24378906|ref|NP_720861.1| putative ABC transporter, ATP-binding protein [Streptococcus mutans UA159] >gi|24376789|gb|AAN58167.1|AE014888_5 putative ABC transporter, ATP-binding protein [Streptococcus mutans UA159] (241 aa)
Score = 287, Expect = 8.0e-24, Identities = 70/210 (33%), Positives = 115/210 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +L++ NL   Y     P + N++F+V  GE    +G NGAGK+TTI  IIG  + ++G I I G+   ++ +  R K+G+IPE       ++  ++L   A    IK + A   A+ +L+ FR+ D  +  P +FS G K+K+++  A   +P + I+DEP   LDP A  D   +L   +   KSI +S+H+L   +   +   IL +G+I
  S:     1 MLKIENLTGGYVNI--PVLKNISFEVADGELVGLIGLNGAGKSTTINEIIGLLQPYEGKISIDGLTLADQEMAYRKKIGFIPETPSLYEELTLKEHLEMIAMAYDIKVEAALARAQKLLELFRLEDKLDWFPIHFSKGMKQKVMIICAFIIDPSLFIVDEPFLGLDPVAISDLTQLLAAEKAKGKSILMSTHVLDSAEKMCDRFVILHHGQI 210
>gi|138895386|ref|YP_001125839.1| ABC transporter ATP-binding protein [Geobacillus thermodenitrificans NG80-2] >gi|196249164|ref|ZP_03147863.1| ABC transporter-related protein [Geobacillus sp. G11MC16] >gi|134266899|gb|ABO67094.1| ABC transporter ATP-binding protein [Geobacillus thermodenitrificans NG80-2] >gi|196211393|gb|EDY06153.1| ABC transporter-related protein [Geobacillus sp. G11MC16] (220 aa)
Score = 287, Expect = 8.4e-24, Identities = 68/210 (32%), Positives = 115/210 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++EV  L   Y   K   +D+++  ++ GE  A VG NGAGK+T I S++       G++YI GID++  E + K+ Y+PE      +++  + + + A L+ +  ++     E +L   R+W+ R+     +S G  +++ LA  L  + D+LI+DEPT+ LDP  R +   IL  L   +K+I +SSH + E+      V  L+NGKI
  S:     1 MIEVTGLTVSYRNNK--VLDDVDLVIHKGERCALVGRNGAGKSTLIHSLLNLLPAVRGTVYIDGIDHRRHEWKKKVAYLPEKFQLYPQLTGEENVRFFASLHGVVDEQR---IEDVLHTVRLWEARHMKSKQYSKGMLQRLGLAIMLYYDADLLILDEPTSGLDPLGRAEVLMILRSLP--NKTILLSSHHIDEVRQLCTHVAYLENGKI 203
>gi|15615776|ref|NP_244080.1| ABC transporter ATP-binding protein [Bacillus halodurans C-125] >gi|10175837|dbj|BAB06933.1| ABC transporter (ATP-binding protein) [Bacillus halodurans C-125] (318 aa)
Score = 286, Expect = 8.5e-24, Identities = 66/215 (30%), Positives = 123/215 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + + ++++  + K+Y    H  +D+L+  +  GE    +G NGAGKTT+I  ++G      G++ ++GID+    +E + K+GY+P+N  F   ++  + L YTA LN I+  EA   A ++L+K  + +   +    +S G K+++ LA  L   P+I+I+DEPT  +DP+   DF  ++  L Q  + ++ + SH L ++    + V I  +GK++
  S:     1 MEEAIIKLNEITKRY--DDHYAVDHLSLSIRKGEIFGLLGPNGAGKTTSILMMLGLSEPTSGTVQVAGIDSTKYPIEVKRKVGYLPDNVGFYPDMTGMENLLYTASLNGIQKIEAIERANTLLEKVGLTEAAKKKTGQYSRGMKQRLGLADVLMKGPEIIILDEPTLGIDPEGVRDFLHLIRNLNQNENLTVLLCSHHLHQVQQVCDRVGIFVDGKLL 216
>gi|69244415|ref|ZP_00602831.1| ABC transporter [Enterococcus faecium DO] >gi|68196356|gb|EAN10784.1| ABC transporter [Enterococcus faecium DO] (245 aa)
Score = 286, Expect = 8.8e-24, Identities = 69/194 (35%), Positives = 108/194 (55%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + +++F V PGE    +G NGAGK+TTIK IIG      G+I I+ +   KN E  R ++GYIPE       ++  +++  TA    I    A   AE +L+ FR+ +  +  P NFS G K+K+++  A    P + I+DEP   LDP A     +++ E++K    I +S+HIL+  + Y +   +L NG+I
  S:    16 PVLKDISFDVQPGEIVGLIGLNGAGKSTTIKHIIGLLEASKGTIEINHLSLKKNTEEYRKQIGYIPETPSLYEELTLREHIEVTAMAYDIPMDIAMKRAEKLLETFRLSNRLDWFPANFSKGMKQKVMILCAFLIEPSLYIIDEPFLGLDPLAINALLELMVEMKKEGAGILMSTHILATAEKYCDRFVVLHNGEI 211
>gi|170756223|ref|YP_001780813.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum B1 str. Okra] >gi|169121435|gb|ACA45271.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum B1 str. Okra] (304 aa)
Score = 286, Expect = 8.9e-24, Identities = 78/212 (36%), Positives = 125/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+G D +    +   K+G + E   F   +S +  L   A L    SKE     + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  +SSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINGYDVEKDSEKAIEKIGTMVEAPSFYGGLSGYKNLILMANLYG-ASKER---VDEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLVSSHILSEIQAVCNRIGIIEKGSL 212
>gi|163732836|ref|ZP_02140281.1| ABC transporter, ATP-binding protein, putative [Roseobacter litoralis Och 149] >gi|161394196|gb|EDQ18520.1| ABC transporter, ATP-binding protein, putative [Roseobacter litoralis Och 149] (312 aa)
Score = 286, Expect = 8.9e-24, Identities = 64/236 (27%), Positives = 132/236 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEG 291
           +LE+ +LRK  Y      ++ ++ ++  GE  A +G NGAGKTT I ++ G  R   GS+ + G D       +R  +G +P+           + + ++  L    S + K+  E+IL++  +WD R+      S G K+++L+A+ALS+ P +L +DEPTA +D + R D ++I+ +L+    +I +++H + E +  ++ V ++  G+++  +++++     G+   +++L +  +G
  S:     4 ILEIKDLRK-VYSDGFKALNGVSLEIEEGEIIALLGPNGAGKTTLISTVCGITRASGGSVRVGGFDIIKDFRAARGMIGLVPQEVNLEPFERVINTVRFSRGLFGKPSDDTKV--EAILRQLSLWDKRDNQIRELSGGMKRRVLIAKALSHEPRLLFLDEPTAGVDVELRKDMWEIVADLKASGVTIVLTTHYIEEAEAIADRVGVIAKGELLLIEEKSELMKRMGQKQLQVQLTQTLDG 240
>gi|196246535|ref|ZP_03145254.1| ABC transporter related [Cyanothece sp. PCC 8802] >gi|196205766|gb|EDY00566.1| ABC transporter related [Cyanothece sp. PCC 8802] (316 aa)
Score = 286, Expect = 9.2e-24, Identities = 66/205 (32%), Positives = 116/205 (56%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+   ++  ++ +  +V  GE +  +G NGAGKTT I+ +  +     G IY+ G      N N   + ++GY+P++      ++ +DYL Y A+L  +KS   +   + +L+  ++   R+   N  S G K+++ LA+ + + P +L +DEP + LDP AR+ F +I+  LQ    +I ISSH+LS+L     +V I++ G +V
  S:    12 LTKQF--DRYVAVNQVELQVEIGEVYGLIGPNGAGKTTLIRMLSAAEEPTTGEIYLYGDRLLRSNSNPHLKQRLGYLPDDFPLYEDLNVWDYLEYFARLYYLKSPHRRRRLQEVLELVQLTSKRDSKINTLSRGMKQRLSLARTIIHEPMLLFLDEPVSGLDPIARMQFREIIKVLQTAGMTILISSHVLSDLAQLCTSVGIMELGSLV 218
>gi|196259329|ref|ZP_03157860.1| ABC transporter related [Cyanothece sp. PCC 7822] >gi|196199541|gb|EDX94365.1| ABC transporter related [Cyanothece sp. PCC 7822] (326 aa)
Score = 286, Expect = 9.2e-24, Identities = 69/212 (32%), Positives = 124/212 (58%)
  Q:    55 PLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-----KSKEAKLF-----AESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           P+++  +LRK Y       +   ++   +  VY GE    +G NGAGKTT +K+++G  R   G   + G    ++  + ++GY+PEN ++   ++ +++L   A + +I     K +  +L      A+S  KK +M          +S G +++I +AQAL N+P+++ +DEP + LDP  R    +I+  LQK  K+IF +SHILS+++   + + IL  G+I+
  S:    18 PVVQTWHLRKVYRTGFWLNQLIESLKGCDLSVYQGETFGLLGPNGAGKTTLLKTLLGIVRPTSGRAVLLGRPIGDISVKKRIGYLPENAYYYDFLTGWEFLELIANVFEIPRSVQKKRIPQLLELVGLAQSAAKKKQM--------RQYSKGMQQRIGMAQALINDPELVFLDEPMSGLDPMGRYQVREIILSLQKQGKTIFFNSHILSDVEQICDRIAILARGEII 236
>gi|159899664|ref|YP_001545911.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] >gi|159892703|gb|ABX05783.1| ABC transporter related [Herpetosiphon aurantiacus ATCC 23779] (319 aa)
Score = 286, Expect = 9.2e-24, Identities = 61/211 (28%), Positives = 120/211 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E  NL +++    H  ++ +N  +  G  + F+G NGAGKTTT++ +    +   G  +++GI  +      R  +G++P+       +  ++YL + A +  IK        + +L+   + +  +    N S G K+++ LA+ ++++P +LI+DEP + LDP+ARI+  ++L EL ++ K+I +SSHILSEL    + + I++ G ++
  S:     4 IVETHNLTQRF--GTHLALNQVNLSIPKGAVYGFIGPNGAGKTTTMRILTTLLQPTAGEAFVNGISVRQDPDAVRKMIGFMPDYFGVYESMRVWEYLDFFAHIYGIKQPRRTSLIQELLQLVDLTEKHDSYVMNLSRGMKQRLSLARTMAHDPSLLILDEPASGLDPRARIELRELLRELSRMGKTIMVSSHILSELAEMCSHIGIIERGTLL 214
>gi|166030861|ref|ZP_02233690.1| hypothetical protein DORFOR_00541 [Dorea formicigenerans ATCC 27755] >gi|166029443|gb|EDR48200.1| hypothetical protein DORFOR_00541 [Dorea formicigenerans ATCC 27755] (366 aa)
Score = 286, Expect = 9.5e-24, Identities = 69/211 (32%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++ V +L K Y   +   +D+L+F++  G  + F+G NGAGK+TT+  I G      G + I G D   +  E++  +GY+PE     +  +  +YL + A+   +K KE     E ++ + R+ ++R +  +  S G ++++ +AQAL  NP ++I+DEPT  LDP   I+  D++ +L K H ++ +SSHILSE+      V I+  GK++
  S:     1 MISVKHLTKCY--GEFTAVDDLSFEIDEGHVYGFLGPNGAGKSTTMNIITGCLSATSGQVTIDGHDIFEEPKEAKRAIGYLPEIPPLYTNETPEEYLKFVAEAKGLKGKEMDRQIEGVISQTRIQNVRKRLISKLSKGYRQRVGIAQALLGNPKVIILDEPTVGLDPIQIIEIRDLIKQLGKNH-TVILSSHILSEVQAICEKVLIISGGKLI 210
>gi|126460016|ref|YP_001056294.1| ABC transporter related [Pyrobaculum calidifontis JCM 11548] >gi|126249737|gb|ABO08828.1| ABC transporter related [Pyrobaculum calidifontis JCM 11548] (303 aa)
Score = 286, Expect = 9.5e-24, Identities = 62/210 (29%), Positives = 121/210 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI---DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           ++E + L K + G++   +D ++F    G F A +G NGAGKTTT+  ++G+ R   GS+ + G        L +R  +GY P++  F  ++S ++ L +   +  +   EA   A  +L++  +++ R +    +S G ++K+ +A AL  NP+ L++DEPT+ LDP AR D +D+L ++ +  +++  ++H+  E    ++ V I+  G++
  S:     4 VIEALGLVKAFGGRR--VVDGVSFSAGVG-FTALMGPNGAGKTTTLSMVVGALRPDRGSVRVCGFYMWGRDGLRARRLLGYAPQDMPFKDKLSGYENLVWIGLIKGLGLFEAGREARRLLEEVGLYEHRGKRVALYSGGMRRKLAVAAALLGNPEALVLDEPTSGLDPVARADLWDLLAKVGR-GRAVLFTTHMAEEAQRRADFVVIMHEGRV 212
>gi|163765700|ref|ZP_02172732.1| ABC transporter related [Anaeromyxobacter sp. K] >gi|196170936|gb|ACG71909.1| ABC transporter-related protein [Anaeromyxobacter sp. K] (318 aa)
Score = 286, Expect = 9.5e-24, Identities = 63/198 (31%), Positives = 116/198 (58%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDG--SIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
            +K   +D L+ +V PGE   FVG NGAGKTTTIK ++G      G  SI+   I ++  ++R  +GY+PE+  +   ++  + L + AKL+ +   E     + +L+   +    ++    +S G ++++ +AQAL  +P ++++DEP + LDP  R D  D++ EL++  K++F S+HIL +++   + V ++  GK+
  S:    18 ARKVTAVDALDLEVAPGEIFGFVGPNGAGKTTTIKMLMGLIYPTSGRASIFDDPIPSRRAKAR--IGYLPEHPAYYEFLTGREALRFFAKLSDVPGAERGRRCDELLELVGLSAAADRQIRKYSKGMQQRLGIAQALVGDPALVVLDEPMSGLDPVGRKDVRDLILELKRRGKTVFFSTHILPDVESLCDRVGVILRGKL 215
>gi|85705907|ref|ZP_01037003.1| ABC transporter, ATP-binding protein [Roseovarius sp. 217] >gi|85669495|gb|EAQ24360.1| ABC transporter, ATP-binding protein [Roseovarius sp. 217] (354 aa)
Score = 286, Expect = 1.0e-23, Identities = 84/338 (24%), Positives = 169/338 (50%)
  Q:     5 FTKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEG--DKVGKYEVN---SNNEIIYEFKDKNE---LAELIDKLISKEILVK-FEKYYLSIEDLY 342
            TK D + I +   +   + +    M +  +H+ F   ++    D+     ++ V  L K Y G     +DN+   +  GE  A +G NGAGKTT I ++ G      G   + G D       +R  +G +P+       +  F+ +  T + ++        ++  E IL++  +WD RN      S G K+++L+A+AL + P +L +DEPTA +D + R D ++++ +LQK   +I +++H L E +  ++ + +++ G+I+  + +       G    RI+LV   +     +  Y+++     + +IY ++ + E   +  L+  L  + + V+  E    S+E+++
  S:     4 LTKTDCSLIGNAAHR---RTDAYAGMHVALSHQRFTFCVQKKGADM---AAIVRVEGLTKTYRGG-FTALDNVTLAIEEGEILALLGPNGAGKTTLISTLCGITTPTGGHASVGGHDIITGYRAARAMIGLVPQEI----ALEPFEKVINTVRFSRGLFGKPRDEVLIEKILRQLSLWDKRNNRIRELSGGMKRRVLIAKALCHEPRVLFLDEPTAGVDVELRRDMWEVVRDLQKSGVTIILTTHYLEEAEAMADRIAVINRGEILLIEDKTALMRRMGSKSLRIELVTSLDTIPASLATYDLDRAEDGHSLIYNYQTRAEGTGITRLLQALAEEGLSVRDIETRESSLEEIF 345
>gi|166364171|ref|YP_001656444.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] >gi|166086544|dbj|BAG01252.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] (317 aa)
Score = 286, Expect = 1.0e-23, Identities = 66/210 (31%), Positives = 116/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +  V L KQ+   +H  ++ ++ ++  GE +  +G NGAGKTT I+ +  +     G IY+ G     D  N   +  +GY+P+N      ++ ++YL Y A+L  I   +       +L+  ++    + S    S G K+++ LA+ + + P IL++DEP + LDP AR+ F +I+  LQ    +I ISSH+LS+L    ++V I++ G +V
  S:     8 IATVGLTKQF--DRHGAVNQVDLQIEAGEVYGLIGPNGAGKTTLIRMLAAAEEPTTGEIYLHGERLLRDESNPRLKRNLGYLPDNFPLYDDLNVWNYLDYFARLYHIPRSQRHRRIYEVLELVQLTGKSHNSIATLSRGMKQRLSLARTIIHEPLILLLDEPVSGLDPIARLQFREIIKVLQSAGMTILISSHVLSDLAELCSSVGIMELGYLV 219
>gi|89096591|ref|ZP_01169483.1| transporter [Bacillus sp. NRRL B-14911] >gi|89088606|gb|EAR67715.1| transporter [Bacillus sp. NRRL B-14911] (258 aa)
Score = 286, Expect = 1.0e-23, Identities = 65/210 (30%), Positives = 123/210 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +LE+ +L+K Y  K  P +  ++ +V  GE   ++G NGAGK+TT+K ++G    + G + I G  I +  ++ + K+GY+PE       ++  +YL +  +L  I S  A   A+++++ F + ++      ++S G ++K+L+  +L +NPD+L  DEP   LD  + + F +I+ +L    K+IF SSHI+  ++  S+ + +L +G+I
  S:     5 ILEIEDLKKSYGSK--PVLKGVSLQVKRGEIIGYIGPNGAGKSTTVKIMLGIEDGYSGGVKIFGQDISDGKIDYKRKIGYVPEIAEVYDNLTGHEYLTFIGELYGIDSDLASYKAKALMELFGIGEVYYSRITSYSKGMRQKLLIISSLLHNPDLLFFDEPINGLDANSVMIFKEIMAQLAVQGKTIFYSSHIMDVVEKISSRIILLHDGRI 214
