>gi|26553550|ref|NP_757484.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453556|dbj|BAC43888.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (679 aa)
Score = 2922, Expect = 0.0e+00, Identities = 679/679 (100%), Positives = 679/679 (100%)
  Q:     1 MRNEFTKNIAVKTKSFFENFNHFIKYEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLNVTEQGKPSAVQGYTPNSNSSRTAEESYQVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQDFSNFTGTSLKLVYPMEPSSQSSQTQEENFLFVPTYDTGISSTNASNLFGTYVQYTLYDYNNVKLVDGNTEYLDFENLINQRFEYRWDNVQWTQNNSNGSTQETDATKIILNYADDFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKLNQIIYTGIYRNFVRGSNSTINVQIIIDRFMAAFEELQKDPNNTSLLEELARNYIQQFVLLRLMYFNFQSGISNLRSYINSLESNNQNNGGGSGSGNSNGNGTDSGNTENDTDTYNKGIQAFFTGAFSGGSISFKIKDPSNNSSNSYFNYSFRPTYRIAPSSRFANFQEAKLVSLYNPYGLFISWIGFSAVITLISLVIYRKKDFK 679
           MRNEFTKNIAVKTKSFFENFNHFIKYEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLNVTEQGKPSAVQGYTPNSNSSRTAEESYQVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQDFSNFTGTSLKLVYPMEPSSQSSQTQEENFLFVPTYDTGISSTNASNLFGTYVQYTLYDYNNVKLVDGNTEYLDFENLINQRFEYRWDNVQWTQNNSNGSTQETDATKIILNYADDFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKLNQIIYTGIYRNFVRGSNSTINVQIIIDRFMAAFEELQKDPNNTSLLEELARNYIQQFVLLRLMYFNFQSGISNLRSYINSLESNNQNNGGGSGSGNSNGNGTDSGNTENDTDTYNKGIQAFFTGAFSGGSISFKIKDPSNNSSNSYFNYSFRPTYRIAPSSRFANFQEAKLVSLYNPYGLFISWIGFSAVITLISLVIYRKKDFK
  S:     1 MRNEFTKNIAVKTKSFFENFNHFIKYEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLNVTEQGKPSAVQGYTPNSNSSRTAEESYQVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQDFSNFTGTSLKLVYPMEPSSQSSQTQEENFLFVPTYDTGISSTNASNLFGTYVQYTLYDYNNVKLVDGNTEYLDFENLINQRFEYRWDNVQWTQNNSNGSTQETDATKIILNYADDFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKLNQIIYTGIYRNFVRGSNSTINVQIIIDRFMAAFEELQKDPNNTSLLEELARNYIQQFVLLRLMYFNFQSGISNLRSYINSLESNNQNNGGGSGSGNSNGNGTDSGNTENDTDTYNKGIQAFFTGAFSGGSISFKIKDPSNNSSNSYFNYSFRPTYRIAPSSRFANFQEAKLVSLYNPYGLFISWIGFSAVITLISLVIYRKKDFK 679
>gi|26553756|ref|NP_757690.1| putative integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453763|dbj|BAC44094.1| putative integral membrane protein [Mycoplasma penetrans HF-2] (626 aa)
Score = 329, Expect = 2.3e-28, Identities = 132/462 (28%), Positives = 218/462 (47%)
  Q:    26 YEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLN---VTEQGKPSAVQGYTPNSNSSRTAEES-------------YQVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQDFSNFT--GTSLKLVYPMEPSSQSSQTQEENFLFVPTYDTGISSTNASNLFGTY-------------VQYTLYDYNNV-----KLVDGNTEYLDFENLINQRFEYRWDNVQWTQNNSNGSTQETDATKIILNYADDFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKLNQIIYTGIYRNFV 487
           + +F+K++F F F L   K S+YI IFVY+ +I   +II P +    PI L +    ++ L+  +A+++ YI +EIFRT +DDGTEL+T+SKP+ R +I F K  +  I    I++ G   S+           D   ++ G F  T++   +FGSI    S++  KI S+L + GL F++++ ++L +  + T  N     N S+N+  +  +N   V+  G   ++Q      ++S +   S             ++       +     FDFG QLS++F LN  P DT   +  M  +     L+FS      + +  G S   V P      +       +L++ T  T  SS  ++ +   Y             +  T+YDYN       +  D  T    +E+  N     ++     T  NSN +T E+  TK            TNG      Q    L+N T   + +K  N +    Y  + R  V
  S:    22 FSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVN-----NLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSVSSSNPGMSHITVRPTVSWPNAGTAYPYQYLYLNT--TTASSITSNTMLHKYRIKKSYSYNEFAQMNKTIYDYNAANSSTNETTDSTTSVKYWEDAWN-----KYKETNGTSGNSN-TTLESFVTKFFKERTSSTTTSTNG------QTALSLFNRTEAQELLKEFNTIQYSAYLNLLRKGV 500
>gi|26554049|ref|NP_757983.1| hypothetical protein MYPE5970 [Mycoplasma penetrans HF-2] >gi|26454057|dbj|BAC44387.1| hypothetical protein [Mycoplasma penetrans HF-2] (198 aa)
Score = 226, Expect = 2.2e-16, Identities = 61/175 (34%), Positives = 103/175 (58%)
  Q:    21 NHFIKYEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIIS 195
           NHF    MF+K  F F+F L  KK S Y++I +Y  +I+   I   LI G +P    + P+    L+ ++ +ISSYI+ +I++TP++DG+EL+ +SKPL+R+ IF  K  ++++ G   AL     ++I    P+      L  + GI IA+++ +  F SI++F S+F  K ++
  S:    20 NHF--KNMFNKHCFIFLFVLYIKKVSYYVSILLYQAIII-LFICLSLIRGDEPTYFFANPISITFLIFLLTVISSYISTDIYKTPIEDGSELLIVSKPLNRANIFISKISIISMFGLINALVALPVTAICFAFPNSVHSYSLIALFGIPIASLVIYLAFASISLFISIFLKKSLA 191
>gi|54020528|ref|YP_115978.1| hypothetical protein mhp468 [Mycoplasma hyopneumoniae 232] >gi|53987701|gb|AAV27902.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (593 aa)
Score = 163, Expect = 3.5e-09, Identities = 56/175 (32%), Positives = 93/175 (53%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGT--TIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVF 204
