>gi|26553551|ref|NP_757485.1| chaperonin GroES [Mycoplasma penetrans HF-2] >gi|26453557|dbj|BAC43889.1| chaperonin GroES [Mycoplasma penetrans HF-2] (90 aa)
Score = 405, Expect = 2.8e-38, Identities = 90/90 (100%), Positives = 90/90 (100%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK
  S:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
>gi|51035711|emb|CAH17463.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 198, Expect = 2.5e-14, Identities = 39/88 (44%), Positives = 64/88 (72%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+ S   V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISESCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|189011860|emb|CAQ30453.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 197, Expect = 3.6e-14, Identities = 39/88 (44%), Positives = 64/88 (72%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E+ T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEESKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|189011854|emb|CAQ30447.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 197, Expect = 3.7e-14, Identities = 39/88 (44%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVRRLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|109948170|ref|YP_665398.1| co-chaperonin GroES [Helicobacter acinonychis str. Sheeba] >gi|123066082|sp|Q17VC7|CH10_HELAH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|109715391|emb|CAK00399.1| heat-shock chaperonin GroES [Helicobacter acinonychis str. Sheeba] (118 aa)
Score = 195, Expect = 5.5e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGTEIVLDGTEYMVLELEDILGIV 89
>gi|51035727|emb|CAH17471.1| heat shock protein [Helicobacter pylori] >gi|51035729|emb|CAH17472.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 195, Expect = 5.5e-14, Identities = 39/88 (44%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035717|emb|CAH17466.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 195, Expect = 5.5e-14, Identities = 39/88 (44%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035733|emb|CAH17474.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 195, Expect = 5.5e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGTEIVLDGTEYMVLELEDILGIV 89
>gi|51035725|emb|CAH17470.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 195, Expect = 5.5e-14, Identities = 39/88 (44%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  GI+K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGIVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|189011834|emb|CAQ30432.1| heat shock protein [Helicobacter pylori] >gi|189011836|emb|CAQ30433.1| heat shock protein [Helicobacter pylori] >gi|189011842|emb|CAQ30438.1| heat shock protein [Helicobacter pylori] >gi|189011858|emb|CAQ30451.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|19338966|gb|AAL86899.1|AF479029_1 heat shock protein A subunit [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 37/88 (42%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+D+LG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGTEIVLDGTEYMVLELEDVLGIV 89
>gi|51035707|emb|CAH17461.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035681|emb|CAH17448.1| heat shock protein [Helicobacter pylori] >gi|51035683|emb|CAH17449.1| heat shock protein [Helicobacter pylori] >gi|51035715|emb|CAH17465.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035731|emb|CAH17473.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035739|emb|CAH17477.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035705|emb|CAH17460.1| heat shock protein [Helicobacter pylori] >gi|51035737|emb|CAH17476.1| heat shock protein [Helicobacter pylori] >gi|189011852|emb|CAQ30446.1| heat shock protein [Helicobacter pylori] >gi|189011856|emb|CAQ30450.1| heat shock protein [Helicobacter pylori] >gi|189011878|emb|CAQ30472.1| heat shock protein [Helicobacter pylori] >gi|189011880|emb|CAQ30474.1| heat shock protein [Helicobacter pylori] >gi|195540550|emb|CAQ30437.1| heat shock protein [Helicobacter pylori] >gi|195540552|emb|CAQ30440.1| heat shock protein [Helicobacter pylori] >gi|195540556|emb|CAQ30444.1| heat shock protein [Helicobacter pylori] >gi|195540560|emb|CAQ30449.1| heat shock protein [Helicobacter pylori] >gi|195540562|emb|CAQ30452.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035687|emb|CAH17451.1| heat shock protein [Helicobacter pylori] >gi|51035689|emb|CAH17452.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035697|emb|CAH17456.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035701|emb|CAH17458.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035735|emb|CAH17475.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035573|emb|CAH17394.1| heat shock protein [Helicobacter pylori] (129 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    12 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 100