>gi|150385659|ref|ZP_01924267.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] >gi|150257966|gb|EDM95269.1| ABC transporter related [Victivallis vadensis ATCC BAA-548] (321 aa)
Score = 286, Expect = 1.0e-23, Identities = 74/223 (33%), Positives = 127/223 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLR---NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT----QKRNKNENGE 278
           ++E  N+ + Y+G K   +  ++F V  GE   F+G NGAGK+TT++ I G      G I I G D   K +E++   GY+PEN      +S   +L ++A    I+    K  +E+I +  ++  L    +QS +  S G   ++  AQA+ ++P +LI+DEPT  LDP  + +  +++ E+ K  K+I +S+HIL E++     V I+D G++V+     Q + K  +G+
  S:     1 MIEATNVTR-YFGDK-AAVAGVSFSVGKGEVLGFLGPNGAGKSTTMRMITGFLPLSGGRIAIGGCDIAEKPVEAKRLFGYLPENAPAYQDMSVAGFLDFSAS---IRGLSGKARSEAIARAVKLCHLEKVMHQSIDTLSKGYHHRVCFAQAILHDPPVLILDEPTDGLDPNQKHEMRELIREMGK-SKAIIVSTHILEEVEAICTRVIIIDRGELVFNGTPQQLKEKAPHGD 226
>gi|189501678|ref|YP_001957395.1| hypothetical protein Aasi_0222 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497119|gb|ACE05666.1| hypothetical protein Aasi_0222 [Candidatus Amoebophilus asiaticus 5a2] (308 aa)
Score = 286, Expect = 1.1e-23, Identities = 64/212 (30%), Positives = 121/212 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +++  L K +  K    +D+L F+V  GE    +G NGAGK+TT+K + G  +  +G IYI G D   ++L+++  +GY+PE+      +   +YL +   ++ +  +     A  ++++  + D++N+     S G ++++ LAQAL ++P +L++DEPT  LDP        ++ EL +  K+I  S+HI+ E++   + V I+ +GK+  T
  S:     3 IDISKLSKHFQNKT--VVDHLTFRVKKGEILGLLGPNGAGKSTTMKMLTGYIQPSEGKIYICGYDLNKESLKAKKNIGYLPEHNPLYLDMYVHEYLQFMGSIHGLGKRACIQRARLVVEQCDIGDVQNKKLGVLSKGYRQRVGLAQALMHDPTVLVLDEPTTGLDPNQLHHIRQLIKELGR-EKAIIFSTHIMQEVEAVCDQVIIMHHGKLCLT 213
>gi|167934694|ref|ZP_02521769.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus AH1134] (312 aa)
Score = 286, Expect = 1.1e-23, Identities = 77/274 (28%), Positives = 149/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKHKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNQIIQHFINHDIEIR 288
>gi|124521337|ref|ZP_01696284.1| ABC transporter related [Bacillus coagulans 36D1] >gi|124496896|gb|EAY44472.1| ABC transporter related [Bacillus coagulans 36D1] (303 aa)
Score = 286, Expect = 1.1e-23, Identities = 75/216 (34%), Positives = 121/216 (56%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLN-KIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           T P L+V+++ K+  G+K   I  ++F+V PGE   F+G NGAGKTTTI+ + G  R   G I I G  +  +  E+   +G I EN      ++ ++ L Y A+++  I        A  +    R+ D        +S G ++++ +AQAL  NP +LI+DEPT  LDP    +  + +  L +K H S+ +SSH+LSE+ L  + V I+ NG+++ T
  S:     3 TIPALKVIDVHKKI-GRKE-IIKGISFEVMPGEVFGFLGPNGAGKTTTIRMLTGLIRPTSGKILIGGKNVRTEFTEAMKNLGCIVENPEMYPFLTGYENLAYFARMDPSIPRNRLDEVAALVGLTGRIHD----KVKTYSLGMRQRLGIAQALLGNPKLLILDEPTNGLDPAGIREMREFIRSLAEKAHLSVLVSSHLLSEVQLMCDKVAIIHNGQVIRT 216
>gi|88603759|ref|YP_503937.1| ABC transporter related [Methanospirillum hungatei JF-1] >gi|88189221|gb|ABD42218.1| ABC transporter related [Methanospirillum hungatei JF-1] (310 aa)
Score = 286, Expect = 1.1e-23, Identities = 79/253 (31%), Positives = 134/253 (52%)
  Q:    45 VNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID----NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKY 297
           +N  D  L   ++E   L K+Y  ++   ++ + F V  GE   F+G NGAGKTTT+K +        G + I G D     +N+  R ++G +P+ T     +S FD L   A+   I   +A+  A S+L+ F +    +      S G K+++ LA++L NNPD+LI+DEPT  LDP+AR   ++ L +L+    +I +++H L E     + + I+D+G I+   + + +E       + +VE    D+V +Y
  S:     1 MNTSDSSLPNQVIEATGLIKRY--RELTAVNGITFSVTKGELFGFLGPNGAGKTTTMKMVQCVSPRSGGELKIFGEDPEFSGRNI--RKRIGVVPQETNLDPDLSVFDNLVMYARFFDIPKSDAEKRALSLLEFFELEAKMDTIIEKLSGGMKRRLHLARSLMNNPDLLILDEPTIGLDPQARHHIWEKLLKLRAEGHTIVLTTHYLDEAARLCDRLVIMDHGNILV--EGSPDELVRAYIGMDIVETDNTDEVSRY 251
>gi|126697865|ref|YP_001086762.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] >gi|115249302|emb|CAJ67115.1| ABC transporter, ATP-binding protein [Clostridium difficile 630] (306 aa)
Score = 286, Expect = 1.1e-23, Identities = 90/291 (30%), Positives = 160/291 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN------------SNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G      G+I + G  +      S   +GY+P+   F + +   +YL    ++  +  KE ++ +E +L    + + + +    FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I  +   ++ ++     R+ L+E    D++ K++ +            +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     4 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKKEIQIRSEELLSLVGLGNEKRRI-GGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRL-LLEFASNDEIQKFKSSDGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 305
>gi|170729183|ref|YP_001763209.1| ABC transporter related [Shewanella woodyi ATCC 51908] >gi|169814530|gb|ACA89114.1| ABC transporter related [Shewanella woodyi ATCC 51908] (244 aa)
Score = 285, Expect = 1.1e-23, Identities = 63/211 (29%), Positives = 117/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   ++NL+F+   G+    +G NGAGKTT ++++ G  +  +G   I GID     ++++ ++G  P+      R++  +Y+ Y A+LN +   +AK   + +L +  M D+ ++    FS GQ+ K  LAQA+ + P  +I+DEPT  LD  +     D+L  L++    +  SSH++ E+    + V ++  GK+V
  S:     1 MIKVCNLSKKIGDVQ--ALNNLSFEANDGQITGLLGPNGAGKTTCLRTVFGLLQADEGHAEIDGIDVAKSPIQAKQQLGLFPDPFGLYERLTPREYISYFAELNGLSRTQAKDATQKVLTELHMDDIADRRCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGLDVMSTRVLRDLLKALKEQGHCVLFSSHVMQEVAALCDQVIVMAEGKVV 211
>gi|160873201|ref|YP_001552517.1| ABC transporter related [Shewanella baltica OS195] >gi|160858723|gb|ABX47257.1| ABC transporter related [Shewanella baltica OS195] (244 aa)
Score = 285, Expect = 1.1e-23, Identities = 65/211 (30%), Positives = 118/211 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   +++L+F    G+    +G NGAGKTT +++I G  +  +G   I GID     + ++ ++G  P+      R++  +Y+ Y A+L+ + SKEAK     ++ K R+ D+ ++    FS GQ+ K  LAQA+ ++P  +I+DEPT  LD  +     DIL +L+     +  SSH++ E+    + V ++  G++V
  S:     1 MIKVSNLSKRIGDVQ--ALNDLSFVAQNGQITGLLGPNGAGKTTCLRTIFGLLKPDNGKAEIEGIDVAIDPIGAKQQLGLFPDPFGLYERLTPREYIRYFAELSGLSSKEAKEATSQVIAKLRLEDISDRRCKGFSQGQRMKTALAQAIVHSPSNIILDEPTRGLDVMSTRLLRDILIDLKNQGHCVLFSSHVMQEVAALCDQVIVMAQGRVV 211
>gi|28210006|ref|NP_780950.1| ABC transporter ATP-binding protein [Clostridium tetani E88] >gi|28202441|gb|AAO34887.1| ABC transporter ATP-binding protein [Clostridium tetani E88] (241 aa)
Score = 285, Expect = 1.1e-23, Identities = 68/218 (31%), Positives = 123/218 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKM--GYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           ++ + N+ K Y G     +DN++  +  GE   F+G NGAGKTTTIK I G     +G I I+G+D K    R KM  G++P+N     R+   +YL + A + K+  ++ +   + +  +F M +  +    ++S G ++KI++   L ++P++ I+DEP   LDPK+     +++ E  K  K++F S+H+L   +   + + I++NGK++   K N+
  S:     1 MIHLENVSKSYNGTTK-AVDNISLSIEKGEIFGFLGPNGAGKTTTIKMITGILNADEGEIKINGVDIKKDPLRAKMQFGFVPDNPDMFLRLKGIEYLNFIADIYKVSQEKREEKIKELSLRFNMENALDDRIQSYSHGMRQKIIIMGVLIHDPEVWILDEPMTGLDPKSAYILKEMMREHVKSGKTVFFSTHVLEVAEKLCDRLAIINNGKVLLCGKLNE 219
>gi|169349557|ref|ZP_02866495.1| hypothetical protein CLOSPI_00284 [Clostridium spiroforme DSM 1552] >gi|169293632|gb|EDS75765.1| hypothetical protein CLOSPI_00284 [Clostridium spiroforme DSM 1552] (311 aa)
Score = 285, Expect = 1.1e-23, Identities = 71/205 (34%), Positives = 124/205 (60%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIVYTQ 269
           +Y+G     ID+++F++  G+ +  +G NGAGK+TT+  ++G      GS  I G    + +++  MGY PE   F S +S  +YL Y A+L+     +A   +  +L++F + + + +   +FS+G KKK+ L QAL ++P++L++DEPTANLDP +R +    L +L    K ++ ISSH+L+EL+   + V +++ G +V  Q
  S:    12 KYFGS-FKAIDDISFELDGGKIYGIIGPNGAGKSTTMSILMGLVFPSSGSGIIKGYPLGSNDAKKLMGYSPEFPNFYSDMSCLEYLVYMAQLSGFNYDDAIKKSLILLEEFGLSNHKFKKVADFSTGMKKKVGLIQALIHDPEVLLLDEPTANLDPSSRSEIIHSLKKLVSQRKMTVLISSHVLTELETIIDHVILINQGHVVLNQ 216
>gi|168143590|ref|ZP_02586819.1| ABC transporter, ATP-binding protein [Bacillus cereus G9842] (238 aa)
Score = 285, Expect = 1.1e-23, Identities = 68/217 (31%), Positives = 120/217 (55%)
  Q:    56 LLEVVNLRKQYY-GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
           +LE++N  K Y  GKK   +D+LN  V  G+   F+G NGAGK+TTIKS++G     +G I+I G  +    +  +  M YIP+N     +++   YL + A + K+ +++ +   +     F +        +++S G K+K+ +  A+ + P +L++DEP   LDPKA +    I+ EL +   +IF S+H+L   +   N V +++ GK+  + + N
  S:     1 MLEIINFSKTYKDGKK--AVDHLNIAVKAGDIFGFIGHNGAGKSTTIKSLVGVIDFEEGEIFIDGHSVKKDPIACKRVMAYIPDNPDLYEQLTGIQYLNFVADVFKVPARDREEQIQKYGDAFEITPYLGDLISSYSHGMKQKVAIISAVLHKPKLLVLDEPFVGLDPKAAVVLKGIMKELCEKGSAIFFSTHVLDVAEKLCNKVAMINRGKLALSGEVN 218
>gi|145953777|ref|ZP_01802785.1| hypothetical protein CdifQ_04003790 [Clostridium difficile QCD-32g58] >gi|168694556|ref|ZP_02726833.1| Predicted transporter protein [Clostridium difficile QCD-37x79] >gi|168724221|ref|ZP_02756498.1| Predicted transporter protein [Clostridium difficile QCD-76w55] >gi|168731561|ref|ZP_02763838.1| Predicted transporter protein [Clostridium difficile QCD-97b34] >gi|196160452|ref|ZP_03121013.1| transporter protein [Clostridium difficile CIP 107932] (295 aa)
Score = 285, Expect = 1.1e-23, Identities = 72/210 (34%), Positives = 124/210 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL-----ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L++ ++ K++  K    ++++   + PG +  F+GANGAGKTT ++ I    +  +G I  +G   KN+     E R  +G++P+   FP   S  DYL Y A L  +  +E K    ++L+   + D++N+     S G K+++ +AQA+ N+P ILIMDEPTA LDP  R+ F + + E    ++ + IS+HI+S+++  S    I+ +GKI+
  S:     3 LKIEHVTKKF--KDKIAVEDVCLTLTPGVW-GFLGANGAGKTTLMRIITDIMKPTNGKILYNG---KNIYIMGAEYRNLLGFLPQEFGFPQDFSVKDYLEYIAALKDVPPREVKGKINNLLEILTLSDVKNKKIIKLSGGMKRRVGIAQAMLNDPKILIMDEPTAGLDPGERVRFRNFISEFSH-NRVVLISTHIVSDIEYISTQNAIMKSGKIL 210
>gi|148544486|ref|YP_001271856.1| ABC transporter related [Lactobacillus reuteri F275] >gi|184153851|ref|YP_001842192.1| ABC transporter ATP-binding component [Lactobacillus reuteri F275] >gi|148531520|gb|ABQ83519.1| ABC transporter related [Lactobacillus reuteri F275] >gi|183225195|dbj|BAG25712.1| ABC transporter ATP-binding component [Lactobacillus reuteri F275] (245 aa)
Score = 285, Expect = 1.1e-23, Identities = 63/194 (32%), Positives = 106/194 (54%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + +++F V PGE    +G NGAGK+TT+  +IG  R F GSI I+G  I     E + ++ Y+PE       ++  +++  T    ++   EA   A  +LK FR+ +  +  P NFS G K+K+++  A      +LI+DEP   LDP A  D  D++ + +K   ++ +S+H+L     Y +   +L +GK+
  S:    16 PVLKDVSFDVQPGELVGLIGLNGAGKSTTLNHVIGLLRPFSGSIKINGLTIQANPEEYKKQIAYVPETPILYDELTLREHIDLTIMAYELDHGEAWQRATKLLKLFRLDNKLDWFPANFSKGMKQKVMICCAFMTKAKLLIIDEPFYGLDPLAVHDLLDLIEQKKKEGVAVLMSTHVLDTAQRYCDRFVLLADGKV 211
>gi|187778500|ref|ZP_02994973.1| hypothetical protein CLOSPO_02095 [Clostridium sporogenes ATCC 15579] >gi|187772125|gb|EDU35927.1| hypothetical protein CLOSPO_02095 [Clostridium sporogenes ATCC 15579] (285 aa)
Score = 285, Expect = 1.2e-23, Identities = 95/274 (34%), Positives = 156/274 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDN--KNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKF-RMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV 329
           +LEV NL+K+Y   K  +++N+NF++  G    F+G NGAGK+TTIK I+   +   G I I G+DN     E + K+G++ +  +F   ++          + KI +   K +++    K+ + +DL   +   N S G K K  LA ALS+N +++IMDEPTA LDP  R +  DIL +L Q  +KS+F S+HI ++L+  ++ +T ++ GKIV+++  NK+E  E    +K   DF  ++  KY V  N    + F+     A +I ++  K  L+
  S:     4 ILEVRNLKKEY---KDFSLENINFQLDRGYIMGFIGPNGAGKSTTIKLIMNLIKKDSGDIKIFGMDNVKGEKEVKEKIGFVYDENYFYDHVN-------IETMKKIIAPFYKGWSDKTFSKYLKTFDLDPKKKIKNLSKGMKMKFSLALALSHNAELIIMDEPTAGLDPVFRREILDILYDLIQDENKSVFFSTHITTDLEKIADYITFINKGKIVFSE--NKDEIMEKYDLVKGGLDFLNEETKKYFVGINKN-SFGFEGLTTSANIIKEITRKGELI 269
>gi|193709095|ref|XP_001947916.1| PREDICTED: similar to AGAP006379-PA [Acyrthosiphon pisum] (1577 aa)
Score = 285, Expect = 1.2e-23, Identities = 70/210 (33%), Positives = 122/210 (58%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-----RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + V NL K++       +D +N  +Y G+  A +G NGAGKTTT+  I G +    G+I ++G   KN+ S     R  +G  P++    S +++ D+L +   L  +  + AK     +LK   +   +N+  +N S G K+K+ LA AL  NP ILI+DEPT+ +DP++R + +D+L   +   ++I I++H + E D+  + + I+D+GK++