           S +YF+F+F L+FKKK IY+ I +  LM +  A+IA      +   L S+ +L + L L I II+SY+ + IF+       +++T  KP  R      K L LT  G   ++ ++  + S   +    + +V+   + G  F+++   F +FG++T   +LF NK  S LS +  VF
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWG--FLSSFFSFMIFGAMT---ALFGNKFSSKLSLSIAVF 183
>gi|71893818|ref|YP_279264.1| hypothetical protein MHJ_0467 [Mycoplasma hyopneumoniae J] >gi|71851945|gb|AAZ44553.1| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (593 aa)
Score = 163, Expect = 3.7e-09, Identities = 56/175 (32%), Positives = 93/175 (53%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGT--TIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVF 204
           S +YF+F+F L+FKKK IY+ I +  LM +  A+IA      +   L S+ +L + L L I II+SY+ + IF+       +++T  KP  R      K L LT  G   ++ ++  + S   +    + +V+   + G  F+++   F +FG++T   +LF NK  S LS +  VF
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWG--FLSSFFSFMIFGAMT---ALFGNKFSSKLSLSIAVF 183
>gi|72080802|ref|YP_287860.1| hypothetical protein MHP7448_0470 [Mycoplasma hyopneumoniae 7448] >gi|71913926|gb|AAZ53837.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (593 aa)
Score = 163, Expect = 3.8e-09, Identities = 56/175 (32%), Positives = 93/175 (53%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGT--TIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVF 204
           S +YF+F+F L+FKKK IY+ I +  LM +  A+IA      +   L S+ +L + L L I II+SY+ + IF+       +++T  KP  R      K L LT  G   ++ ++  + S   +    + +V+   + G  F+++   F +FG++T   +LF NK  S LS +  VF
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWG--FLSSFFSFMIFGAMT---ALFGNKFSSKLSLSIAVF 183
>gi|31544579|ref|NP_853157.1| hypothetical protein MGA_1302 [Mycoplasma gallisepticum R] >gi|31541424|gb|AAP56725.1| NosY [Mycoplasma gallisepticum R] (652 aa)
Score = 147, Expect = 3.1e-07, Identities = 67/308 (21%), Positives = 131/308 (42%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVL--SLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNF--DTGTNFSENTNQIGYLNVTEQGKPSAVQGYTPNSNSSRTAEESYQVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQDFSNFTGTSLKLVYPME 340
           YF F+     KK  ++     Y +M++   +I PL     P    + PV+  S  L+ +++I    + + +F+  V DGTE++ +SKP+ R      K LVL +     +    I ++I    P     +   ++ GIFI   I    FGSI++  S   +K  +++      F++   + L +L   + +    D+     E +      +   Q     V      S++ +  ++ Y+    +  + +   F+ G  L+S++ LN     ++     ++ + +  K+ F  + D  NF      L  P E
  S:    13 YFAFLIKQIVKKPFVWATFSAYFIMLLVILLIFPLYQETSPANYWNNPVIHVSTFLIPVVSIFGIMVAMFLFKDGVADGTEIIIISKPVSRKIYVSAKFLVLILTCLVFSFLLIITAAIAKINPQFQLQNMKDLMLGIFIGNFINSLFFGSISILISFGLSKNSTIVIVFLATFLMNFQTPLSALFFKSPSRVLSDSQHTLVERSLLTNKQDRNHQPVGETVAFQPTPSDAKQNIKQLYEQAEASTFYNQSFYFNLGNALNSIYNLNSL---SYENSGNINFLSANTKIVFERVFDPDNFYNIDFFLPRPDE 321
>gi|26554047|ref|NP_757981.1| hypothetical protein MYPE5950 [Mycoplasma penetrans HF-2] >gi|26454055|dbj|BAC44385.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (575 aa)
Score = 117, Expect = 9.0e-04, Identities = 46/165 (27%), Positives = 81/165 (49%)
  Q:   131 VLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTK-TNFDTGTNFSENTNQIGYLNVTEQGKPSAVQGYTPNSNSSRTAEESYQVEFDTKVFPKFALFDFGQQLSSMFTLN 295
           ++ + G   +L   I +S     P+      L  + G+ IAT+I +  F S+ +  S+F  K +SL++ + +  +++  +I     +D +  N +T TN    T+ I      +  K S V     N N +    ESYQ E   +++PK +  +F QQLS+M+ LN
  S:     1 MILLFGLMNSLISLIVTSTIFAFPNSIYDYSLIALFGVPIATLIIYIAFSSLALLISVFMKKSLSLITISVINVILLFFTIFNIFVVDIRFKNDNTFTNSYRITHPITLNQNNQLDKKSVVS----NVNGT-DFYESYQNESSQRLYPKLSPINFYQQLSNMYGLN 161
>gi|13508074|ref|NP_110023.1| hypothetical protein MPN335 [Mycoplasma pneumoniae M129] >gi|2496462|sp|P75443|Y335_MYCPN Uncharacterized protein MPN_335 >gi|1674194|gb|AAB96149.1| hypothetical protein MPN_335 [Mycoplasma pneumoniae M129] (741 aa)
Score = 115, Expect = 1.3e-03, Identities = 40/185 (21%), Positives = 91/185 (49%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPV--LSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTI 217
           YF+FI     K   +++   + + ++    +I P      P+ L S+PV  +S +++  IA+ ++ IT ++F     +G E++ +++   R ++FF +  VL I  T  A    +F S+  T+ +  +     ++  +F   ++   +F  + +  + F N+  S+L     V +   T+++ + +I
  S:    22 YFRFILKQIVKSWLLWVTAGLVLFLLALVLLIIPAFTKQDPLFLWSHPVVQMSSLIIPFIALFATIITFQVFINGYYNGLEILLITRFFTRGRLFFARLAVLFIWITGTAFLSGLFVSLTATLGATSQT-VTDLVLSVFFGVLLLSLLFSCVLIIIAQFLNRTQSMLLLLLGVSLASFTTVILAFSI 207
>gi|26553808|ref|NP_757742.1| hypothetical protein MYPE3550 [Mycoplasma penetrans HF-2] >gi|26453815|dbj|BAC44146.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (468 aa)
Score = 115, Expect = 1.5e-03, Identities = 66/245 (26%), Positives = 122/245 (49%)