>gi|51035561|emb|CAH17388.1| heat shock protein [Helicobacter pylori] (129 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    12 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 100
>gi|51035567|emb|CAH17391.1| heat shock protein [Helicobacter pylori] (137 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    20 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 108
>gi|51035631|emb|CAH17423.1| heat shock protein [Helicobacter pylori] (128 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    11 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 99
>gi|51035719|emb|CAH17467.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|51035559|emb|CAH17387.1| heat shock protein [Helicobacter pylori] (126 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     9 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 97
>gi|15611080|ref|NP_222731.1| co-chaperonin GroES [Helicobacter pylori J99] >gi|15644644|ref|NP_206813.1| co-chaperonin GroES [Helicobacter pylori 26695] >gi|108562436|ref|YP_626752.1| co-chaperonin GroES [Helicobacter pylori HPAG1] >gi|122980585|sp|Q1CVE4|CH10_HELPH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|60391894|sp|P0A0R3|CH10_HELPY 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein 10) >gi|60391895|sp|P0A0R4|CH10_HELPJ 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein 10) >gi|2313085|gb|AAD07081.1| co-chaperone (groES) [Helicobacter pylori 26695] >gi|4154503|gb|AAD05584.1| 10kDa chaperone [Helicobacter pylori J99] >gi|51035675|emb|CAH17445.1| heat shock protein [Helicobacter pylori] >gi|51035685|emb|CAH17450.1| heat shock protein [Helicobacter pylori] >gi|51035691|emb|CAH17453.1| heat shock protein [Helicobacter pylori] >gi|51035693|emb|CAH17454.1| heat shock protein [Helicobacter pylori] >gi|51035695|emb|CAH17455.1| heat shock protein [Helicobacter pylori] >gi|51035699|emb|CAH17457.1| heat shock protein [Helicobacter pylori] >gi|51035703|emb|CAH17459.1| heat shock protein [Helicobacter pylori] >gi|51035709|emb|CAH17462.1| heat shock protein [Helicobacter pylori] >gi|51035713|emb|CAH17464.1| heat shock protein [Helicobacter pylori] >gi|51035721|emb|CAH17468.1| heat shock protein [Helicobacter pylori] >gi|51035723|emb|CAH17469.1| heat shock protein [Helicobacter pylori] >gi|51035741|emb|CAH17478.1| heat shock protein [Helicobacter pylori] >gi|107836209|gb|ABF84078.1| cochaperone protein [Helicobacter pylori HPAG1] >gi|189011872|emb|CAQ30465.1| heat shock protein [Helicobacter pylori] >gi|189011876|emb|CAQ30469.1| heat shock protein [Helicobacter pylori] >gi|189011886|emb|CAQ30477.1| heat shock protein [Helicobacter pylori] >gi|195540576|emb|CAQ30466.1| heat shock protein [Helicobacter pylori] >gi|195540578|emb|CAQ30468.1| heat shock protein [Helicobacter pylori] >gi|195540580|emb|CAQ30470.1| heat shock protein [Helicobacter pylori] >gi|195540582|emb|CAQ30471.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 194, Expect = 8.4e-14, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|712830|gb|AAC41440.1| heat shock protein (118 aa)
Score = 192, Expect = 1.3e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 89
>gi|51035677|emb|CAH17446.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 192, Expect = 1.3e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 89
>gi|51035679|emb|CAH17447.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 192, Expect = 1.3e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 89
>gi|51035635|emb|CAH17425.1| heat shock protein [Helicobacter pylori] (128 aa)
Score = 192, Expect = 1.5e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    11 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGTEIVLDGIEYMVLELEDILGIV 99
>gi|51035563|emb|CAH17389.1| heat shock protein [Helicobacter pylori] >gi|51035565|emb|CAH17390.1| heat shock protein [Helicobacter pylori] (129 aa)
Score = 191, Expect = 1.5e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    12 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGIEYMVLELEDILGIV 100
>gi|51035637|emb|CAH17426.1| heat shock protein [Helicobacter pylori] (128 aa)
Score = 191, Expect = 1.6e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    11 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGTEIVLDGIEYMVLELEDILGIV 99
>gi|51035633|emb|CAH17424.1| heat shock protein [Helicobacter pylori] (128 aa)
Score = 191, Expect = 1.6e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    11 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 99