  S:   497 ISVQNLHKRF--GNFYAVDGVNLDLYKGQITALLGHNGAGKTTTMSIITGLFSPTYGTINVNG---KNVFSNIDDFRQNLGLCPQHNLLFSYLTTLDHLIFFGMLKGLPMRNAKSEGLHLLKLLNILQKKNELVSNLSGGMKRKLSLAIALVGNPQILILDEPTSGMDPESRREMWDLLLSFRGT-RTILITTHFMEEADVLGDRIAIMDHGKVI 705
Score = 217, Expect = 9.7e-16, Identities = 60/211 (28%), Positives = 106/211 (50%)
  Q:    53 TKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK-----MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           + PLL V +L K++   K   +  ++F V PGE    +G NGAGKTTT + + G      G   I       L S        +GY P+      +++  + L   A L  I     K   +  +K   + + +++    +S G K+K+  A AL  +P ++ +DEPT+ +DP AR + + +L   Q+  +++ ++SH + E +   N +TI+ +G
  S:  1249 SSPLLLVDDLVKKF-SFKFTGVRGISFAVSPGECFGLLGVNGAGKTTTFRILTGDTFPSKGDASILTDKLYKLSSNINQYVSLIGYCPQFDAINDQLTGRETLRLMAILRGISPTNTKKHVDKWIKLLGLEEYKDRVCGKYSGGNKRKLNTAMALIGDPPVVFLDEPTSGVDPVARRNLWQLLAASQRGGQAVVLTSHSMDECEALCNRLTIMVDG 1463
>gi|160915432|ref|ZP_02077643.1| hypothetical protein EUBDOL_01440 [Eubacterium dolichum DSM 3991] >gi|158432552|gb|EDP10841.1| hypothetical protein EUBDOL_01440 [Eubacterium dolichum DSM 3991] (249 aa)
Score = 285, Expect = 1.2e-23, Identities = 63/214 (29%), Positives = 119/214 (55%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           K ++E+ N+ K  YG KH  +D+++  +  GE   F+G NGAGKTTTIK I G     +GSI I+G D     +E++ + G +P++     R+   +YL +   + ++ S   +   + + + F M +  N    ++S G ++KI++   L ++P++ I+DEP   LDP++     +++ E      ++F S+H+L   +   + V I++ G I++
  S:     7 KTMIEINNVTK-IYGGKHKAVDHISLHIPTGEIVGFIGPNGAGKTTTIKMITGVLNPDEGSISINGKDIVKNPIEAKKEFGIVPDSADMFLRLKGIEYLNFMGDIYEVDSDLRRQRIDELAEAFEMSNALNDKILSYSHGMRQKIIIMGVLLSDPNVWILDEPMTGLDPQSAFKLKEMMKEHAAKGNTVFFSTHVLEVAEKLCDKVVIINKGTILF 221
>gi|49481092|ref|YP_035971.1| multidrug ABC transporter, ATP-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166992413|ref|ZP_02258873.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus AH820] >gi|196033276|ref|ZP_03100688.1| ABC transporter, ATP-binding protein [Bacillus cereus W] >gi|49332648|gb|AAT63294.1| multidrug ABC transporter, ATP-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195993710|gb|EDX57666.1| ABC transporter, ATP-binding protein [Bacillus cereus W] (312 aa)
Score = 285, Expect = 1.2e-23, Identities = 77/274 (28%), Positives = 150/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D +   P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGVVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKQKSFPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHFINHDIEIR 288
>gi|163816388|ref|ZP_02207754.1| hypothetical protein COPEUT_02577 [Coprococcus eutactus ATCC 27759] >gi|158448385|gb|EDP25380.1| hypothetical protein COPEUT_02577 [Coprococcus eutactus ATCC 27759] (317 aa)
Score = 285, Expect = 1.3e-23, Identities = 99/292 (33%), Positives = 159/292 (54%)
  Q:    47 QEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQK-LHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCY-RIKLVEDFEG------DKVG--KYEVNSNNEIIYEFKDKNELAELIDKLISKEILVK--------FEKYYLSI 338
           +E  +L++ LLE  NL KQY    H  +D++N  +  G  + F+G NGAGKTT +K I G  +   G I + G   K+L+  R+++G + E       +++++ L    KL  IK K    + E IL+   + ++  +   +FS G K+++ +  AL   PD+L++DEP   LDP+   +  D +  LQK  + +I ISSHIL EL   +    I+ NG ++  Q+  + E    C  RI+L  D         D +G   Y+V ++ E I+ F+  NE A L  +L    I VK         E Y+L++
  S:     8 KEMKNLSEMLLETRNLTKQY--GHHKAVDSVNMHIKKGAIYGFIGRNGAGKTTCLKMISGLSKPTCGEIEMFGYKGKDLQKVRSRIGCLIEAPGLYGNMTAYENLNIKCKLFGIKKKS---YIEEILRIIGLENVEKKKTKHFSLGMKQRLGIGLALVGEPDLLVLDEPINGLDPQGIAEIRDTIQRLQKEKNMTICISSHILGELSKIATDYGIIHNGSLL--QEITREELIRRCSERIELTLDHPKQAIPVLDSMGFTNYQV-TDKEHIHIFERLNESAALNMELAKSGIPVKGISITSEELETYFLNL 310
>gi|89893012|ref|YP_516499.1| hypothetical protein DSY0266 [Desulfitobacterium hafniense Y51] >gi|89332460|dbj|BAE82055.1| hypothetical protein [Desulfitobacterium hafniense Y51] (327 aa)
Score = 285, Expect = 1.4e-23, Identities = 66/210 (31%), Positives = 122/210 (58%)
  Q:    57 LEVVNLRKQYYGKKH----PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGI--DNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +EV+N  +  Y +K       + ++N  V  GE +A +G NGAGK+T IK I+G  +   G I I G+  D KN E + ++GY+PE   F   +++++ + + AKL  I  K      E +L++  + +  ++    FS G ++++ LAQA+ + PD+L++DEPT  LDP   ++   ++    K   +I  SSH L++++  +  + I++ G+++
  S:    25 MEVINTLEVKYAQKFYGPFQAVKDINLTVEKGEIYALLGHNGAGKSTLIKMILGLVKASAGMIEIEGLNYDAKNKEIKKRVGYLPERMNFYDNLTAWETISFYAKLKGITRKRC----EEVLEQVGLREAEHRRVGTFSKGMQQRLGLAQAIIHKPDLLVLDEPTTGLDPIGILELKAMIRNWNKEGTTILFSSHNLNDVEELAQRIGIMNRGEMI 236
>gi|166368065|ref|YP_001660338.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] >gi|166090438|dbj|BAG05146.1| ABC-transporter ATP-binding protein [Microcystis aeruginosa NIES-843] (326 aa)
Score = 285, Expect = 1.4e-23, Identities = 66/213 (30%), Positives = 119/213 (55%)
  Q:    54 KPLLEVVNLRKQY-----YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRM--WDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           + +LE +NL+K Y       KK  ++ N    V+ GE    +G NGAGKTT +K+++G  R   G   I G    +   R ++GY+PEN ++   ++ +++L   A + +I S   K     +L    +     + +    +S G  ++I +AQAL N+P+++  DEP + LDP  R    +I+  L++  K+IF +SHILS+++   + + +L  G+++
  S:    17 QTVLETLNLQKTYRTGFWLDKKIESLKNCTLIVHEGETFGLLGPNGAGKTTLLKTLLGIVRPTSGRALILGQPIGDRSVRQRIGYLPENAYYYDYLTGWEFLQLIASIFQIPSSVQKKRIPELLDLVGLDRKTAQKKQLRQYSKGMMQRIGIAQALINDPELVFFDEPMSGLDPIGRYQVREIIQSLKQRGKTIFFNSHILSDVEQICDRIALLARGELL 236
>gi|54302528|ref|YP_132521.1| ABC transporter [Photobacterium profundum SS9] >gi|46915950|emb|CAG22721.1| hypothetical NosF protein [Photobacterium profundum SS9] (349 aa)
Score = 285, Expect = 1.4e-23, Identities = 68/215 (31%), Positives = 111/215 (51%)
  Q:    50 IDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID---NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           I  T P++ + N  K Y  ++   + N+N ++  GE     G NGAGKTT +K I+G  +   G + I G+D    K   SR  +GY+PEN  F   ++  + L Y ++L  +  K+     E +     M    N+    +S G ++++ LAQA    P +L++DEPT  LDP A  +F+  +  L+    SI + SHIL  ++ + +   IL  G+
  S:    24 IKATSPIVSLHNTSKHY--QQVEALKNINLQLAAGEVLGLFGHNGAGKTTMMKLILGVIKASHGDVKIFGVDPLSKKAWHSRRNIGYLPENVSFYDHLTGLEVLTYFSRLKSVNKKQVIALLEQVGLTVAM----NRKVKTYSKGMRQRLGLAQAFLGEPKLLLLDEPTVGLDPIATKEFYQTVDNLKSNGASIILCSHILPGVEQHIDRAIILSGGE 235
>gi|114320235|ref|YP_741918.1| ABC transporter related [Alkalilimnicola ehrlichei MLHE-1] >gi|114226629|gb|ABI56428.1| ABC transporter related [Alkalilimnicola ehrlichei MLHE-1] (308 aa)
Score = 285, Expect = 1.4e-23, Identities = 67/209 (32%), Positives = 119/209 (56%)
  Q:    58 EVVNLRK--QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES---RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +VV+L    +++G  H  +  L   +  GE    +G NGAGK+TT+K I+G      GS+ + G      E+   R ++GY+PEN  F  +++  + L Y A L K+    A+    ++L++  +    ++    +S G ++++ LAQAL  +P +L+MDEPT  LDP A  DF+D++ +L+    SI + SH+L  ++ + +   I+  GK++
  S:     3 KVVSLESVDKHFGSVH-AVTGLTLGLEAGEVLGLMGHNGAGKSTTMKLILGLLTPTAGSVEVFGKSPSQKEAADLRGRIGYLPENVSFYEQLTGREVLRYFADLKKV----ARSLVGTLLERVGLAHAADRKVRTYSKGMRQRLGLAQALLGDPQLLLMDEPTVGLDPIATRDFYDMMDDLRGKGVSIILCSHVLPGIERHIDRAAIMGQGKLL 211
>gi|195436624|ref|XP_002066257.1| GK18193 [Drosophila willistoni] >gi|194162342|gb|EDW77243.1| GK18193 [Drosophila willistoni] (1529 aa)
Score = 284, Expect = 1.5e-23, Identities = 86/286 (30%), Positives = 156/286 (54%)
  Q:    59 VVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT----QKRNKNENGEMCYRIKL-VEDFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILVKFEK--YYLSIEDLYKK 344
           + +L K++   K  TI  DNLN  +   E    +G NGAGKTT +  I+G      G I +     +++ S R  +G+ P+++ F S ++   +L + A+L    + EA  +A++ LKK  ++D  +    N S G K+++ L  A++ N  I+I+DEP++ LD ++R + +DIL  L+K  K+I +++H + E ++  + + IL NG++  +    + + K++ G   YR+KL + DF                   F+ ++E+ ELI+K I   + +   K   Y+ +   YKK
  S:   409 ISDLCKKFQTTKRETIISDNLNMTINNKEITVLLGHNGAGKTTMMNMIMGLVPKDSGKIVVC--SERDVSSYRHLIGFCPQHSVFMSYMTCRQHLKFFAELRGATNAEAHSWADTTLKKLNLYDKADVYGKNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDIESRRELWDILLNLRK-EKAILVTTHYMEEAEVLGDTICILANGQLQRSGSPLELKRKSDRG---YRLKLEITDF------------------NFR-RDEIMELINKHIPSAMFISMVKPTVYICLPYKYKK 679
Score = 242, Expect = 1.3e-18, Identities = 77/259 (29%), Positives = 127/259 (49%)
  Q:     6 TKKDNNFISSLKSKQLEKKEKEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIK-------SKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           T KDN   S    K+ E++ K+     N + +Y                PL+ V NL K Y   K+  +D ++F    GE    +G NGAGKT+T + I  +     G+I+I GID +  E   R + GY P+       +++   L Y A L  ++       S EA +  E  L K  +   R     ++S G K+K+L A A+   P ++++DEPT  +DP +R   +  + + Q L +++ ++SH + E +   N + I+  GK
  S:  1164 TAKDNGDSSIDDCKKEEERVKDLMSNGNGSDQY----------------PLI-VSNLVKSY--NKNRAVDKISFAAPRGECFGLLGVNGAGKTSTFQMIAANLTLDKGNIHIDGIDIRQDEVAYRHRFGYCPQYDALNRFMTAEQCLRYMAMLRGLRVGKEGADSVEANV--EYWLDKIHLTKYRQIQVCHYSGGTKRKLLAAMAMIGAPSLVLLDEPTTGVDPISRRFLWQCIKDFQNLDRTVVLTSHSMDECEELCNRLAIMAKGK 1410
>gi|195338273|ref|XP_002035749.1| GM15192 [Drosophila sechellia] >gi|194129629|gb|EDW51672.1| GM15192 [Drosophila sechellia] (1594 aa)
Score = 284, Expect = 1.5e-23, Identities = 75/231 (32%), Positives = 134/231 (58%)
  Q:    59 VVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEMCYRIKL-VEDF 289
           +  L K++   K  T+  DNLN  +   E    +G NGAGKTT +  I+G      G I +     +++ S R  +G+ P+++ F S ++   +L + A+L   +  +A+ +A+  LKK  + D RN+   N S G K+++ L  A++ N  I+I+DEP++ LD  +R + +DIL  L+K  K+I +++H + E ++  + + IL NGK+  + +    K ++G + YR+KL + DF
  S:   461 ITELCKKFQTSKRDTLISDNLNMTINNKEITVLLGHNGAGKTTMMNMIMGLVPKDSGKIIVC--SERDVASYRHLIGFCPQHSVFMSYMTCHQHLEFFAQLRGARRSDARDWADEKLKKLGLGDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDINSRRELWDILLNLRK-EKAILVTTHYMEEAEVLGDTICILANGKLQSIGSPLELKRKSG-IGYRLKLEINDF 693
Score = 214, Expect = 2.2e-15, Identities = 62/210 (29%), Positives = 107/210 (50%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSK-----EAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           PL+ V NLRK+Y  K    +D ++     GE    +G NGAGKT+T + I  +     GSI I G  I    L+ R   GY P+       +++   L+Y A L  + +        K   +  L+K  +   +     ++S G K+K+L A A+   P ++++DEPT  +DP +R   +  + + Q   +++ ++SH + E +   N + I+ +GK
  S:  1252 PLI-VHNLRKRYGDKV--AVDGVSLAAAQGECFGLLGVNGAGKTSTFQMIAANLPLDGGSIRIKGAEIREHELKYREYFGYCPQYDALNKFMTAEQCLHYMALLRGLSNSTEGPASCKENVKYWLEKMHLTKYQKVQVRHYSGGTKRKLLAAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRLAIMAHGK 1465
>gi|118726438|ref|ZP_01575064.1| ABC transporter related [Clostridium cellulolyticum H10] >gi|118664205|gb|EAV70841.1| ABC transporter related [Clostridium cellulolyticum H10] (242 aa)
Score = 284, Expect = 1.5e-23, Identities = 68/213 (31%), Positives = 112/213 (52%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           K +L + NL K Y G K   +DNL  ++  G+ + F+G NGAGKTTTIK + G     +G I I G  +    LE +  + YIP+N      ++   YL + A +  I + E +   +       + +      +++S G K+K+ +  AL +NP + IMDEP   LDPKA     +++ E  +   +IF S+H+L   +   N + I+ +GK++
  S:     4 KNMLTISNLSKTYKGGKR-AVDNLTLEIQKGDIYGFIGHNGAGKTTTIKCVAGILEFSEGDILIEGKSVKTNPLECKRMIAYIPDNPDLYENMTGIQYLNFIADVFSISANEREKSIKEYADMMELTESLGDLISSYSHGMKQKLAIISALVHNPSLYIMDEPFVGLDPKAAHTLKEVMKEKCRQGSAIFFSTHVLEVAEKLCNKIAIIKDGKLI 217
>gi|192810199|ref|ZP_03038872.1| ABC transporter related [Geobacillus sp. Y412MC10] >gi|192800491|gb|EDV76998.1| ABC transporter related [Geobacillus sp. Y412MC10] (309 aa)
Score = 284, Expect = 1.5e-23, Identities = 68/215 (31%), Positives = 121/215 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           ++E+ NL K+Y G  H  + +++  +  G    FVG NGAGK+TT+  +        G   + G D      E R ++GY+P+      ++ S +YL++      I   E +     +L+   + D  +   ++ S G K+++ LA+ L ++P++LI+DEP + LDP+ARI+  +IL EL+ + K+I ISSHIL EL    + + ++++G++V   K
  S:     1 MIEIRNLSKRY-GAFH-ALKDISLHIEKGTVFGFVGPNGAGKSTTMSILATLMLPTSGVAKVGGYDVTQHPKEVRKRIGYMPDFFGVYDQLKSTEYLHFYGASYGIPRAEREQLIPQLLELVNLSDKADTYVDSLSRGMKQRLCLARCLVHDPEVLILDEPASGLDPRARIEMREILKELKLMGKTIIISSHILPELAEMVDEIGVIEHGEMVAQGK 215