  Q:    28 MFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDK---VDQLKVIGG----------IFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLNVTEQGKPSAVQ-----GYTPNS---NSSRTAEESYQVEFD 272
           + S  YF FIF +N KK +  + I +++L ++   I      G    + ++   LS+I VL I+ I+S  T+ +F+    +G E++ +SKP+ R QI F K  +L ++   I++   I + IG++I +  K     Q  +             +F A+I    +FGSIT   ++  +K +S      L  ++ + +   S+      N  +  NF    +Q   +   +  K + V      G+  +S   +S+ + + SYQ   D
  S:    63 ILSYFYFLFIFLIN-KKGTWIMPIIIFLLPLLFSIIAITSSEGSTNTIYIT--SLSIICVLTISFITSK-TINLFKDSETEGVEILIVSKPIERWQIIFGKFSILILVSLLISVLNFISNLIGVSIVNAFKKLDTSQTAIFNQVDLNVNYALLVFGASIALCLLFGSITSLITIKCSKKLSSSIPIMLFMLMYMGTFFSSIISTIGENGSSAYNFYNKWSQTSSIQYNQSFKYTHVNNSVWIGFEKSSIENSSTDSNKVSYQTLLD 324
>gi|42561436|ref|NP_975887.1| hypothetical protein MSC_0919 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492935|emb|CAE77529.1| Conserved hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (487 aa)
Score = 114, Expect = 1.8e-03, Identities = 52/196 (26%), Positives = 93/196 (47%)
  Q:    32 EYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGL-TIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGT 227
           +Y QF F    KKKS  I     ++  +   +I   ++  + + LLS+ +   IL+ +  + S    + IF+    +G E+++LSKPL R  +   K L LT  G   +LT  I S + L  + S   +    ++ G     +I + +F   TV  S    + IS++    L   + +T ++  L+I+ K+N D  +
  S:     7 KYSQFAFYTILKKKSSIILPIFTLISSLIIGLILKFVVNNKYVELLSF-LYVFILITLTVVFSCIKALNIFKDLEQEGLEIISLSKPLTRESLIIGKLLCLTFFGLIWSLTLLISSFLSLYAVYSFLYLFLTSLLLG--FVGLITYLLFSLFTVLLSYKLAQKISMIIPFVLFIPLSLTGMI--LSINVKSNVDQAS 198
>gi|147921268|ref|YP_684918.1| putative ABC-type transport system, permease component [uncultured methanogenic archaeon RC-I] >gi|110620314|emb|CAJ35592.1| putative ABC-type transport system, permease component [uncultured methanogenic archaeon RC-I] (283 aa)
Score = 112, Expect = 2.9e-03, Identities = 54/176 (30%), Positives = 92/176 (52%)
  Q:    38 FSLNFK-KKSIYINIFVY--ILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIG---LTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSL-----FANKIISLLSTTGLVFVIIVTSILG 213
           F  N K K+ I + IF +   L++    ++      F+P ++L+      I++ ++A+I S  T+ + R    D T L  LSKP+ RS + F K L    +   + L  AIF+ +    LT       D L V GG+ I+ ++  +V+ +I V  S      F + I S+++  GL F  I+ +I+G
  S:    19 FKDNLKSKRFIILGIFYFGFALLLTFAVVMMTRTESFKPHMVLAIMSNLNIVLALLAVIVSSDTISMERK---DRTILQLLSKPVDRSSVIFGKFLGCLSVVAALFLASAIFAYLATAVLTGKYPAAGDLLPVAGGL-ISMVLMLSVYVAIGVLISTVTKNPFISIIGSIMAWIGLWFSSIIGNIVG 201
>gi|188158995|ref|ZP_02998448.1| hypothetical protein Mmycm_00235 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (631 aa)
Score = 110, Expect = 5.8e-03, Identities = 55/196 (28%), Positives = 95/196 (48%)
  Q:    32 EYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGL-TIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVT-SILGS-LTIDTKTNFDTGT 227
           +Y QF F    KKKS  I     ++  +   +I   ++  + + LLS+ +   IL+ +  + S    + IF+    +G E+++LSKPL R  +   K L LT  G   +LT  I   + L  I S   +    ++ G     +I + +F   TV  S    + IS++    + FV+ V  S++G  L+I+ K+N D  +
  S:     7 KYSQFAFYTILKKKSSIILPIFTLISSLIIGLILKFVVNNKYVELLSF-LYVFILITLTVVFSCIKALNIFKDLEQEGLEIISLSKPLTRESLIIGKLLCLTFFGLIWSLTLLISGFLSLYAIYSFLYLFLTSLLLG--FVGLITYLLFSLFTVLLSYKLAQKISMI----IPFVLFVPLSLIGMILSINVKSNVDQAS 198
>gi|186701597|ref|ZP_02971306.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700827|gb|EDU19109.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (595 aa)
Score = 108, Expect = 8.3e-03, Identities = 47/186 (25%), Positives = 92/186 (49%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIISLL----STTGLVFVIIVTSILGSL 215
           S  Y  F+  L   KK+ Y+   + +L+ +   I+   ++  +   L+   V+ +  +L+  I +S   + IF+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ +FG IT   +L  N  IS+L    S   L+ + I+ +++G +
  S:    10 SLAYIGFLTRLIIVKKTTYLLPIITLLITLIIGIVVGCVVKQKTQFLIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLV----SFLGLLIFYLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISILIPFVSFIPLLTIGIIANLVGQV 199
>gi|13357649|ref|NP_077923.1| membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761999|ref|YP_001752173.1| hypothetical protein UPA3_0093 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508508|ref|ZP_02958036.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11292842|pir||E82934 hypothetical protein UU092 [imported] - Ureaplasma urealyticum >gi|6899046|gb|AAF30498.1|AE002109_1 unique hypothetical membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827576|gb|ACA32838.1| putative membrane protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675938|gb|EDT87843.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (595 aa)