>gi|145956228|ref|ZP_01805225.1| hypothetical protein CdifQ_04000332 [Clostridium difficile QCD-32g58] (306 aa)
Score = 284, Expect = 1.5e-23, Identities = 90/291 (30%), Positives = 160/291 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN------------SNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G      G+I + G  +      S   +GY+P+   F + +   +YL    ++  +  KE K+ +E +L    + + + +    FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I  +   ++ ++     R+ L+E    +++ K++ +            +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     4 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKKEIKIRSEELLSLVGLGNEKRRI-GGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRL-LLEFASNNEIQKFKSSGGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 305
>gi|169826003|ref|YP_001696161.1| ABC-type transporter ATP-binding protein [Lysinibacillus sphaericus C3-41] >gi|168990491|gb|ACA38031.1| ABC-type transporter ATP-binding protein [Lysinibacillus sphaericus C3-41] (239 aa)
Score = 284, Expect = 1.6e-23, Identities = 67/192 (34%), Positives = 105/192 (54%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNK--NLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           I +L+F +  GE    +G NGAGK+TTIK IIG+    +G IY++G+  K    + RT   YIPE       ++  ++L  TA    I        +E +LK+FRM    N  P++FS G ++K+++  A   NP + I+DEP   LDP       D + E +K   SI +S+HILS  + + + + +L  G++
  S:     9 IKDLSFTIEKGELVGLIGLNGAGKSTTIKHIIGTMLPKEGDIYLNGVTLKEDTDKYRTAFSYIPETPVLYDELTLREHLELTAMAYGIDKATLDARSEVLLKEFRMEKRLNWFPSHFSKGMRQKVMIMCAFLINPSLYIIDEPFVGLDPLGIQSLLDQMDEKKKEGASILMSTHILSTAEKHCDRIILLHEGRV 202
>gi|168696496|ref|ZP_02728773.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-37x79] >gi|168725387|ref|ZP_02757664.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-76w55] >gi|168732487|ref|ZP_02764764.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-97b34] >gi|196161208|ref|ZP_03121769.1| ABC transporter, ATP-binding protein [Clostridium difficile CIP 107932] (305 aa)
Score = 284, Expect = 1.6e-23, Identities = 90/291 (30%), Positives = 160/291 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN------------SNNEIIYEFKDKNELAELIDKLISKEIL--VKFEKYYLSIEDLYKKYV 346
           ++ +  L K +  +K   IDNLNF V  G    FVG NGAGKTTT+K ++G      G+I + G  +      S   +GY+P+   F + +   +YL    ++  +  KE K+ +E +L    + + + +    FS G K+++ +AQAL + P +LI DEPT+ LDP  R +  DI+ +++     IF S+HILS+++   + V IL+ G I  +   ++ ++     R+ L+E    +++ K++ +            +N EI+   KD   + + +   +++  L  VK E   LS+E+L+ + V
  S:     3 IVSINGLSKGFGNRK--IIDNLNFTVPEGSVFGFVGKNGAGKTTTMKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEITGLSKKEIKIRSEELLSLVGLGNEKRRI-GGFSRGMKQRLGIAQALLSRPKLLICDEPTSALDPVGRKEILDIMLKIKDSTTVIF-STHILSDVERICDHVAILNKGSIALSGTLSEIKSMHGKDRL-LLEFASNNEIQKFKSSGGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLAEMNLCPVKMELIELSLENLFLEVV 304
>gi|193692972|ref|XP_001946066.1| PREDICTED: similar to ATP-binding cassette sub-family A member 3, putative, partial [Acyrthosiphon pisum] (767 aa)
Score = 284, Expect = 1.6e-23, Identities = 68/209 (32%), Positives = 125/209 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           + V NL K ++G  H  ++ +N  +Y G+  A +G NGAGKTTT+  I G      G++Y++G D  K++++ R  +G  P++    S +++ D+L +   L  +  + AK     +LK   +   +    +N S G K+K+ LA AL+ NP ILI+DEPT+ +DP++R + +D+L   + + ++I I++H + E D+  + + I+D+G++
  S:   464 ISVQNLHK-HFGNFH-AVNGVNLDLYKGQITALLGHNGAGKTTTMSIITGLLSPTYGTVYVNGNDLFKDIDNFRQDLGLCPQHNLLFSYLTTLDHLIFFGMLKGLSLQSAKSKGLQLLKLLNILHKKADLVSNLSGGMKRKVSLAIALAGNPKILILDEPTSGMDPESRREMWDLLISFRGV-RTILITTHFMEEADVLGDRIAIMDHGQV 671
>gi|47565522|ref|ZP_00236563.1| daunorubicin resistance ATP-binding protein [Bacillus cereus G9241] >gi|166983726|ref|ZP_02255113.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus AH187] >gi|168160060|ref|ZP_02595293.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus H3081.97] >gi|47557512|gb|EAL15839.1| daunorubicin resistance ATP-binding protein [Bacillus cereus G9241] (312 aa)
Score = 284, Expect = 1.6e-23, Identities = 76/274 (27%), Positives = 150/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D +   P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L +++   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKQKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIVQHFINHDIEIR 288
>gi|196181221|gb|EDX76210.1| ABC transporter, ATP-binding protein [Microcoleus chthonoplastes PCC 7420] (328 aa)
Score = 284, Expect = 1.6e-23, Identities = 64/205 (31%), Positives = 118/205 (57%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L KQ+   +H  +++++ +V  GE +  +G NGAGKTT I+ +  +     G IYI+G     D  N + + ++GY+P++      ++ +DYL Y ++L +++          +L+  ++   R       S G K+++ LA+ + + P +L++DEP + LDP AR+ F +I+  LQ+   +I ISSH+LS+L     +V I++ G +V
  S:    24 LTKQF--DRHIAVNDIDLQVAAGEVYGLIGPNGAGKTTLIRMLAAAEEPTTGEIYINGDRLLRDQSNPKLKQRIGYLPDDFPVYEDLTVWDYLDYFSRLYRLREPRRTRRLREVLELVQLTSKRKSLIATLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFREIIKTLQEAGMTILISSHVLSDLAELCTSVGIMELGYLV 230
>gi|168134637|ref|ZP_02577866.1| Export ABC transporter ATP-binding protein [Bacillus cereus B4264] (312 aa)
Score = 284, Expect = 1.6e-23, Identities = 77/274 (28%), Positives = 150/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D +   P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKQKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKSIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHCINHDIEIR 288
>gi|167767825|ref|ZP_02439878.1| hypothetical protein CLOSS21_02360 [Clostridium sp. SS2/1] >gi|167710564|gb|EDS21143.1| hypothetical protein CLOSS21_02360 [Clostridium sp. SS2/1] (340 aa)
Score = 284, Expect = 1.6e-23, Identities = 68/211 (32%), Positives = 124/211 (58%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L+EV +L K+Y    H  +D+L+F +  G  + F+G NGAGK+TT+  + G      G + I+G  I  +  +++  +GY+PE       ++  +YLY+ A+L KI   +       +++  ++ D++++   N S G +++  LA A+ + PDI+I+DEPT  LDPK  I+  +++  L K H ++ +SSHIL+E+    + + I+  GK++
  S:    20 LIEVKHLTKKY--GTHLAVDDLSFTIEKGRIYGFLGPNGAGKSTTMNIMTGYIGASSGEVIINGHNILEEPEKAKKCIGYLPEIPPLYLDMTVSEYLYFAAELKKIPKADRNAQVIKVMELIKLVDMKDRLIKNLSKGYRQRTGLAAAILDFPDIIILDEPTVGLDPKQIIEIRELIRTLAKDH-TVILSSHILAEVQEICDDILIISKGKLI 229
>gi|195579054|ref|XP_002079377.1| GD23921 [Drosophila simulans] >gi|194191386|gb|EDX04962.1| GD23921 [Drosophila simulans] (1603 aa)
Score = 284, Expect = 1.6e-23, Identities = 75/231 (32%), Positives = 134/231 (58%)
  Q:    59 VVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEMCYRIKL-VEDF 289
           +  L K++   K  T+  DNLN  +   E    +G NGAGKTT +  I+G      G I +     +++ S R  +G+ P+++ F S ++   +L + A+L   +  +A+ +A+  LKK  + D RN+   N S G K+++ L  A++ N  I+I+DEP++ LD  +R + +DIL  L+K  K+I +++H + E ++  + + IL NGK+  + +    K ++G + YR+KL + DF
  S:   470 ITELCKKFQTSKRDTLISDNLNMTINNKEITVLLGHNGAGKTTMMNMIMGLVPKDSGKIIVC--SERDVASYRHLIGFCPQHSVFMSYMTCHQHLEFFAQLRGARRSDARDWADEKLKKLGLGDKRNEFGRNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDINSRRELWDILLNLRK-EKAILVTTHYMEEAEVLGDTICILANGKLQSIGSPLELKRKSG-IGYRLKLEINDF 702
Score = 220, Expect = 4.6e-16, Identities = 63/210 (30%), Positives = 108/210 (51%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSK-----EAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           PL+ V NLRK+Y  K    +D ++F    GE    +G NGAGKT+T + I  +     GSI I G  I    L+ R   GY P+       +++   L+Y A L  + +        K   +  L+K  +   +     ++S G K+K+L A A+   P ++++DEPT  +DP +R   +  + + Q   +++ ++SH + E +   N + I+ +GK
  S:  1261 PLI-VHNLRKRYGDKV--AVDGVSFAAAQGECFGLLGVNGAGKTSTFQMIAANLPLDGGSIRIKGAEIREHELKYREYFGYCPQYDALNKFMTAEQCLHYMALLRGLSNSTEGPASCKENVKYWLEKMHLTKYQKVQVRHYSGGTKRKLLAAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRLAIMAHGK 1474
>gi|194466671|ref|ZP_03072658.1| ABC transporter related [Lactobacillus reuteri 100-23] >gi|194453707|gb|EDX42604.1| ABC transporter related [Lactobacillus reuteri 100-23] (245 aa)
Score = 284, Expect = 1.7e-23, Identities = 63/194 (32%), Positives = 106/194 (54%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + +++F V PGE    +G NGAGK+TT+  +IG  R F GSI I+G  I     E + ++ Y+PE       ++  +++  T    ++   EA   A  +LK FR+ +  +  P NFS G K+K+++  A      +LI+DEP   LDP A  D  D++ + +K   ++ +S+H+L     Y +   +L +GK+
  S:    16 PVLKDVSFDVQPGELVGLIGLNGAGKSTTLNHVIGLLRPFSGSIKINGLTIQANPEEYKKEIAYVPETPILYDELTLREHIDLTIMAYELDHDEAWQRATKLLKLFRLDNKLDWFPANFSKGMKQKVMICCAFMTKAKLLIIDEPFYGLDPLAVHDLLDLIEQKKKEGVAVLMSTHVLDTAQRYCDRFVLLADGKV 211
>gi|118477265|ref|YP_894416.1| multidrug ABC transporter, ATP-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|118416490|gb|ABK84909.1| multidrug ABC transporter, ATP-binding protein [Bacillus thuringiensis str. Al Hakam] (313 aa)
Score = 284, Expect = 1.7e-23, Identities = 77/274 (28%), Positives = 149/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     5 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGVVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKHKSFPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHFINHDIEIR 289
>gi|168178608|ref|ZP_02613272.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum NCTC 2916] >gi|182670930|gb|EDT82904.1| bacitracin ABC transporter, ATP-binding protein BcrA [Clostridium botulinum NCTC 2916] (307 aa)
Score = 284, Expect = 1.7e-23, Identities = 76/212 (35%), Positives = 123/212 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           K LL   NL K+Y  KK   ++NLN  VY G+ + F+G NGAGK+TTIKSI+G  +   G + I+  D +    +   K+G + E   F   +S +  L   A L  +  K      + +L+  R+ D  +++ + +S G K+++ +A+A  NNP+I+I+DEPT  LDP+   D  +++ +L +K H +  ISSHILSE+    N + I++ G +
  S:     4 KCLLSTHNLTKEYKNKK--AVNNLNITVYEGDVYGFLGPNGAGKSTTIKSIMGLIKPTSGKVIINRYDVEKDSEKAIEKIGTMVEAPSFYGGLSGYKNLILMANLYGVPKKRV----DEVLEMVRLTDSAHKNVSKYSLGMKQRLGIARAFLNNPNIVILDEPTNGLDPQGIKDIRELIQDLSKKYHVTFLISSHILSEIQAVCNRIGIIEKGSL 212
>gi|86157064|ref|YP_463849.1| ABC transporter, ATPase subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773575|gb|ABC80412.1| ABC transporter, ATPase subunit [Anaeromyxobacter dehalogenans 2CP-C] (318 aa)
Score = 284, Expect = 1.7e-23, Identities = 58/198 (29%), Positives = 113/198 (57%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
            +K   +D L+ +V PGE   FVG NGAGKTTTIK ++G      G  +I      +  ++ ++GY+PE+  +   ++  + L + A+L+++         + +L+   +    ++    +S G ++++ +AQAL  +P ++++DEP + LDP  R D  D++ EL++  K++F S+HIL +++   + V ++  GK+
  S:    18 ARKVTAVDALDLEVAPGEIFGFVGPNGAGKTTTIKMLMGLIYPSSGRAFIFDDPIPSRRAKARIGYLPEHPAYYEFLTGREALRFFARLSEVPGAARDRRCDELLELVGLTAAADRQIRKYSKGMQQRLGIAQALVGDPALVVLDEPMSGLDPVGRKDVRDLILELKRRGKTVFFSTHILPDVESLCDRVGVILRGKL 215
>gi|52143626|ref|YP_083202.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus E33L] >gi|196045139|ref|ZP_03112372.1| ABC transporter, ATP-binding protein [Bacillus cereus 03BB108] >gi|51977095|gb|AAU18645.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus E33L] >gi|196024141|gb|EDX62815.1| ABC transporter, ATP-binding protein [Bacillus cereus 03BB108] (312 aa)
Score = 284, Expect = 1.7e-23, Identities = 77/274 (28%), Positives = 149/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGVVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKHKSFPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHFINHDIEIR 288
>gi|168159786|ref|ZP_02595019.1| ABC transporter, ATP-binding protein [Bacillus cereus H3081.97] (241 aa)
Score = 284, Expect = 1.8e-23, Identities = 65/212 (30%), Positives = 120/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E++N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PD+ I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     1 MIEIMNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKKTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDVWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKLCDRVAIINKGNLQF 213
>gi|168179350|ref|ZP_02614014.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] >gi|182669639|gb|EDT81615.1| ABC transporter, ATP-binding protein [Clostridium botulinum NCTC 2916] (285 aa)
Score = 284, Expect = 1.8e-23, Identities = 89/247 (36%), Positives = 142/247 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES--RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSN 302
           +LEV NL+K+Y   K  +++N++F++  G    F+G NGAGK+TTIK I+   +   G I I G+DN   E   + K+G++ +  +F      +D++        I     +   E+  K  R ++L   +   N S G K K  LA ALS+N +++IMDEPTA LDP  R +  DIL +L Q  +KS+F S+HI ++L+  ++ +T ++ GK+V++Q  NK+E  E    +K   DF  ++  KY V  N
  S:     4 ILEVKNLKKEY---KDFSVENISFQLDRGYIMGFIGPNGAGKSTTIKLIMNLIKKDAGDIKIFGMDNVRYEKEVKEKVGFVYDENYF------YDHVNIETMKKIIAPFYKEWSDETFSKYLRTFNLDPKKKIKNLSKGMKMKFSLALALSHNAELIIMDEPTAGLDPVFRREILDILYDLIQDENKSVFFSTHITTDLEKIADYITFINKGKLVFSQ--NKDEIMEKYNLVKGGLDFLNEETKKYFVGIN 243
>gi|30261841|ref|NP_844218.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] >gi|47527082|ref|YP_018431.1| ABC transporter ATP-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184675|ref|YP_027927.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Sterne] >gi|65319118|ref|ZP_00392077.1| COG1131: ABC-type multidrug transport system, ATPase component [Bacillus anthracis str. A2012] >gi|165869491|ref|ZP_02214150.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0488] >gi|167633333|ref|ZP_02391658.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0442] >gi|167638829|ref|ZP_02397104.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0193] >gi|170686091|ref|ZP_02877313.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0465] >gi|170707254|ref|ZP_02897709.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0389] >gi|177650616|ref|ZP_02933583.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0174] >gi|190566287|ref|ZP_03019205.1| ABC transporter, ATP-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|30256069|gb|AAP25704.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] >gi|47502230|gb|AAT30906.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178602|gb|AAT53978.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Sterne] >gi|164714931|gb|EDR20449.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0488] >gi|167513293|gb|EDR88664.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0193] >gi|167531371|gb|EDR94049.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0442] >gi|170127753|gb|EDS96625.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0389] >gi|170669788|gb|EDT20529.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0465] >gi|172083760|gb|EDT68820.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0174] >gi|190562422|gb|EDV16389.1| ABC transporter, ATP-binding protein [Bacillus anthracis Tsiankovskii-I] (312 aa)
Score = 284, Expect = 1.9e-23, Identities = 77/274 (28%), Positives = 149/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D +   P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L + I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGVVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKQKSFPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKFIQHFINHDIEIR 288
>gi|126311366|ref|XP_001381788.1| PREDICTED: similar to ABCA4 [Monodelphis domestica] (2305 aa)
Score = 283, Expect = 1.9e-23, Identities = 73/256 (28%), Positives = 135/256 (52%)
  Q:    10 NNFISSLKSKQLEKKE--KEYQMEMNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           N   S+ + + LEK E   E     + + E  + F    Q  +    P + V NL K +  +  P +D+LN   Y  +  AF+G NGAGKTTT+  + G      G++ I G D   +++S R  +G  P++      ++  +++   A+L     KEA+L  E++L+   +   RN+   N S G ++K+ +A A   +  ++++DEPT+ +DP +R   +D+L + +   ++I +S+H + E DL  + + I+  G++
  S:   883 NEACSTKEERALEKTEPLTEEMQNPDYSGEIQDTFFEKEQPGL---VPGVCVQNLVKVFNYQSRPAVDHLNITFYENQITAFLGHNGAGKTTTMSILTGLLPATSGTVLIGGKDIETSMDSIRQNLGMCPQHNILFHHLTVAEHILLYAQLKGKSRKEAQLEMETMLEDTGLHHKRNEEVQNLSGGMQRKLSVAIAFVGDAKVIVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISRGRL 1138
Score = 235, Expect = 7.3e-18, Identities = 57/208 (27%), Positives = 103/208 (49%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           +L +  L K Y G   P +D L   V PGE    +G NGAGKTTT K + G      G   ++G  I  +  E    MGY P+       ++  ++LY  A+L  + +++ K  A   ++   +    +     +S G K+K+  A AL   P ++++DEPT  +DP++R   ++ +  + +  +++ ++SH + E +     + I+  G
  S:  1936 ILRLHELTKIYSGTTSPAVDRLCIGVRPGECFGLLGVNGAGKTTTFKMLTGDISVTSGDAIVAGNSILTQISEVHQHMGYCPQFDAIDDLLTGREHLYLYARLRGVPTEDIKRVANWCIQSLGLSVYADHLVGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQSRRLLWNAIVGIIRDGRAVVLTSHSMEECEALCTRLAIMVRG 2145
>gi|126656451|ref|ZP_01727712.1| ABC transporter-like protein [Cyanothece sp. CCY0110] >gi|126622137|gb|EAZ92844.1| ABC transporter-like protein [Cyanothece sp. CCY0110] (331 aa)
Score = 283, Expect = 1.9e-23, Identities = 68/213 (31%), Positives = 122/213 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y       I++++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D   +++E R  +GY+PE       ++   +L + A++  + S +        +++ ++ D R       S G K+++ +AQA+ ++P ++I+DEPT  LDPK  I+  +++  L   H +I +S+HIL E+ +  + VTI++ GK+V T
  S:     1 MIEVEHLSKIY--GSTAAIEDVDFSVEKGEILGFLGPNGAGKTTTMRILSGYIPATTGTAKIAGYDVHEQSIEVRRNIGYLPETPPLYPDMTVEGFLKFVARIKGVASSDRNSRVNWSIERCQLEDKRKVLIRKLSKGYKQRVGIAQAIVHDPPVIILDEPTVGLDPKQIIEVRNLIKSLAGEH-TILLSTHILPEVSMTCDRVTIINGGKVVAT 212
>gi|118478630|ref|YP_895781.1| ABC transporter, ATP-binding protein [Bacillus thuringiensis str. Al Hakam] >gi|118417855|gb|ABK86274.1| ABC transporter, ATP-binding protein [Bacillus thuringiensis str. Al Hakam] (244 aa)
Score = 283, Expect = 1.9e-23, Identities = 65/212 (30%), Positives = 119/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E+ N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PD+ I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     4 MIEITNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKRTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDVWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKLCDRVAIINKGNLQF 216
>gi|168714222|ref|ZP_02746499.1| ABC transporter, ATP-binding protein [Clostridium difficile QCD-63q42] (290 aa)
Score = 283, Expect = 1.9e-23, Identities = 68/211 (32%), Positives = 125/211 (59%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL-ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + V NL K++ GKK   +DN+N ++  G F   +G NGAGKTT ++ +       +GSI++ G+  +N  E R  +GY+P++      ++ +  + Y A L+ I  ++ +     +L K  + + +N    + S G  +++ +AQ+L +NP +LI+DEPTA LDP+ RI F ++L E+    + + +S+HI+ +++     V IL++GK++Y
  S:     5 IAVSNLSKRF-GKKQ-ALDNINLEIDSGMF-GLLGRNGAGKTTFMRILATLLSKTEGSIHMCGVPIENTKEIRNMVGYLPQDFSMYPNMTVYKAMDYLAVLSDIPLRKRRKIIAKLLSKVNLTNYQNVKVKSLSGGMNRRLGIAQSLIHNPRVLIVDEPTAGLDPEERIRFRNLLCEIAN-DRIVILSTHIVGDIEATCENVAILNSGKVIY 212
>gi|153807978|ref|ZP_01960646.1| hypothetical protein BACCAC_02264 [Bacteroides caccae ATCC 43185] >gi|149129587|gb|EDM20801.1| hypothetical protein BACCAC_02264 [Bacteroides caccae ATCC 43185] (297 aa)
Score = 283, Expect = 1.9e-23, Identities = 61/211 (28%), Positives = 127/211 (60%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI-KSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           + + NL K Y    H  + ++N ++  G F   +G NGAGK+T ++ ++       G + I G D   +  E R  +GY+P++  F ++  ++++L Y A+L+ + ++++ K   + +L+   ++D+R +  N  S G K+++ +AQAL ++P ++I+DEPT  LDP+ RI F ++L E+ +   +I +S+HI+ ++    N + +++ G++ +
  S:     3 ITIKNLNKIYPNGNH-ALKDVNLEIPTGMF-GLLGPNGAGKSTLMRILVALMEPTSGQVEICGYDLMKQRKEIRGILGYLPQDFRFFAKYKTYEFLDYAARLSGMTQNRQRKQAVDEMLENVGLFDVRERYANKLSGGMKRRLGIAQALIHHPKVIIVDEPTTGLDPEERIRFRNLLSEVSENDVTIILSTHIVGDISSTCNNMALMNRGEVSF 214
>gi|166983323|ref|ZP_02254736.1| ABC transporter, ATP-binding protein [Bacillus cereus AH187] >gi|167632504|ref|ZP_02390831.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0442] >gi|170684803|ref|ZP_02876028.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0465] >gi|167532802|gb|EDR95438.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0442] >gi|170671063|gb|EDT21801.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0465] (241 aa)
Score = 283, Expect = 2.0e-23, Identities = 65/212 (30%), Positives = 120/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E++N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PD+ I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     1 MIEIMNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKRTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDVWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKLCDRVAIINKGNLQF 213
>gi|47564472|ref|ZP_00235517.1| ABC transporter, ATP-binding protein [Bacillus cereus G9241] >gi|47558624|gb|EAL16947.1| ABC transporter, ATP-binding protein [Bacillus cereus G9241] (241 aa)
Score = 283, Expect = 2.0e-23, Identities = 66/212 (31%), Positives = 119/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E+ N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PDI I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     1 MIEITNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKKTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDIWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKICDRVAIINKGNLQF 213
>gi|73670322|ref|YP_306337.1| ABC transporter, ATP-binding protein [Methanosarcina barkeri str. Fusaro] >gi|72397484|gb|AAZ71757.1| ABC transporter, ATP-binding protein [Methanosarcina barkeri str. Fusaro] (247 aa)
Score = 283, Expect = 2.0e-23, Identities = 69/215 (32%), Positives = 116/215 (53%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
           ++EV NL K Y  +K   +++++F +   E    +G NG+GKTT IK + G  +   GS+ + G+D     + +R   G +PE    PS +++ +YLY+ AK+ K+++ E     E   +     D  N    + S G ++K++ AQA  + P++ I+DEP  NLDP  +    D L    K   ++FIS+HIL        ++ I+  GK+VYT +
  S:     1 MIEVRNLSKSYGSRK--AVNDISFSIGKSELFGLLGPNGSGKTTMIKMLTGQIKPTFGSVRVLGVDVLEDPIRARELAGIVPEQETPPSFLTAEEYLYFVAKIRKMENYEKA--CEKWFEFLDFGDQNNSLCKDLSRGTRQKLMFAQAFLHEPELAIIDEPLINLDPVMQKKVKDFLTICVKNGGTVFISTHILEIAKQICTSIGIIYKGKMVYTGR 213
>gi|29375285|ref|NP_814438.1| ABC transporter, ATP-binding protein [Enterococcus faecalis V583] >gi|29342745|gb|AAO80509.1| ABC transporter, ATP-binding protein [Enterococcus faecalis V583] (245 aa)
Score = 283, Expect = 2.0e-23, Identities = 69/194 (35%), Positives = 105/194 (54%)
  Q:    72 PTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           P + ++NF V  GE    +G NGAGK+TTIK+IIG      G I I G  +     E R K+GYIPE       ++  +++  TA    I  +EA   AE +LK FR+ +     P NFS G K+K+++  A    P + I+DEP   LDP A     +++  ++K   +I +S+HIL+  + Y +   +L  GK+
  S:    16 PVLKDINFDVKSGEMVGLIGLNGAGKSTTIKNIIGLLTPQKGKIMIDGETLQQAPEEYRKKIGYIPETPSLYEELTLKEHIEVTALAYDIPLEEAFKRAEPLLKTFRLDNKLEWFPANFSKGMKQKVMVLCAFLIEPSLYIIDEPFLGLDPLAIHALLELMDTMRKQGAAILMSTHILATAEKYCDRFVVLHEGKL 211
>gi|28493144|ref|NP_787305.1| ABC transporter ATP-binding protein [Tropheryma whipplei str. Twist] >gi|28476184|gb|AAO44274.1| ABC transporter ATP-binding protein [Tropheryma whipplei str. Twist] (346 aa)
Score = 283, Expect = 2.1e-23, Identities = 66/217 (30%), Positives = 120/217 (55%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFD-ILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN 272
            +EV+N+  +Y G      +N++  V  G+    +G NGAGKTT ++ + G      GSI I+G    +L ++   G  P+ + FPS +   +++ Y +KL     +   L A  +L KF + DL+N+  ++ S GQK+++ +A A    P ++++DEPTA LD  +R D  + +  E+ K   +  ++SH L +++  ++ V +L NG+I + +  N
  S:    55 FVEVMNVAYRYRGGM-CAFENVSLSVKKGQVLGLLGVNGAGKTTFVRLLQGILSPISGSISINGYPPTSLRAKVICGNAPQTSVFPSALRVSEFISYVSKL---YPRSESLSA--VLDKFHLKDLKNRKGSHMSGGQKRQVAVALAFVGFPSLVLLDEPTAGLDISSRRDVINTVKSEISKRGITAIVTSHYLDDIESLADTVVVLQNGRITHNEPIN 266
>gi|114706409|ref|ZP_01439311.1| ABC transporter ATP-binding protein [Fulvimarina pelagi HTCC2506] >gi|114538270|gb|EAU41392.1| ABC transporter ATP-binding protein [Fulvimarina pelagi HTCC2506] (313 aa)
Score = 283, Expect = 2.1e-23, Identities = 61/220 (27%), Positives = 129/220 (58%)
  Q:    54 KPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI---KSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK 273
           KP+L + N+ K Y G  +  + N++  +  GE  A +G NGAGKTT I  I G  R  +G I + G D K+   ++R K+G +P+         +F+ ++ T   ++    K K+  +  E +LK   +++ R+      S G K+++L+A+AL++ P++L +DEPTA +D   R + ++++ +L++   ++ +++H + E ++ ++ + ++  G+++  + +N+