Score = 108, Expect = 8.8e-03, Identities = 43/168 (25%), Positives = 81/168 (48%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIISLL 197
           S  Y  F+  L   KK+ Y+   + +L+ +   I+   ++  +   L+   V+ +  +L+  I +S   + IF+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ +FG IT   +L  N  IS+L
  S:    10 SLAYIGFLTRLIIVKKTTYLLPIITLLITLIIGIVVGCVVKQKTQFLIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLV----SFLGLLIFYLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISIL 177
>gi|171920295|ref|ZP_02691002.2| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902708|gb|EDT48997.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] (595 aa)
Score = 108, Expect = 8.9e-03, Identities = 43/168 (25%), Positives = 81/168 (48%)
  Q:    30 SKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIISLL 197
           S  Y  F+  L   KK+ Y+   + +L+ +   I+   ++  +   L+   V+ +  +L+  I +S   + IF+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ +FG IT   +L  N  IS+L
  S:    10 SLAYIGFLTRLIIVKKTTYLLPIITLLITLIIGIVVGCVVKQKTQFLIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLV----SFLGLLIFYLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISIL 177
>gi|83319911|ref|YP_424750.1| hypothetical protein MCAP_0802 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283797|gb|ABC01729.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (612 aa)
Score = 105, Expect = 2.0e-02, Identities = 56/196 (28%), Positives = 95/196 (48%)
  Q:    32 EYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAI--FSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGT 227
           +Y QF F    KKKS  I   + ++  +   II   ++  + + LLS+ +   ILV +  + S    + IF+    +G E+++LSKPL R  +   K L LT  G   +LT  I  F S+  T   +       ++G + + T + F++F   TV  S    + IS++     V  I ++ I   L+I+ K+N D  +
  S:     7 KYSQFAFYTILKKKSSIILPVITLISSLIIGIILNFVVNNKYVELLSF-LYVFILVTLTVVFSCIKALNIFKDFEQEGLEIISLSKPLTRESLIIGKLLCLTFFGLIWSLTLLISGFLSLYATYSFLYLFLTSLLLGFVGLITYLLFSLF---TVLLSYKLAQKISMI--IPFVLFIPLSLIGMILSINVKSNVDQAS 198
>gi|171920804|ref|ZP_02931987.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903568|gb|EDT49857.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (596 aa)
Score = 105, Expect = 2.1e-02, Identities = 46/170 (27%), Positives = 89/170 (52%)
  Q:    43 KKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIIS----LLSTTGLVFVIIVTSIL 212
           KK +  + I  +++M++   I+  ++      L++SY V+ +  +L+  I +S   + +F+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ VFG +T   +L  N  IS    L+S   L+ V IV++I+
  S:    24 KKTTYILPIITFLIMLIVGIIVGCVVNQKSQFLIISY-VMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSL----ISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPLVSFVPLLAVGIVSNIV 196
>gi|188568748|ref|ZP_03005495.1| hypothetical protein Uurealyserovar_01370 [Ureaplasma urealyticum serovar 2] >gi|188592562|ref|ZP_03005880.1| hypothetical protein Uureaserovar_01380 [Ureaplasma urealyticum serovar 10] (592 aa)
Score = 105, Expect = 2.1e-02, Identities = 49/183 (26%), Positives = 89/183 (48%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIIS----LLSTTGLVFVIIVTSILGSL 215
           Y  F+      KK+ YI   +  L+ +   II   ++  +   L+   V+ +  +L+  I +S   + +F+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ VFG +T   +L  N  IS    L+S   L+ V IV++I+  L
  S:     9 YVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSL----ISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPLVSFVPLLAVGIVSNIVSQL 195
>gi|185178700|ref|ZP_02964520.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|195867364|ref|ZP_03079368.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209293|gb|EDU06336.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|195660840|gb|EDX54093.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (596 aa)
Score = 105, Expect = 2.1e-02, Identities = 49/183 (26%), Positives = 89/183 (48%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIIS----LLSTTGLVFVIIVTSILGSL 215
           Y  F+      KK+ YI   +  L+ +   II   ++  +   L+   V+ +  +L+  I +S   + +F+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ VFG +T   +L  N  IS    L+S   L+ V IV++I+  L
  S:    13 YVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSL----ISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPLVSFVPLLAVGIVSNIVSQL 199