  S:     7 KPILSIENVSKTYEGG-YKALKNVDLTIQKGEIFALLGPNGAGKTTLISLICGLARLNEGRITVDGHDVKSEFYKARGKIGLVPQEL----TTDAFESVWNTVSFSRGLFGKPKDPTVI-ERVLKSLALYEKRDNKLRTLSGGMKRRVLIAKALAHEPEVLFLDEPTAGVDVALRREMWNVVADLRQTGVTVILTTHYIEEAEMMADRIGVISKGELILVEDKNE 225
>gi|126657402|ref|ZP_01728561.1| ABC transporter ATP-binding protein [Cyanothece sp. CCY0110] >gi|126621389|gb|EAZ92101.1| ABC transporter ATP-binding protein [Cyanothece sp. CCY0110] (317 aa)
Score = 283, Expect = 2.2e-23, Identities = 65/206 (31%), Positives = 121/206 (58%)
  Q:    61 NLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG----IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           NL KQ+  ++H  ++ L  +V PGE +  +G NGAGKTT ++ +        G I+I G     DN +   + K+GY+P++      ++ +DYL Y A+L  ++    +   + +L+  ++   +N +    S G K+++ LA+ + ++P +L++DEP + LDP AR+ F +++  LQ +  ++ ISSH+LS+L     +V I++ G +V
  S:    12 NLTKQF--ERHIAVNKLELEVQPGEVYGLIGPNGAGKTTLMRMLAAVEEPTTGEIHIYGDRLLTDNSHPRLKQKLGYLPDDFPLYEDLNVWDYLDYFARLYHLRLPHRRRRIQEVLELVQLTSKKNSNIKTLSRGMKQRLSLARTILHDPLLLLLDEPVSGLDPIARMQFREVIRILQSVGMTVLISSHVLSDLAELCTSVGIMELGSLV 219
>gi|196476975|gb|ACG76503.1| ABC-type multidrug transport system, ATPase component [Phenylobacterium zucineum HLK1] (308 aa)
Score = 283, Expect = 2.2e-23, Identities = 75/273 (27%), Positives = 143/273 (52%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRN--KNENGEMCYRIKLVEDFEGDKVG--KYEVN---SNNEIIYEFKDKNE---LAELIDKLISKEI 327
           P++ V  L K Y    H  + ++N  +  GE  A +G NGAGKTT I  I G  R   G +   G  I      +RTK+G +P+     +    +D + ++  L      +A L  E +LK   +WD ++      S G K+++++A+ALS+ P IL +DEPTA +D + R D ++++  L++   ++ +++H + E +  ++ + ++  G+++  + ++    + G+    + L E       G   Y++       E++Y F  + E   +AELI +L  + +
  S:     3 PIISVRGLSKTY-ASGHQALKDVNLDIRRGEIFALLGPNGAGKTTLIGIICGLVRASSGQVVADGHDIQRDYRAARTKIGLVPQELSTDAFEKVWDTVKFSRGLFGKAPDDAHL--EKVLKDLSLWDKKDAKIMALSGGMKRRVMIAKALSHEPTILFLDEPTAGVDVELRRDMWEMVRRLREAGVTVILTTHYIEEAEEMADRIGVISRGELIVVEDKDVLMRKLGKKQLTLHLQEPLAAVPPGLADYQLELAAEGTELVYTFDAQAERTGIAELIKRLTEQGV 284
>gi|124524367|ref|ZP_01697909.1| ABC transporter related [Bacillus coagulans 36D1] >gi|124495080|gb|EAY42849.1| ABC transporter related [Bacillus coagulans 36D1] (248 aa)
Score = 283, Expect = 2.2e-23, Identities = 74/210 (35%), Positives = 108/210 (51%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-----RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           LLEV +L   Y   K P I +++F V  G+    +G NGAGK+TTI+ IIG      G I I+G   KNL +     R +  YIPE       ++  ++L   A    I  K        +LK+FR+       P NFS G K+K+++  A    P + I+DEP   LDP       D++G ++K    I +S+HIL+  + Y +   IL NG+I
  S:     3 LLEVASLTGGY--TKKPVIQDVSFTVEAGQLIGLIGLNGAGKSTTIRHIIGLMEPKKGRITING---KNLNADPDAYRKQFSYIPETPILYEELTLEEHLKLAAMAYGIDEKTYADRTVPLLKEFRLHKKLGWFPANFSKGMKQKVMIMCAFLVEPSLYIIDEPFLGLDPLGIQSLLDLMGTMKKKGAGILMSTHILATAERYCDGFIILHNGRI 212
>gi|91775035|ref|YP_544791.1| ABC transporter related [Methylobacillus flagellatus KT] >gi|91709022|gb|ABE48950.1| ABC transporter related [Methylobacillus flagellatus KT] (310 aa)
Score = 283, Expect = 2.2e-23, Identities = 66/223 (29%), Positives = 129/223 (57%)
  Q:    52 LTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT-------QKRNKN 274
           +T   +E   L +QY  +    +++++F +  GE   F+G NGAGK+TT+K + G+    +GS+ I GID   +  +++  +GY+PE       ++  ++L   A+L+++  +  K   +   ++  + ++  +   N S G ++++ +AQA+ +NP ++I+DEPT  LDP    D   ++ EL   H S+ +S+HIL E+++  + V I+  G +V+        Q+R+ N
  S:     1 MTTITVEASELTRQYGSRA--AVNDVSFTLSKGEVLGFLGPNGAGKSTTMKMLTGNLAPSNGSVKICGIDMMERPKDAKALIGYLPEQPPLYRELTVDEFLTIAARLHRVSPQHIKKAVDVAKQRCGLTEMGKRLIENLSKGYQQRVGIAQAIIHNPMVVILDEPTVGLDPIQIRDIRALIKELGGEH-SVILSTHILPEVEMVCDRVQIIHKGSLVFNGGIDVLKQQRHGN 229
>gi|167766012|ref|ZP_02438065.1| hypothetical protein CLOSS21_00503 [Clostridium sp. SS2/1] >gi|167712092|gb|EDS22671.1| hypothetical protein CLOSS21_00503 [Clostridium sp. SS2/1] (293 aa)
Score = 283, Expect = 2.4e-23, Identities = 65/211 (30%), Positives = 121/211 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           L + N+ KQ+  KK   +++++F +  G  +  +G NGAGKTT ++ +        G+I   G D        R  +GY+P++  +   ++ +DY+ Y A +  I+   AK   + +LK+  + D + Q   N S G  +++ +AQA+ N+P ILI+DEPTA LDP  RI F +++ EL +  + + +S+HI+S+++  +N + ++  G+  +
  S:     3 LSINNVTKQFKDKK--AVNDISFSMGNG-VYGLLGVNGAGKTTLMRMLCTLTTPDCGTITWDGKDIFKMGASYRQILGYLPQDFGYYPYLTIYDYVMYIASIKGIRPAVAKKRTKELLKQVGLSDQKKQKMRNLSGGMVRRVGIAQAMLNDPKILILDEPTAGLDPNERIRFRNLISELAE-ERLVLLSTHIVSDVEFIANKIVLMKEGQCCF 211
>gi|167463195|ref|ZP_02328284.1| putative multidrug ABC transporter, ATPase component [Paenibacillus larvae subsp. larvae BRL-230010] (307 aa)
Score = 283, Expect = 2.4e-23, Identities = 58/207 (28%), Positives = 119/207 (57%)
  Q:    60 VNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           VN  K+ YG+ H  +  ++F+V  G  +  +G NGAGK+TT+K +    +   G++ + G D   +  E R  +GY+P+N     ++S++D L +  ++  +K    K   + +L++  + D    + + FS G  ++I +A +L + P +LI+DEPT  +DP++R   F+++ +L +   ++  S+H + E++   + + I+D+G ++
  S:     7 VNQLKKTYGQ-HQAVKQISFEVQAGGCYGLLGPNGAGKSTTMKIVSCILKPDRGTVEVFGRDAVKQTSEVRKMIGYVPQNITLYDKLSAYDNLLFFGEMFGLKGLSLKKRIQDVLEQVGLSDRAKDAVHTFSGGMARRINIAASLLHQPKLLILDEPTVGIDPQSRNHIFEMIRQLNRDGVTVIYSTHYMEEVETLCDQLAIIDHGNVI 214
>gi|148244997|ref|YP_001219691.1| ABC transporter ATP-binding protein [Candidatus Vesicomyosocius okutanii HA] >gi|146326824|dbj|BAF61967.1| ABC transporter ATP-binding protein [Candidatus Vesicomyosocius okutanii HA] (305 aa)
Score = 283, Expect = 2.4e-23, Identities = 68/203 (33%), Positives = 112/203 (55%)
  Q:    64 KQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           K+ Y  +   +  ++  V  G+F+A +G+NGAGKTT I  I G      GSI + G +  N  ++ K  +G +P+   F       + L   A    I   +AK+ AE +LK+  +W+ R+    + S G K++++LA+AL + P ILI+DEPTA +D K R   +  L +L +   +I +++H L E +L    V IL+ GK++
  S:    11 KKTYSNQLEALKGIDLCVDHGDFYALLGSNGAGKTTVIGIICGLLNKTSGSIKVLGFNQSNHVNQVKKLIGLMPQEFNFNPFEPIEEILINQAGYYGIAKSKAKIQAEFLLKEVDLWEKRSDMAKSLSGGMKRRLMLARALIHQPKILILDEPTAGVDVKIRHSIWRFLSKLNRQGMTIILTTHYLGEAELLCRNVAILNEGKVI 215
>gi|20808275|ref|NP_623446.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] >gi|20516875|gb|AAM25050.1| ABC-type multidrug transport system, ATPase component [Thermoanaerobacter tengcongensis MB4] (312 aa)
Score = 283, Expect = 2.4e-23, Identities = 68/211 (32%), Positives = 121/211 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKL-HKSIFISSHILSELDLYSNAVTILDNGKIV 266
           ++E+  L K Y     P +D+L+ ++  GE    +G NGAGKTTTI  I+G     +G + + GI++    L+ +  +GY+PE+  F   ++  + L  TA LN ++ KEA   AE +L+K  + + +++    +S G ++++ LA AL   P I+I+DEPT  LDP+   +F +++  L +    ++ +SSH L ++    + V I   GK++
  S:     5 VIELKGLTKIY--GTQPAVDHLDLEIKRGEVFGLLGPNGAGKTTTILMILGLVEPTEGEVKVLGINSTREPLKVKKWVGYLPEDVGFYEDMTGLENLKLTAALNGMEEKEAVKAAEELLEKVGLGEAKDKKVGAYSRGMRQRLGLADALIKKPQIVILDEPTLGLDPEGMKEFLELIKNLSREGGMTVLLSSHHLHQVQEICDRVGIFVKGKLI 216
>gi|167629728|ref|YP_001680227.1| bacitracin ABC transporter [Heliobacterium modesticaldum Ice1] >gi|167592468|gb|ABZ84216.1| bacitracin abc transporter [Heliobacterium modesticaldum Ice1] (308 aa)
Score = 283, Expect = 2.4e-23, Identities = 74/212 (34%), Positives = 122/212 (57%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHK-SIFISSHILSELDLYSNAVTILDNGKIV 266
           P+LEV NL K Y G     + +LN  V  GE + F+G NGAGKTTTI+ I+G  R   G I + G   ++   E   ++G + E   F + +++ + L Y A++  + + +A    + IL    +    ++  N FS G K+++ +A+AL + P++LI+DEPT  LDP    +   I+ +L K    +IF+SSHIL E++  ++ V I+  G++V
  S:     6 PILEVSNLGKVYNGTW--AVKSLNLSVRTGEIYGFLGRNGAGKTTTIRMIMGLIRPSQGQIRLFGRPKESFGQEMFRRIGSMIEYPGFYTHLTARENLLYNARMIGLPNLKA---VDEILSFMGLGQAADKQVNQFSLGMKQRLGIARALLHEPELLILDEPTNGLDPAGIREIRHIIRDLSKYRNITIFVSSHILPEIEQLADRVGIIHQGQLV 215
>gi|49479016|ref|YP_037450.1| ABC transporter, ATP-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52142208|ref|YP_084621.1| ABC transporter, ATP-binding protein [Bacillus cereus E33L] >gi|49330572|gb|AAT61218.1| ABC transporter, ATP-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975677|gb|AAU17227.1| ABC transporter, ATP-binding protein [Bacillus cereus E33L] (241 aa)
Score = 283, Expect = 2.4e-23, Identities = 65/212 (30%), Positives = 119/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E+ N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PD+ I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     1 MIEITNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKKTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDVWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKLCDRVAIINKGNLQF 213
>gi|73536592|ref|XP_847720.1| ABC transporter, putative [Leishmania major strain Friedlin] >gi|70799596|gb|AAZ09512.1| ABC transporter, putative [Leishmania major strain Friedlin] (1866 aa)
Score = 283, Expect = 2.4e-23, Identities = 68/257 (26%), Positives = 135/257 (52%)
  Q:     9 DNNFISSLKSKQLEKKEKEYQME-MNAAHEYFERFIRVNQEDIDLTKPLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           D+ F        +E +E+  ++E  + + +  E ++  ++   + T+  + V +L K+Y G +H  + +++F V  GE    +G NGAGKTT +  + G      G  +++    +++ SR  +GY P+     S +S+ ++L+  A+L  IK K  +     +LK+  ++  RNQ+  + S G K+++ LA AL      +++DEPT+ +D  AR    D++  L    KS+ +++H L E++  ++ V  +  G +
  S:  1492 DSAFTQCCTKLNIEDEEEHRRLEEADPSVKQEEDYVCADKTGPESTR--VAVQHLSKRYLGAEHAALQDISFGVKEGEVMGLLGLNGAGKTTAVSILAGEVVATGGEAFVNHYAVQSMASRPFVGYCPQYDALLSNLSAEEHLWLYARLRSIKEKHIRAEVHVLLKELGLYPFRNQAAASLSGGNKRRLSLAIALVGRTTSVLLDEPTSGMDAVARAQTCDVVRRLTA-QKSVVLTTHRLDEVEALADRVAFVVRGNL 1746
Score = 225, Expect = 1.0e-16, Identities = 50/196 (25%), Positives = 102/196 (52%)
  Q:    68 GKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNL--ESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNG 263
           G +   +D + F +  GE    +G NGAGK+T +    G     +G +Y+ G + +    E R  +GY P+     S ++  +++ + A++    +   +   + ++    + + R+   +  SSGQ++++ +A A+  +  +L +DEPTA +D K R   ++ L   +   +S+ IS+H+L E D  ++ V I++ G
  S:   681 GDRIVALDGVTFAMRTGEVSVLLGPNGAGKSTIMGVATGMVNPTNGDVYVRGYNARTHLDECRQNIGYCPQRDIVWSLLTVEEHITFYARMKGSHAVNVQEKVDYVVDLLDLHEKRHCKASELSSGQRRRLCVAIAMVGDSSVLFLDEPTAGMDIKGRKIVYEALNRTRN-QRSVLISTHLLDEADRIADRVLIVNKG 877
>gi|30263296|ref|NP_845673.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] >gi|47528670|ref|YP_020019.1| ABC transporter ATP-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186145|ref|YP_029397.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Sterne] >gi|165868616|ref|ZP_02213276.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0488] >gi|166993990|ref|ZP_02260450.1| ABC transporter, ATP-binding protein [Bacillus cereus AH820] >gi|167637518|ref|ZP_02395798.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0193] >gi|170705293|ref|ZP_02895758.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0389] >gi|177650068|ref|ZP_02933069.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0174] >gi|190564727|ref|ZP_03017648.1| ABC transporter, ATP-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|196032172|ref|ZP_03099586.1| ABC transporter, ATP-binding protein [Bacillus cereus W] >gi|196037999|ref|ZP_03105309.1| ABC transporter, ATP-binding protein [Bacillus cereus NVH0597-99] >gi|196042656|ref|ZP_03109895.1| ABC transporter, ATP-binding protein [Bacillus cereus 03BB108] >gi|30257930|gb|AAP27159.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Ames] >gi|47503818|gb|AAT32494.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180072|gb|AAT55448.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. Sterne] >gi|164715342|gb|EDR20859.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0488] >gi|167515025|gb|EDR90391.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0193] >gi|170130148|gb|EDS99010.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0389] >gi|172084020|gb|EDT69079.1| ABC transporter, ATP-binding protein [Bacillus anthracis str. A0174] >gi|190564044|gb|EDV18008.1| ABC transporter, ATP-binding protein [Bacillus anthracis Tsiankovskii-I] >gi|195994923|gb|EDX58877.1| ABC transporter, ATP-binding protein [Bacillus cereus W] >gi|196026140|gb|EDX64808.1| ABC transporter, ATP-binding protein [Bacillus cereus 03BB108] >gi|196031269|gb|EDX69866.1| ABC transporter, ATP-binding protein [Bacillus cereus NVH0597-99] (241 aa)