>gi|188024353|ref|ZP_02997024.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039343|ref|ZP_02998120.1| hypothetical protein Uures_01215 [Ureaplasma urealyticum serovar 8] >gi|188518702|ref|ZP_03004128.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188531103|ref|ZP_03005342.1| hypothetical protein Uurese_01000009_0200003488 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188018619|gb|EDU56659.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997703|gb|EDU66800.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (592 aa)
Score = 105, Expect = 2.1e-02, Identities = 49/183 (26%), Positives = 89/183 (48%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIIS----LLSTTGLVFVIIVTSILGSL 215
           Y  F+      KK+ YI   +  L+ +   II   ++  +   L+   V+ +  +L+  I +S   + +F+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ VFG +T   +L  N  IS    L+S   L+ V IV++I+  L
  S:     9 YVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSL----ISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPLVSFVPLLAVGIVSNIVSQL 195
>gi|83319360|ref|YP_424746.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283246|gb|ABC01178.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (621 aa)
Score = 105, Expect = 2.4e-02, Identities = 55/207 (26%), Positives = 102/207 (49%)
  Q:    32 EYFQF-IFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYI-TVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFA---VFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGY 238
           +Y QF  F++ +KK S  + IF  +  I+   +I   +I  + + L SY  L + L+LII +I S I ++ IF+    +G E+++ SKP+ R+ +   K L L+         G I+SSI L    +        I  I  + ++ F     +  I++  ++ + K+   ++ T  + + I  SI+G +           +N + N N++GY
  S:     7 KYCQFAFFTILYKKSSYLLPIFTLVFSII-IGLIFKFVIDEKYLALSSY--LYIFLLLIITVIFSAIKSLNIFKDLDQEGLEIISFSKPISRNSLILGKLLCLS-------FYGLIWSSILLISFLVSLYANYSFINLILTSLLLWFVGLITYLLISLITAILSYKLTQKIALTIPLVLFIFLSIIGMV---------LSSNTTSNLNKVGY 199
>gi|188524135|ref|ZP_03004208.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659940|gb|EDX53320.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (592 aa)
Score = 104, Expect = 2.9e-02, Identities = 48/183 (26%), Positives = 89/183 (48%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGI----FIATIICFAVFGSITVFFSLFANKIIS----LLSTTGLVFVIIVTSILGSL 215
           Y  F+      KK+ YI   +  L+ +   II   ++  +   L+   ++ +  +L+  I +S   + +F+   +DG +++ +SKP+ R  I + K     + G   +L     S +GL I  +   +  K +       +I+  IC+ VFG +T   +L  N  IS    L+S   L+ V IV++I+  L
  S:     9 YVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYIMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSL----ISFLGLLIFYLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPLVSFVPLLAVGIVSNIVSQL 195
>gi|188158999|ref|ZP_02998452.1| ABC transporter, permease protein, putative [Mycoplasma mycoides subsp. mycoides LC str. GM12] (623 aa)
Score = 102, Expect = 4.5e-02, Identities = 54/215 (25%), Positives = 103/215 (47%)
  Q:    24 IKYEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYI-TVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFA---VFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGY 238
           +K  +F    F F F++ +KK S  + IF  +   +   +I   +I  + + L SY  L + L+LII +I S I ++ +F+    +G E+++ SKP+ R+ +   K L L+         G I+SSI L    +        I  I  + ++ F     +  I++  ++ + K+   ++ T  + + I  SI+G +           +N + N N++GY
  S:     1 MKISIFKYSQFAF-FTILYKKSSYLLPIFTLVFSTI-IGLIFKFVIDEKYLGLSSY--LYIFLLLIITVIFSAIKSLNVFKDLDQEGLEIISFSKPISRNNLILGKLLCLS-------FYGLIWSSILLISSLVSLYANYSFINLILTSLLLWFVGLITYLLISLITAILSYKLTQKIALTIPLVLFIFLSIIGMV---------LSSNTTSNLNKVGY 199
>gi|113478064|ref|YP_724125.1| hypothetical protein Tery_4688 [Trichodesmium erythraeum IMS101] >gi|110169112|gb|ABG53652.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101] (257 aa)
Score = 102, Expect = 4.7e-02, Identities = 42/166 (25%), Positives = 83/166 (50%)
  Q:    37 IFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSL-ILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCL-------VLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICF---AVFGSITVFFSLFANKIISLLSTTGL 202
           +F    + + +YI     +LM+ A  +I  L +G    ++L + + ++ IL LI+ +   +I   +    ++  T  + ++KPL RS++   K +       VL I+ T I   G I S  G++ P          IG I +  I  F   ++  ++ + F +F + +++ L T G+
  S:    13 VFGEAIRDRILYIIGLFALLMVAAVRLIPELSVGTDDKIILDFGLAAISILGLIVTV---FIGTNLVNKEIEKRTVYILVAKPLSRSELIVGKHIGLSAVLAVLLIVMTVI--YGLILSLSGISYP----------IGSILVTVIFIFIQLSLLTAVAILFGVFTSSLLATLFTFGI 174
>gi|108761057|ref|YP_633917.1| putative efflux ABC transporter, permease protein PilI [Myxococcus xanthus DK 1622] >gi|2581816|gb|AAC36156.1| PilI [Myxococcus xanthus DK 1622] >gi|108464937|gb|ABF90122.1| putative efflux ABC transporter, permease protein PilI [Myxococcus xanthus DK 1622] (255 aa)
Score = 100, Expect = 7.2e-02, Identities = 31/120 (25%), Positives = 61/120 (50%)
  Q:    85 ILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCL--VLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVF 204
           ++ L++  +S Y++  +    ++  T  + +SKPL R++    +    +LT+    +A+T   +  + L    I +  QL  +GG+++       V  S     S FA++++S L TTGL F
  S:    57 VMSLLLVFLSVYLSSGLISREIERRTIFLMVSKPLSRTRFLLARLAGNMLTLGVLLVAMTLLFWVQLALHRSPITQ-PQLAALGGLYLELF----VLTSAGFLMSTFASQLVSALVTTGLYF 173
>gi|42560871|ref|NP_975322.1| ABC transporter, permease component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492368|emb|CAE76964.1| ABC transporter, permease component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] (610 aa)
Score = 99, Expect = 9.3e-02, Identities = 52/190 (27%), Positives = 90/190 (47%)
  Q:    33 YFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGF---QPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGL-TIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTN 222
           Y  F F++ FKKKS   +IF+  ++ V   II  L+  F      L LS  + ++ L+L   + SS  ++ IF+   ++G E++TLSKP+ R  I   K   LT  G   +    I   I L  I S   +    ++  +   +++ + + G +    S   N+ IS+     L   +I+T  + S  + +  N
  S:     8 YAFFAFNITFKKKS---SIFMPGVITVISFIIG-LVFKFVVSDKYLELSGFLYTIALILTTVVFSSIKSLNIFKDLENEGIEIITLSKPISRKNIVLGKLASLTFFGLLWSFVLFICGLISLYAIHSFKDLILYSLL--LMFVSLVTYLMVGLLVALLSNKLNQKISMTIPLVLFVPLILTGSIISANVSSNVN 195
>gi|15227380|ref|NP_181687.1| ACA4 (AUTO-INHIBITED CA(2+)-ATPASE, ISOFORM 4); calcium-transporting ATPase/ calmodulin binding [Arabidopsis thaliana] >gi|12229630|sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type (Ca(2+)-ATPase isoform 4) >gi|11493643|gb|AAG35585.1|AF200739_1 plasma membrane-type calcium ATPase isoform 4 [Arabidopsis thaliana] >gi|2618691|gb|AAB84338.1| putative Ca2+-ATPase [Arabidopsis thaliana] (1030 aa)
Score = 98, Expect = 1.4e-01, Identities = 37/182 (20%), Positives = 85/182 (46%)
  Q:    34 FQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTI--ALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSIT--------VFFSLFANKIISLLSTTGLVFVIIVTSILGSL 215
           F+ I ++    +++YINI  ++   +   ++A +I      +  S P+ ++ L+ +  I+ +   + +   P ++G   +    P+ R+  F  K +   I G ++   +   I +  G ++  +D  D   V+  +   + +   VF  I         VF  +F + + + + T  +VF +I+   LG+ 
  S:   787 FKTIVNVARWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVNMIMDTLGALALATEPPNEG---LMKRAPIARTASFITKTMWRNIAGQSVYQLIVLGILNFAGKSLLKLDGPDSTAVLNTVIFNSFVFCQVFNEINSREIEKINVFKGMFNSWVFTWVMTVTVVFQVIIVEFLGAF 975
>gi|125975546|ref|YP_001039456.1| membrane spanning protein [Clostridium thermocellum ATCC 27405] >gi|125715771|gb|ABN54263.1| membrane spanning protein [Clostridium thermocellum ATCC 27405] (250 aa)
Score = 97, Expect = 1.8e-01, Identities = 50/170 (29%), Positives = 90/170 (52%)
  Q:    42 FKKKSIYINIFVYILMIVACAIIAPLI-IGFQPILLLS--YP--VLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCK-CLV-------LTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSI 211
           ++KK + +   + IL IV   ++   I  GF  I   S  +P  VLSL++  I+ + ++ + +++F       T  +TL++P+ R +++  K C V       L +I     + G IF+++ L++  +     L+++   +I T+I    F  I VFFS        L S TG+ F+ IV  I
  S:    16 YRKKKVVVAAILSILAIVMGQLVVTGINRGFGLIAASSTQFPILVLSLLVNTILPLFTTLVAIDVFSGEFSHNTMKITLTRPVSRMKLYAAKICAVAFFVLANLLMIMLLSLVAGFIFNAVSLSVSGV-----LRIVLS-YIVTLIPIMCFALIVVFFSNV------LRSGTGVFFLSIVLFI 186
>gi|167757046|ref|ZP_02429173.1| hypothetical protein CLORAM_02595 [Clostridium ramosum DSM 1402] >gi|167703221|gb|EDS17800.1| hypothetical protein CLORAM_02595 [Clostridium ramosum DSM 1402] (164 aa)
Score = 97, Expect = 2.0e-01, Identities = 20/44 (45%), Positives = 34/44 (77%)
  Q:    42 FKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLS------YPVLSLI 85
           FKK   Y++I  Y+++I    I+AP+++G++P+++LS      YPV SLI
  S:     4 FKKVVSYLSILCYVVIIALVLILAPMVVGYKPVVVLSGSMEPTYPVGSLI 53
>gi|16332298|ref|NP_443026.1| hypothetical protein sll1107 [Synechocystis sp. PCC 6803] >gi|1653928|dbj|BAA18838.1| sll1107 [Synechocystis sp. PCC 6803] (258 aa)
Score = 97, Expect = 2.0e-01, Identities = 46/187 (24%), Positives = 92/187 (49%)
  Q:    43 KKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKV---DQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSL-TIDTKTNFDTGTNF 229
           + + +Y+  F  ILM +A  I+  + +G    + L   + +    L+ AI++ ++   +    +D  T L+ + KPL RS+    K L L+ + T + +   I +SI L + +  K+       +I   F+  ++  AV  +I + F +F + I++ L + G+ F+  ++  L  L  I    N +T T +