Score = 282, Expect = 2.5e-23, Identities = 65/212 (30%), Positives = 119/212 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           ++E+ N+ K Y G  +  + +L+  V  GE   F+G NGAGK+TTIK I G +    G+I I+GID     +E++   GY+P++     R+   +YL + A + ++  +  +   ES+ KKF +++  +    ++S G ++KI++   L + PD+ I+DEP   LDPK+     +++ E     K +F S+H+L   +   + V I++ G + +
  S:     1 MIEITNVSKSYNGSTY-AVKDLSLSVPSGEIFGFLGPNGAGKSTTIKMITGIHGVDKGTITINGIDIMKNPMEAKRTFGYVPDSPDMFLRLKGIEYLNFMADMYEVPKEVRQERIESLAKKFDLYNALSDQIQSYSHGMRQKIVIIGVLVHEPDVWILDEPLTGLDPKSAYILKEMMREHADKGKIVFFSTHVLEVAEKLCDRVAIINKGNLQF 213
>gi|83646126|ref|YP_434561.1| ABC-type multidrug transport system, ATPase component [Hahella chejuensis KCTC 2396] >gi|83634169|gb|ABC30136.1| ABC-type multidrug transport system, ATPase component [Hahella chejuensis KCTC 2396] (305 aa)
Score = 282, Expect = 2.5e-23, Identities = 67/201 (33%), Positives = 113/201 (56%)
  Q:    65 QYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           QYYG+ H  + +LN  +  GE     G NGAGKTTTIK I+G  R   G++   G     ++ R ++GY+PEN  F  ++S  + L Y A+L +    + K    S+L++  + +  NQ    +S G ++++ LAQAL   P +L++DEPT  LDP A  D ++++  L+     + + SH+L  ++ + +   IL +G++
  S:     9 QYYGR-HQVLHDLNLTLGEGEVLGLFGHNGAGKTTTIKLILGLLRPDRGNVLTLGRSPNQVDMRRQIGYLPENVMFYPQLSGLETLRYFARLKQAPLTQVK----SLLEQVGLSEAANQKVKTYSKGMRQRLGLAQALLGEPRLLLLDEPTVGLDPIATADLYELVDGLRCRGAGVILCSHVLPGVEPHIDRAAILAHGRL 204
>gi|90420486|ref|ZP_01228393.1| ATP-binding protein, ABC-type transporter [Aurantimonas sp. SI85-9A1] >gi|90335214|gb|EAS48967.1| ATP-binding protein, ABC-type transporter [Aurantimonas sp. SI85-9A1] (308 aa)
Score = 282, Expect = 2.5e-23, Identities = 61/217 (28%), Positives = 120/217 (55%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           P+L V N+ K Y G     + N++  +  GE  A +G NGAGKTT I  I G     +GSI + G  ID     +R+ +G +P+         +F+ ++ T   ++     K      E +L+   +WD R+      S G K+++L+A+ALS+ P++L +DEPTA +D   R + ++++ +L++   +I +++H + E ++ ++ + ++  G+++  + +
  S:     3 PILSVQNVSKTYAGG-FQALKNIDLSIDKGEIFALLGPNGAGKTTLISIICGIAGLTEGSISVGGHDIDRDFRAARSMIGLVPQEL----TTDAFESVWATVSFSRGLFGKKRNPAHIEKVLRDLSLWDKRDSKIMTLSGGMKRRVLIAKALSHEPEVLFLDEPTAGVDVGLRREMWEVVRKLRESGVTIILTTHYIEEAEMMADRIGVISRGELILVEDK 218
>gi|110833739|ref|YP_692598.1| ABC transporter ATP-binding component [Alcanivorax borkumensis SK2] >gi|110646850|emb|CAL16326.1| ABC transporter ATP-binding component [Alcanivorax borkumensis SK2] (314 aa)
Score = 282, Expect = 2.5e-23, Identities = 66/209 (31%), Positives = 113/209 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           L + NL K Y       +  ++ +V  G+F A +G NGAGK+TTI  I       DG + I G  +D +   ++ ++G +P+   F      FD +   A    I    A+  AE  L++  +WD R++     S G K+++++A+AL + P++LI+DEPTA +D + R   +D L +L +  K+I +++H L E +     + I+D+G I
  S:     8 LTIRNLTKTYANGVQ-ALKGIDLEVKKGDFFALLGPNGAGKSTTIGVISSLVNKSDGDVSIFGYSLDTQRSLAKKQIGVVPQEFNFNQFEKVFDIVVTQAGFYGIPGPLARERAEKYLRQLGLWDKRDKQSRTLSGGMKRRLMIARALVHEPELLILDEPTAGVDIELRRSMWDFLTKLNEQGKTIILTTHYLEEAESLCRHIAIIDHGVI 217
>gi|168141927|ref|ZP_02585156.1| multidrug ABC transporter, ATP-binding protein [Bacillus cereus G9842] (312 aa)
Score = 282, Expect = 2.6e-23, Identities = 77/274 (28%), Positives = 148/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ +  K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKHKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWVEVKSVENLDVKKLKEINGVKAVQIEENVIKVNSDAGVNNLNKIIQHFINHDIEIR 288
>gi|163749827|ref|ZP_02157072.1| ATP-binding transport protein NatA [Shewanella benthica KT99] >gi|161330341|gb|EDQ01320.1| ATP-binding transport protein NatA [Shewanella benthica KT99] (244 aa)
Score = 282, Expect = 2.6e-23, Identities = 65/211 (30%), Positives = 116/211 (54%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKN--LESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++V NL K+    +   +D+L+F+   G+    +G NGAGKTT +++I G  +   G   I GID     +E++ ++G  P+      R++  +Y+ Y A+LN +   EAK     +L +  M D+ ++    FS GQ+ K  LAQA+ + P  +I+DEPT  LD  +     D+L  L++    +  SSH++ E+    + V ++ +GK++
  S:     1 MIKVSNLSKRI--GEVQALDDLSFEAKDGQITGLLGPNGAGKTTCLRTIFGLLQPDKGIAEIDGIDVSKYPIEAKQQLGLFPDPFGLYERLTPREYVSYFAELNGLSRVEAKAATAKVLSQLHMDDIADRRCKGFSQGQRMKTALAQAIVHQPTNIILDEPTRGLDVMSTRVLRDLLRGLKENGHCVLFSSHVMQEVAALCDQVIVMADGKVI 211
>gi|196041222|ref|ZP_03108517.1| ABC transporter, ATP-binding protein [Bacillus cereus NVH0597-99] >gi|196027930|gb|EDX66542.1| ABC transporter, ATP-binding protein [Bacillus cereus NVH0597-99] (312 aa)
Score = 282, Expect = 2.7e-23, Identities = 77/274 (28%), Positives = 149/274 (54%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK-----NENGEMCYRIKLVEDFEGDKV----GKYEVNSNNEIIYEFKDK--NELAELIDKLISKEILVK 330
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++    + +      +  ++   +K VE+ + +K+    G   V     +I    D   N L ++I   I+ +I ++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGVVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKYKSFPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVIAEGTKEQLKAIITDTKDIWIEVKSVENLDVEKLKEINGVKAVQIEENVIKVNSDAGLNNLNKIIQHFINHDIEIR 288
>gi|146306252|ref|YP_001186717.1| ABC transporter related [Pseudomonas mendocina ymp] >gi|145574453|gb|ABP83985.1| ABC transporter related [Pseudomonas mendocina ymp] (309 aa)
Score = 282, Expect = 2.7e-23, Identities = 58/205 (28%), Positives = 111/205 (54%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKR 271
           Y   HP +  ++  +  GE  A +G NGAGKTT I  I G     +G + + G D       +R+++G +P+          F+ ++ T K ++     K    + E +LK   +WD RN      S G K+++++A+ALS+ P IL +DEPTA +D + R D ++++  L++   +I +++H + E +  ++ + ++  G+I+  + +
  S:    14 YASGHPALQGIDLDIRQGEIFALLGPNGAGKTTLISIICGIVNPGEGRVLVGGKDIVRDYRAARSQIGLVPQELV----SDVFETVWATVKFSRGLFGKKPDPAYLEQLLKDLSLWDKRNAKIMELSGGMKRRVMIAKALSHEPQILFLDEPTAGVDVELRRDMWNMVRRLRERGVTIILTTHYIEEAEEMADRIGVISKGRIILVEDK 218
>gi|116007328|ref|NP_001036360.1| CG31731 CG31731-PB, isoform B [Drosophila melanogaster] >gi|113194984|gb|ABI31314.1| CG31731-PB, isoform B [Drosophila melanogaster] (1597 aa)
Score = 282, Expect = 2.7e-23, Identities = 76/241 (31%), Positives = 137/241 (56%)
  Q:    59 VVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEMCYRIKL-VEDFEGDKVGKYEV 299
           +  L K++   K  T+  DNLN  +   E    +G NGAGKTT +  I+G      G I +     +++ S R  +G+ P+++ F S ++   +L + A+L      +A+ +A+  LKK  + D RN+   N S G K+++ L  A++ N  I+I+DEP++ LD  +R + +DIL  L+K  K++ +++H + E ++  + + IL NGK+  + +    K ++G + YR+KL + DF   +V   E+
  S:   463 ITELCKKFQTSKRDTLISDNLNMTINNKEITVLLGHNGAGKTTMMNMIMGLVPKDSGKIIVC--SERDVASYRHLIGFCPQHSVFMSYMTCHQHLEFFAQLRGACRSDARDWADEKLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDINSRRELWDILLNLRK-EKAVLVTTHYMEEAEVLGDTICILANGKLQSIGSPLELKRKSG-IGYRLKLEINDFTSREVEIMEI 705
Score = 227, Expect = 6.5e-17, Identities = 62/208 (29%), Positives = 106/208 (50%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEA------KLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           L V NLRK+Y  K    +D ++F    GE    +G NGAGKT+T + I  +     G+I I G D     L+ R   GY P+       +++   LYY A L  +  +        K   +  L+K  +   +     ++S G K+K+L A A+   P ++++DEPT  +DP +R   +  + + Q   +++ ++SH + E +   N + I+ +GK
  S:  1255 LIVHNLRKRYGDKL--AVDGVSFAAAQGECFGLLGVNGAGKTSTFQMIAANLPLDGGTIRIKGADIREHELKYREYFGYCPQYDALNKFMTAEQCLYYMALLRGLSRRRTDGPASCKEHVKYWLEKMHLTKYQKVQVRHYSGGTKRKLLAAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRLAIMAHGK 1468
>gi|28574150|ref|NP_723838.2| CG31731 CG31731-PA, isoform A [Drosophila melanogaster] >gi|28380352|gb|AAF53329.3| CG31731-PA, isoform A [Drosophila melanogaster] (1544 aa)
Score = 282, Expect = 2.7e-23, Identities = 76/241 (31%), Positives = 137/241 (56%)
  Q:    59 VVNLRKQYYGKKHPTI--DNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLES-RTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI--VYTQKRNKNENGEMCYRIKL-VEDFEGDKVGKYEV 299
           +  L K++   K  T+  DNLN  +   E    +G NGAGKTT +  I+G      G I +     +++ S R  +G+ P+++ F S ++   +L + A+L      +A+ +A+  LKK  + D RN+   N S G K+++ L  A++ N  I+I+DEP++ LD  +R + +DIL  L+K  K++ +++H + E ++  + + IL NGK+  + +    K ++G + YR+KL + DF   +V   E+
  S:   410 ITELCKKFQTSKRDTLISDNLNMTINNKEITVLLGHNGAGKTTMMNMIMGLVPKDSGKIIVC--SERDVASYRHLIGFCPQHSVFMSYMTCHQHLEFFAQLRGACRSDARDWADEKLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVILDEPSSGLDINSRRELWDILLNLRK-EKAVLVTTHYMEEAEVLGDTICILANGKLQSIGSPLELKRKSG-IGYRLKLEINDFTSREVEIMEI 652
Score = 227, Expect = 6.5e-17, Identities = 62/208 (29%), Positives = 106/208 (50%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEA------KLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGK 264
           L V NLRK+Y  K    +D ++F    GE    +G NGAGKT+T + I  +     G+I I G D     L+ R   GY P+       +++   LYY A L  +  +        K   +  L+K  +   +     ++S G K+K+L A A+   P ++++DEPT  +DP +R   +  + + Q   +++ ++SH + E +   N + I+ +GK
  S:  1202 LIVHNLRKRYGDKL--AVDGVSFAAAQGECFGLLGVNGAGKTSTFQMIAANLPLDGGTIRIKGADIREHELKYREYFGYCPQYDALNKFMTAEQCLYYMALLRGLSRRRTDGPASCKEHVKYWLEKMHLTKYQKVQVRHYSGGTKRKLLAAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRLAIMAHGK 1415
>gi|89092961|ref|ZP_01165912.1| probable ATP-binding component of ABC transporter [Oceanospirillum sp. MED92] >gi|89082611|gb|EAR61832.1| probable ATP-binding component of ABC transporter [Oceanospirillum sp. MED92] (306 aa)
Score = 282, Expect = 2.7e-23, Identities = 69/210 (32%), Positives = 117/210 (55%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDG---SIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           L V NLRK Y G     + +++F V  G+F A +G NGAGK+TT+  I+ S  N      S++   +D +  +++  +G +P+   F    +  D L   A    I    A   A+  LK+  +W+ RN +    S G K+++++A+AL ++P +LI+DEPTA +D + R   +D L E+ +   +I +++H L E +     + I+D+GKIV
  S:     5 LSVKNLRKTY-GNGFEALKDISFDVEEGDFFALLGPNGAGKSTTL-GIVSSLVNKSAGEVSVFNHDLDTEKTKAKMHLGVVPQEFNFNMFENVKDILVTQAGYYGISKGVANERADYYLKQLGLWEKRNGAARMLSGGMKRRLMIARALMHDPKLLILDEPTAGVDIELRRSMWDFLQEINRAGTTIILTTHYLEEAESLCRNIAIIDHGKIV 215
>gi|119475850|ref|ZP_01616202.1| probable ATP-binding component of ABC transporter [marine gamma proteobacterium HTCC2143] >gi|119450477|gb|EAW31711.1| probable ATP-binding component of ABC transporter [marine gamma proteobacterium HTCC2143] (306 aa)
Score = 282, Expect = 2.8e-23, Identities = 67/200 (33%), Positives = 111/200 (55%)
  Q:    67 YGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDG---SIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           YG     +  ++ +V  G+F A +G NGAGK+T+I  II S  N  G    I+   ID     ++ ++G +P+   FP+    FD L   A    +    A   AE+ L+K  +WD R ++  + S G K+++++A+AL + P +LI+DEPTA +D + R   +  L EL +   +I +++H L E +     + I+D+GKIV
  S:    14 YGNGFEALKGIDLEVEQGDFFALLGPNGAGKSTSI-GIISSLVNKTGGKVEIFGKSIDTDFSAAKKELGIVPQEFNFPNFEPVFDILVNQAGYYGLPRTVAIERAETYLRKLDLWDKRFEASRHLSGGMKRRLMIARALIHQPRLLILDEPTAGVDIEMRRSMWSFLRELNEQGTTIILTTHYLEEAESLCRNIAIIDHGKIV 215
>gi|172038554|ref|YP_001805055.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] >gi|171700008|gb|ACB52989.1| ATP-binding protein of ABC transporter [Cyanothece sp. ATCC 51142] (331 aa)
Score = 282, Expect = 3.0e-23, Identities = 68/213 (31%), Positives = 121/213 (56%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           ++EV +L K Y       I++++F V  GE   F+G NGAGKTTT++ + G      G+  I+G D    +L  R  +GY+PE       ++   +L + A++  + S +        +++ ++ D R       S G K+++ +AQA+ ++P ++I+DEPT  LDPK  I+  +++  L   H +I +S+HIL E+ +  + VTI+++GK+V T
  S:     1 MIEVEHLSKIY--GSTAAIEDVDFSVEKGEILGFLGPNGAGKTTTMRILSGYIPATTGTAKIAGYDVHENSLAVRRNIGYLPETPPLYPDMTVEGFLKFVARIKGVPSGDRHSRVNWSMERCQLEDKRKVLIRKLSKGYKQRVGIAQAIVHDPPVIILDEPTVGLDPKQIIEVRNLIKSLAGEH-TILLSTHILPEVSMTCDRVTIINSGKVVAT 212
>gi|196248387|ref|ZP_03147088.1| ABC transporter-related protein [Geobacillus sp. G11MC16] >gi|196212112|gb|EDY06870.1| ABC transporter-related protein [Geobacillus sp. G11MC16] (295 aa)
Score = 282, Expect = 3.0e-23, Identities = 62/193 (32%), Positives = 114/193 (59%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           I ++ F V  GE   F+G NGAGK+TTI+ ++G  +   G  +I G D   +++  +  +GY+P    FP  ++  + L   A + ++K+     + + ++++ ++ D R       S G K+K+ L  AL +NP+++I+DEPT+ LDP  +  F D+L E ++  K+IF+SSHI  E++   + V I+ +G+++