  S:    20 RDRILYVIGFFAILMALALRILPEISVGADGKIFLDLGLAAT--SLLGAIVAIFVGTGLINKEIDKRTVLVLIPKPLSRSEFIIGKHLGLSGVLTAMLV---IMTSIYLVMLAWAKIPFSPTAILISQAFL--LLELAVLTAIAILFGVFTSSILATLLSFGVYFMGHISRDLLKLGEITKNANIETLTKY 203
>gi|148377723|ref|YP_001256599.1| ABC transporter, permease protein [Mycoplasma agalactiae PG2] >gi|148291769|emb|CAL59158.1| ABC transporter, permease protein [Mycoplasma agalactiae PG2] (621 aa)
Score = 95, Expect = 2.8e-01, Identities = 35/120 (29%), Positives = 61/120 (50%)
  Q:    32 EYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGF---QPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGL 151
           +Y +F F++ F+K    I+ F+  ++I+  ++I  L+  F   +   LLS  +   I      I SS   + IF+    +G E++TLSKP+ R+ +   K L L   G   +L   + +  GL
  S:     7 KYSRFAFNIVFRK----ISTFILPILILVFSLIIGLVYKFAVGENYHLLSAYIFIFISASATVIFSSIKALNIFKDFDSEGLEIITLSKPISRNNLILGKLLALIYFGLLWSLIMFVAALFGL 125
>gi|57237040|ref|YP_178842.1| hypothetical protein CJE0839 [Campylobacter jejuni RM1221] >gi|57165844|gb|AAW34623.1| conserved domain protein [Campylobacter jejuni RM1221] (116 aa)
Score = 94, Expect = 3.8e-01, Identities = 26/77 (33%), Positives = 46/77 (59%)
  Q:   398 FENLINQRFEYRWDNVQWTQNNSNGSTQETDATKII--LNYAD---------DFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKL 474
            ++L+N ++ Y +D   WT  +S G   E +A++I   LN+ +         +F KL  G  E   +NY +LY    +TQ+  A++K+
  S:    17 LDDLMNGKYTYDFDTKTWTYADSKGVAGENEASEITQSLNFLNAFKDTGVEQEFLKLWQGSQEQSYKNYTNLYE--KWTQKKTAMDKI 102
>gi|157335640|emb|CAO61470.1| unnamed protein product [Vitis vinifera] (883 aa)
Score = 94, Expect = 4.2e-01, Identities = 47/182 (25%), Positives = 84/182 (46%)
  Q:    34 FQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLL-SYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIF--SSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSIT--------VFFSLFANKIISLLSTTGLVFVIIVTSILGSL 215
           F  I ++    +SIYINI  ++   +   I+A LI+ F    L  + P+ ++ L+ +  I+ +   + +   P +D  ELM  S P+ R + F    +   IIG ++     I+   + G     +D  D   ++  I   + +   VF  I         VF  +  N +   + T  +VF II+   LG+ 
  S:   659 FSTIVTVGKWGRSIYINIQKFVQFQLTVNIVA-LIVNFSSACLTGNAPLTAVQLLWVNMIMDTLGALALATEPPND--ELMKRS-PVGRKENFISNVMWRNIIGQSLYQFVIIWFLQTRGKAFFHLDGPDSDLILNTIIFNSFVFCQVFNEINSRELEKINVFKGMLRNHVFVAVVTCTVVFQIIIVQFLGTF 847
>gi|13508072|ref|NP_110021.1| hypothetical protein MPN333 [Mycoplasma pneumoniae M129] >gi|2496463|sp|P75445|Y333_MYCPN Uncharacterized protein MPN_333 >gi|1674196|gb|AAB96151.1| hypothetical protein MPN_333 [Mycoplasma pneumoniae M129] (750 aa)
Score = 94, Expect = 4.3e-01, Identities = 41/138 (29%), Positives = 72/138 (52%)
  Q:    82 LSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIG-LTIPSIDK-VDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDT 219
            SLIL+ ++ +++  IT +IF    ++G EL   SKP+ R +I   K LVL +  + +A+      S+G  T   I+  +D L +   IF+ TI+   +F ++T+  +   + I SL+     V +   +S +  L  DT
  S:    32 FSLILIPLVTLLAGSITADIFIEGYNNGIELFLFSKPISRDRILLIKLLVLLMYLSIVAVLSTAVVSLGYFTRNEIESYLDDLAL--SIFVGTILNGIIFSAVTIMLATRFSNIQSLIILLLFVSLFSFSSPIARLIFDT 169
>gi|110739871|dbj|BAF01841.1| putative Ca2+-ATPase [Arabidopsis thaliana] (292 aa)
Score = 93, Expect = 5.1e-01, Identities = 37/182 (20%), Positives = 85/182 (46%)
  Q:    34 FQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTI--ALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSIT--------VFFSLFANKIISLLSTTGLVFVIIVTSILGSL 215
           F+ I ++    +++YINI  ++   +   ++A +I      +  S P+ ++ L+ +  I+ +   + +   P ++G   +    P+ R+  F  K +   I G ++   +   I +  G ++  +D  D   V+  +   + +   VF  I         VF  +F + + + + T  +VF +I+   LG+ 
  S:    49 FKTIVNVARWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVNMIMDTLGALALATEPPNEG---LMKRAPIARTASFITKTMWRNIAGQSVYQLIVLGILNFAGKSLLKLDGPDSTAVLNTVIFNSFVFCQVFNEINSREIEKINVFKGMFNSWVFTWVMTVTVVFQVIIVEFLGAF 237
>gi|1805654|emb|CAA68234.1| calmodulin-stimulated calcium-ATPase [Brassica oleracea] (1025 aa)
Score = 92, Expect = 5.9e-01, Identities = 39/171 (22%), Positives = 82/171 (47%)
  Q:    45 KSIYINIFVYILMIVACAIIAPLIIGFQPILLL-SYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTI--ALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGS--------ITVFFSLFANKIISLLSTTGLVFVIIVTSILGSL 215
           +++YINI  ++   +   ++A LII F    +  S P+ ++ L+ +  I+ +   + +   P ++G   +   +P+ R+  F  + +   IIG +I   +   I +  G  I  ++  D   V+  I   + +   VF          I VF  +F++ +   + T    F +I+  +LG+ 
  S:   795 RAVYINIQKFVQFQLTVNVVA-LIINFVSACITGSAPLTAVHLLWVNMIMDTLGALALATEPPNEG---LMKRQPIGRTASFITRAMWRNIIGQSIYQLIVLGILNFYGKQILDLNGPDSTAVLNTIIFNSFVFCQVFNEVNSREIEKINVFAGMFSSWVFVAVMTATTGFQLIIVELLGAF 972