  S:    17 IFDVTFTVRQGEVFGFLGPNGAGKSTTIRHLLGFLKPTKGRAFIHGFDCWRESVRVKALVGYLPGEIAFPEGMTGMELLDLLAGMRRMKTTR---YRDELIERLQL-DTR-LPIRKMSKGTKQKVGLVAALMHNPEVIILDEPTSGLDPLMQQTFIDLLREEKQKGKTIFLSSHIFPEIERTCDRVAIMKDGRLM 206
>gi|168181601|ref|ZP_02616265.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] >gi|182675122|gb|EDT87083.1| ABC transporter, ATP-binding protein [Clostridium botulinum Bf] (285 aa)
Score = 282, Expect = 3.1e-23, Identities = 91/247 (36%), Positives = 143/247 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTK--MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKF-RMWDLR-NQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVNSN 302
           +LEV NL+K+Y   K   ++N+N K+  G    F+G NG+GK+TTIK I+   +  DG I I G+DN   E   K  +G++ +  +F   ++          + KI +   K + + I  K+ + +DL   +   N S G K K  LA ALS+N +++IMDEPTA LDP  R +  DIL +L Q  +KS+F S+HI ++L+  ++ +T ++ GK+V++Q  NK+E  E    +K   DF  ++  KY V  N
  S:     4 ILEVKNLKKEY---KDFFLENINLKLDRGYIMGFIGPNGSGKSTTIKLIMNLIKKDDGDIKIFGMDNIKHEKEVKERIGFVYDENYFYDHVN-------IETMKKIIAPFYKGWDDKIFYKYLKSFDLDPKKKIKNLSKGMKMKFSLALALSHNAELIIMDEPTAGLDPVFRREILDILYDLIQDENKSVFFSTHITTDLEKIADYITFINKGKLVFSQ--NKDEIMEKYTLVKGGLDFLNEETEKYFVGIN 243
>gi|146319509|ref|YP_001199221.1| ABC-type multidrug transport system, ATPase component [Streptococcus suis 05ZYH33] >gi|145690315|gb|ABP90821.1| ABC-type multidrug transport system, ATPase component [Streptococcus suis 05ZYH33] (244 aa)
Score = 281, Expect = 3.3e-23, Identities = 71/213 (33%), Positives = 111/213 (52%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYT 268
           +LEV N+   Y     P + +++F V  G+    +G NGAGK+TTIK IIG    + G I I G+         R K+G+IPE       ++  ++L   A    +  ++A    E +LK FR+ +  +  P NFS G K+K+++  A    P +LI+DEP   LDP A  D   +LGE +    SI +S+H+L   +   ++  IL  G++  T
  S:     1 MLEVKNVTGGYVNI--PVLKDVSFTVEDGQLVGLIGLNGAGKSTTIKEIIGLLTPYQGQIVIDGLTLLQGAENYRKKIGFIPETPSLYEELTLKEHLEVVAMAYDLSWEQAWGRVEHLLKLFRLDEKLDWFPVNFSKGMKQKVMIICAFMVEPSLLIVDEPFLGLDPVAISDLIALLGEEKSKGTSILMSTHVLDSAEKMCDSFVILHQGQVRAT 213
>gi|163939643|ref|YP_001644527.1| ABC transporter related [Bacillus weihenstephanensis KBAB4] >gi|163861840|gb|ABY42899.1| ABC transporter related [Bacillus weihenstephanensis KBAB4] (312 aa)
Score = 281, Expect = 3.3e-23, Identities = 64/210 (30%), Positives = 119/210 (56%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           LE+ NL K++       +DN++  +  GE   F+G+NGAGK+TTI  I G  R+ +G I I G  I   N  ++  +G +P++      +++++ + + A L  ++  E K   E  L+   + D     P NFS G K+++ +A A+++ P ++IMDEPT  +DP++R      + +L ++  +I  +SH + E++     + I+D+GK++
  S:     4 LEIKNLTKKF--GDFIAVDNMSLSIKEGEIFGFLGSNGAGKSTTINMIAGLLRSNEGEISILGKNIKKHNRFAKMNIGIVPQDIAIYEELTAYENVKFFAGLYGLRGAELKARVEEALQFVGLSDKHKSYPKNFSGGMKRRLNIACAIAHRPKLIIMDEPTVGIDPQSRNYILQSVRKLNEMGSTIIYTSHYMEEVEEICTKIAIVDHGKVI 213
>gi|168142324|ref|ZP_02585553.1| Bacitracin transport ATP-binding protein bcrA [Bacillus cereus G9842] (303 aa)
Score = 281, Expect = 3.4e-23, Identities = 78/256 (30%), Positives = 147/256 (57%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRT--KMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGEL-QKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEM-CYRIKLVE-DFEGDKVGKYEVNSNNEIIYEFKDKNELAELIDKLISKEILV 329
           + N++F+V  GE    +G NGAGKTT ++ ++G  R  +G ++I G   K    +T  K+G + E   F   +S ++ L Y  ++N   ++E     + ++K   M  + N+    +S G ++++ +AQAL ++PD+L++DEPT  LDP    +    + ++  +  K++ +SSH+LSE++L  + V I+ +G+ V TQ    +++ EM   RI++ + +   + +G   +  +NE+I   KD+ E+  +I  L+ K I V
  S:    23 VQNISFEVKKGEVVGLLGPNGAGKTTLMRMMVGMIRMTEGEVWIDGQSVKQQFEKTAAKIGAVIETPEFYPFLSGYENLTYFGRMNGNVTEER---IDEVVKLLGMGQVINRKVKAYSLGMRQRLGIAQALIHDPDVLVLDEPTNGLDPSGIHEMRMYIKKIAHEQGKAVLVSSHLLSEVELMCDRVIIIQHGEYVATQNIQHSQSEEMETIRIRVDDANKAAEMLGHDVLVKDNELIINVKDE-EIPNVIRTLLEKNIQV 279
>gi|77919736|ref|YP_357551.1| ABC-type transport system, ATPase component [Pelobacter carbinolicus DSM 2380] >gi|77545819|gb|ABA89381.1| ABC-type transport system, ATPase component [Pelobacter carbinolicus DSM 2380] (247 aa)
Score = 281, Expect = 3.4e-23, Identities = 60/209 (28%), Positives = 116/209 (55%)
  Q:    62 LRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQK 270
            R+   G+K   +  ++  V+ GE   F+G NGAGK+TTIK ++   R   G   I G D ++   R ++G++PEN +F   ++  + L++  + + +  K  K     ++++  + D   +    +S G  ++  LA A+ ++PD++I+DEP + LDP  R    D++  L+   K++F SSHIL++++ + + + I+  G++  T K
  S:    11 FREGLRGRKVQALQGVSVSVHQGEVFGFLGLNGAGKSTTIKVLLNLIRPDVGKATILGRDVRDPSVRNRVGFLPENPYFYDYLTGEELLWFGGRASGVAKKVLKKRIPLLMEQVGLTDAGKRHLRTYSKGMVQRAGLALAIVHDPDVVILDEPMSGLDPLGRKMVGDMILSLRGEGKTVFFSSHILNDIERFCDRIGIIAKGRLRLTGK 219
>gi|194017583|ref|ZP_03056194.1| ABC superfamily ATP binding cassette transporter, ABC protein [Bacillus pumilus ATCC 7061] >gi|194010855|gb|EDW20426.1| ABC superfamily ATP binding cassette transporter, ABC protein [Bacillus pumilus ATCC 7061] (305 aa)
Score = 281, Expect = 3.4e-23, Identities = 80/291 (27%), Positives = 167/291 (57%)
  Q:    56 LLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID-NKNLESRTK-MGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEV-NSNNEIIYEFKDKNELAELID--------------------KLISKE--ILVKFEKYYLSIEDLYKKYV 346
           +LE   L K Y    +  + N++F V       F+GANGAGKTTTI+ + G  R   G + ++G+D  K+++  +  +G  P+   F   ++  +++++   L +++    +   E +LK  R+++ ++++  ++S G K+++ +AQAL N+P +LI+DEP + LDP  R D   ++  L K    IF+S+HIL +++  ++ + ++++GKI            EM   +K +++     V ++++   N +++   K+++ + E I+                    +LI++   +L+ +    L++ED++ K V
  S:     3 MLECHELTKSY--GPNEVLKNVSFSVGEVGCVGFLGANGAGKTTTIRILTGLARPTSGVVKVAGLDVTKDMDDISHVIGCCPQQPAFYQDMTGQEWMHWVGGLFQLEKNIIRSKTEELLKLCRIYEAKDRAIGSYSGGMKQRLAIAQALINSPKVLILDEPVSALDPMGRKDVLTLIERL-KHEMLIFMSTHILDDIERVADHIIMINSGKI------------EMSSSMKQIKEDYIQPVIEFQLEQQNTKLVALLKERDWVEECIETGDAYQVRVNDQQMALKELPRLITEAGGVLLHYRLSKLTLEDIFMKVV 303
>gi|154493334|ref|ZP_02032654.1| hypothetical protein PARMER_02671 [Parabacteroides merdae ATCC 43184] >gi|154086544|gb|EDN85589.1| hypothetical protein PARMER_02671 [Parabacteroides merdae ATCC 43184] (297 aa)
Score = 281, Expect = 3.5e-23, Identities = 68/216 (31%), Positives = 132/216 (61%)
  Q:    73 TIDNLNFKVYPGEFHAF--------------VGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFA-ESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY---TQKRNKNENGEMCYRIKLVED 288
           +I  LN KVYP   HA               +G NGAGK+T ++ ++       G + I G D   +  E R  +GY+P++  F ++  ++++L Y A+L+ +  K  +  A + +L+   ++D+R++  N  S G K+++ +AQAL ++P ++I+DEPT  LDP+ RI F ++L E+ +   +I +S+HI+ ++    N + +++ G++ +    Q   +   G++ +RI++  D
  S:     4 SIRKLN-KVYPNGNHALKDVCLEIPTGMFGLLGPNGAGKSTLMRILVALMEPTSGEVNICGYDLMRQRKEIRGVLGYLPQDFRFFAKYKTYEFLDYAARLSGMNCKSLRKNAVDEMLENVGLFDVRDRYANKLSGGMKRRLGIAQALIHHPKVIIVDEPTTGLDPEERIRFRNLLSEVSENDVTIILSTHIVGDISSTCNCMALMNKGEVSFYGSPQDMLRQAEGKV-WRIRVTSD 237
>gi|154503495|ref|ZP_02040555.1| hypothetical protein RUMGNA_01319 [Ruminococcus gnavus ATCC 29149] >gi|153795595|gb|EDN78015.1| hypothetical protein RUMGNA_01319 [Ruminococcus gnavus ATCC 29149] (293 aa)
Score = 281, Expect = 3.5e-23, Identities = 72/210 (34%), Positives = 120/210 (57%)
  Q:    57 LEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGS--IYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIV 266
           +++ NL K YYGK    I NLN  V  GEF  F+G+NGAGK+TTI++++G      G   I+   I  +N + R+ +GY+P    F   +   D L  +A L+    K+  +  E + ++ ++ D+ N+  +  S   +KK+ +  AL + P +LI+DEPT+ LDP  + +FF I+ E  +   ++F+SSH+LSE+        I+  G+I+
  S:     4 IQLSNLTK-YYGKSR-GILNLNLDVKEGEFFGFIGSNGAGKSTTIRTLLGLITPSSGQAKIFDETIRKRNPKIRSHIGYLPSEAVFYRGMKVKDLLKLSADLH---YKDCSVEREILCRRLQL-DV-NRKVDELSFDNRKKVAIVSALQHQPKLLILDEPTSGLDPLMQREFFHIIRERNEQGATVFLSSHVLSEIQRNCTRAAIIREGRII 208
>gi|42522432|ref|NP_967812.1| ABC-type phosphonate transport protein, ATP-binding [Bdellovibrio bacteriovorus HD100] >gi|39574964|emb|CAE78805.1| ABC-type phosphonate transport protein, ATP-binding [Bdellovibrio bacteriovorus HD100] (247 aa)
Score = 281, Expect = 3.5e-23, Identities = 71/212 (33%), Positives = 117/212 (55%)
  Q:    56 LLEVVNLRKQYYG----KKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKS-KEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVY 267
           +L +  L K + G    K    + ++ F +  G+   FVG+NGAGKTTTIK +    R   G I   G    + ES+T++GY+PE  +    ++  ++L     L    + K+    A   LKK  +++ R++    +S G  ++I +AQA+   PD+LI+DEP + LDP  R    DIL E QK   S+F SSH+L +++     + +++ G+I+Y
  S:     3 VLSIEKLNKTFKGGLFEKDRHVLRDVTFSLPEGQTSGFVGSNGAGKTTTIKCLFDFIRPDSGQINFFGAPLTS-ESKTRIGYLPERPYLYEFLTGMEFLRLHWNLCYGSAMKDFHERAHEALKKVDLFEARDRRLRTYSKGMLQRIGIAQAILTRPDLLILDEPMSGLDPDGRAMVKDILREEQKRGVSLFFSSHLLQDMEELCTHLVVINRGQILY 218
>gi|46199397|ref|YP_005064.1| ABC transporter ATP-binding protein [Thermus thermophilus HB27] >gi|46197022|gb|AAS81437.1| ABC transporter ATP-binding protein [Thermus thermophilus HB27] (307 aa)
Score = 281, Expect = 3.6e-23, Identities = 61/192 (31%), Positives = 113/192 (58%)
  Q:    74 IDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGID--NKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKIKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKI 265
           +++LN  V  GE +  +G NG+GKTTTI  ++G      G   + G D   + L+ ++++GY+P+   F   +S+++ L YT +L  +  KEA+   E +LK+  +W++R +    FS G ++++ LA+ L   P + I+DEPT  LDP+A  +F D++  L+    ++ +SSH+L ++    + V +   G++
  S:    19 VEDLNLSVREGEVYGLLGPNGSGKTTTILLLLGLTEPTSGEARVLGFDPMREPLKVKSRVGYLPDQVGFYGELSAWENLRYTTRLLGLPDKEAEARIEEVLKRMGLWEVRGRKVAAFSRGMRQRLGLAEVLLKRPKVAILDEPTLGLDPEAAREFLDLIKGLKAEGITVLLSSHLLHQVQEVCDRVGLFHKGRL 212
>gi|146342468|ref|YP_001207516.1| putative ABC transporter (ATP binding protein) [Bradyrhizobium sp. ORS278] >gi|146195274|emb|CAL79299.1| putative ABC transporter (ATP binding protein) [Bradyrhizobium sp. ORS278] (306 aa)
Score = 281, Expect = 3.7e-23, Identities = 80/292 (27%), Positives = 150/292 (51%)
  Q:    55 PLLEVVNLRKQYYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISG--IDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNK--IKSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNK--NENGEMCYRIKLVEDFEG--DKVGKYEVNSNNE---IIYEFKDKNE---LAELIDKLISKEI-LVKFEKYYLSIEDLYKKYV 346
           P++ V  L K Y      +++N+N  +  GE  A +G NGAGKTT I  I G      G + + G  I++    +R+ +G +P+         SF+ ++ T   ++            E ILK   +WD ++      S G K+++++A+ALS+ P +L +DEPTA +D + R   +D++ EL+    +I +++H + E +  ++ V +++ G+IV  + + K   + G     ++L    +   D +  Y +  + +   + Y++  K E   +  L+  L S  I  V  E    S+ED++   V
  S:     3 PVISVSGLSKTY-PSGFTSLNNINLSIERGEIFALLGPNGAGKTTLISIICGIVNASTGKVAVGGHDINDGYRAARSLIGLVPQEL----HTDSFESVWATVSFSRGLFGKPRNPALIEKILKDLSLWDKKDAKIITLSGGMKRRVMIAKALSHEPQVLFLDEPTAGVDVELRKGMWDVVRELKAAGVTIILTTHYIEEAEEMADRVGVINKGEIVLVEDKAKLMQKLGRKRLSLQLQHRIDSIPDALAPYHLTLSADGWRLAYDYDTKGERTGITSLLGDLRSAGIRFVDLETKQSSLEDIFVSLV 304
>gi|16331443|ref|NP_442171.1| ABC transporter [Synechocystis sp. PCC 6803] >gi|2506115|sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 >gi|1001104|dbj|BAA10241.1| ABC transporter [Synechocystis sp. PCC 6803] (354 aa)
Score = 281, Expect = 3.7e-23, Identities = 73/277 (26%), Positives = 148/277 (53%)
  Q:    66 YYGKKHPTIDNLNFKVYPGEFHAFVGANGAGKTTTIKSIIGSYRNFDGSIYISGIDNKNLESRTKMGYIPENTFFPSRISSFDYLYYTAKLNKI--KSKEAKLFAESILKKFRMWDLRNQSPNNFSSGQKKKILLAQALSNNPDILIMDEPTANLDPKARIDFFDILGELQKLHKSIFISSHILSELDLYSNAVTILDNGKIVYTQKRNKNENGEMCYRIKLVEDFEGDKVGKYEVN-SNNEIIYEFKDKNELAELIDKLIS-KEILVKFEKYYLSIEDLY 342
           +  +K  ++  L+  V  GE    +G NGAGKTT +K ++G  R   G   + G    + +++ ++GY+PEN +F   ++++++L Y   L +I  + ++ ++ A   L        + +    +S G  +++ +AQAL N+P+++ +DEP + LDP  R    +I+  L++  K+IF +SHIL++++   + + IL  G+++ +    +    +  Y + L +  E + +GKY  N S  + ++    + ++  L+D L S    L+       S+ED +
  S:    62 WMNQKVESLKPLSIAVQQGETFGLLGPNGAGKTTLLKILLGVIRASGGRGTLLGKPIGDRQTKQRVGYLPENAYFYDFLTAWEFLDYIGSLFQIGKQERQRRILAMCDLVGLAQKTAKKKQLRQYSKGMLQRVGMAQALINDPEVVFLDEPMSGLDPLGRYQVREIILSLKEQGKTIFFNSHILADVEQICDRIAILARGELLCSGSLAEVLGNDEGYEVVL-KGGEEEALGKYLANLSQEQDVWHGHYQGDVQALVDALPSLNARLISMNLARPSLEDYF 341