>gi|125983938|ref|XP_001355734.1| GA14368-PA [Drosophila pseudoobscura] >gi|54644050|gb|EAL32793.1| GA14368-PA [Drosophila pseudoobscura] (1728 aa)
Score = 92, Expect = 6.3e-01, Identities = 45/159 (28%), Positives = 73/159 (45%)
  Q:    71 FQPILLLSYPVLSLILVLII----AIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNF 229
           F P+L     ++SLI++L        I+ YIT E  +  + +  ++M LS  LH +  F    ++LTI    IA+   I  S G+ + +      L     +++   ICF     +  FFS    K  +  + TGL++ I    I  S TI+T  +   GT  
  S:   266 FDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQ-LKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEGVAVLTHANFTALVFFLIVYVVASICFCFM--MATFFS----KASTAAAVTGLIWFI--AYIPFSFTINTYDDLSLGTKL 419
>gi|171920946|ref|ZP_02932088.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188569197|ref|ZP_02829663.2| hypothetical protein Uurealyserovar_03331 [Ureaplasma urealyticum serovar 2] >gi|188592836|ref|ZP_02694999.2| hypothetical protein Uureaserovar_03215 [Ureaplasma urealyticum serovar 10] >gi|171903182|gb|EDT49471.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (594 aa)
Score = 91, Expect = 7.8e-01, Identities = 38/122 (31%), Positives = 57/122 (46%)
  Q:    72 QPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFF-SLFANKI 193
           Q  L+L Y  +S+ LVL I I S+   + +F+   DDG E++  SK + R  I F K   L +     +L   IF+ I   + + +  D        F     C  +FGSI     S ++NKI
  S:    53 QNYLILFYVFISINLVLTI-IFSTIKAINLFKDLKDDGIEILVFSKSISRKNIIFTKIGFLVLNCVLWSLITYIFNIIFYVVNTKNNNDINLFYLYAFFNYYFCALIFGSIAALIVSRWSNKI 174
>gi|185178901|ref|ZP_02555053.2| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024093|ref|ZP_02569491.2| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039579|ref|ZP_02528723.2| hypothetical protein Uures_02837 [Ureaplasma urealyticum serovar 8] >gi|188518237|ref|ZP_02555909.2| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524402|ref|ZP_02558181.2| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530961|ref|ZP_02546878.2| hypothetical protein Uurese_01000005_0200002480 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867869|ref|ZP_03079868.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209159|gb|EDU06202.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019140|gb|EDU57180.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998265|gb|EDU67362.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659975|gb|EDX53355.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660446|gb|EDX53704.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (594 aa)
Score = 91, Expect = 7.9e-01, Identities = 38/122 (31%), Positives = 57/122 (46%)
  Q:    72 QPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFF-SLFANKI 193
           Q  L+L Y  +S+ LVL I I S+   + +F+   DDG E++  SK + R  I F K   L +     +L   IF+ I   + + +  D        F     C  +FGSI     S ++NKI
  S:    53 QNYLILFYVFISINLVLTI-IFSTIKAINLFKDLKDDGIEILVFSKSISRKNIIFTKIGFLVLNCVLWSLITYIFNIIFYVVNTKNNNDINLFYLYAFFNYYFCALIFGSIAALIVSRWSNKI 174
>gi|18483249|gb|AAL73984.1|AF466149_1 type IIB calcium ATPase [Medicago truncatula] (1037 aa)
Score = 91, Expect = 9.0e-01, Identities = 37/171 (21%), Positives = 80/171 (46%)
  Q:    45 KSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTI--ALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGS--------ITVFFSLFANKIISLLSTTGLVFVIIVTSILGSL 215
           +++YINI  ++   +   ++A +I      +  S P+ ++ L+ +  I+ +   + +   P +DG   +    P+ R   F  K +   IIG +I   +  AI +  G  +  I+  D  +V+  +   + +   VF          I +F  +F + I  L+  + + F +++   LG+ 
  S:   804 RAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVNLIMDTLGALALATEPPNDG---LLKRPPVGRGASFITKTMWRNIIGQSIYQLIVLAILNFDGKRLLGINGSDATEVLNTLIFNSFVFCQVFNEINSRDIEKINIFRGMFDSWIFLLIIFSTVAFQVVIVEFLGAF 981
>gi|167039018|ref|YP_001662003.1| hypothetical protein Teth514_0351 [Thermoanaerobacter sp. X514] >gi|166853258|gb|ABY91667.1| hypothetical protein Teth514_0351 [Thermoanaerobacter sp. X514] (256 aa)
Score = 91, Expect = 9.1e-01, Identities = 42/160 (26%), Positives = 79/160 (49%)
  Q:    38 FSLNFKKKSIYINIFVYILMIVACAIIAP----LIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIF-------FCKCLVLT-IIGTTIALTGAIFSSIGLTIPSIDKVDQL-----KVIGGIFIATIICFAVFGSITVFFSLFANKIISLL 197
           F  N K+K I   IF+ +L+      +A     +I  +   L  ++ +  L  ++I  ++    +       +++G+  + LSKPLHR  IF       FC CL ++ ++  +   +G +F        S+DK+  +     K +   +I   +      +IT+FFS F    IS++
  S:     9 FIKNMKRKDIQTTIFLAVLLPFLVTYLAHKKVVIISSWHSPLENTFMIAFLWGIMIFPLLIIVSSANSLSKEIENGSIKLILSKPLHRRHIFIAKLTFLFCICLGISMLVFLSSYFSGLLFYGFN-KAASVDKIGNISIPLWKSLLFTYILGFLGLLFCSTITLFFSCFFQTSISIM 184