>gi|51035601|emb|CAH17408.1| heat shock protein [Helicobacter pylori] (128 aa)
Score = 191, Expect = 1.7e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    11 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 99
>gi|32266699|ref|NP_860731.1| co-chaperonin GroES [Helicobacter hepaticus ATCC 51449] >gi|60389728|sp|Q7U318|CH10_HELHP 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|32262750|gb|AAP77797.1| chaperone protein HspA (GroES/HSP10 family) [Helicobacter hepaticus ATCC 51449] (90 aa)
Score = 191, Expect = 1.9e-13, Identities = 43/90 (47%), Positives = 68/90 (75%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+FRPLG+RVL++R E +T T +GI++P+ N  +KP  GI+K++S++I +   L     V F +YK  +IK+D++E++V+ELDDILGV+ K
  S:     1 MKFRPLGERVLVERVEEDTKTSSGIIIPD-NAKEKPLMGIVKAVSAKIKDDKILKENDKVVFGKYKGAEIKLDSKEFIVLELDDILGVIEK 90
>gi|189011884|emb|CAQ30476.1| heat shock protein [Helicobacter pylori] >gi|195540566|emb|CAQ30457.1| heat shock protein [Helicobacter pylori] >gi|195540568|emb|CAQ30458.1| heat shock protein [Helicobacter pylori] >gi|195540570|emb|CAQ30459.1| heat shock protein [Helicobacter pylori] >gi|195540572|emb|CAQ30460.1| heat shock protein [Helicobacter pylori] >gi|195540574|emb|CAQ30461.1| heat shock protein [Helicobacter pylori] (117 aa)
Score = 189, Expect = 2.6e-13, Identities = 38/87 (43%), Positives = 62/87 (71%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 KFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 88
>gi|189011882|emb|CAQ30475.1| heat shock protein [Helicobacter pylori] >gi|195540564|emb|CAQ30456.1| heat shock protein [Helicobacter pylori] (120 aa)
Score = 189, Expect = 2.6e-13, Identities = 38/87 (43%), Positives = 62/87 (71%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 KFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 88
>gi|51035569|emb|CAH17392.1| heat shock protein [Helicobacter pylori] (121 aa)
Score = 189, Expect = 2.8e-13, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:    12 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 100
>gi|51035571|emb|CAH17393.1| heat shock protein [Helicobacter pylori] (123 aa)
Score = 189, Expect = 2.8e-13, Identities = 37/88 (42%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  +Y+V+EL+DILG++
  S:     6 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTKYMVLELEDILGIV 94
>gi|189011864|emb|CAQ30455.1| heat shock protein [Helicobacter pylori] (117 aa)
Score = 189, Expect = 3.0e-13, Identities = 38/88 (43%), Positives = 62/88 (70%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E+ T +GI++P+ N  +KP  G+IK++S   +     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEESKTSSGIIIPD-NAKEKPLMGVIKAVSHRSSEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|188526821|ref|YP_001909508.1| co-chaperonin GroES [Helicobacter pylori Shi470] >gi|188143061|gb|ACD47478.1| co-chaperonin GroES [Helicobacter pylori Shi470] (118 aa)
Score = 189, Expect = 3.2e-13, Identities = 38/88 (43%), Positives = 62/88 (70%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K +S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKVVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 89
>gi|31580719|gb|AAP51175.1| heat shock protein A [Helicobacter pylori] (118 aa)
Score = 189, Expect = 3.2e-13, Identities = 38/88 (43%), Positives = 62/88 (70%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFLPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 89
>gi|195540558|emb|CAQ30448.1| heat shock protein [Helicobacter pylori] (116 aa)
Score = 189, Expect = 3.3e-13, Identities = 38/86 (44%), Positives = 61/86 (70%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           F+PLG+RVL++R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 FQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 87
>gi|189011866|emb|CAQ30462.1| heat shock protein [Helicobacter pylori] >gi|189011868|emb|CAQ30463.1| heat shock protein [Helicobacter pylori] (117 aa)
Score = 188, Expect = 4.0e-13, Identities = 37/87 (42%), Positives = 62/87 (71%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 KFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 88
>gi|189011870|emb|CAQ30464.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 188, Expect = 4.3e-13, Identities = 37/88 (42%), Positives = 62/88 (70%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+    +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPDKAK-EKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|77543435|gb|ABA87131.1| heat shock protein A [Helicobacter pylori] (117 aa)
Score = 186, Expect = 6.3e-13, Identities = 37/87 (42%), Positives = 62/87 (71%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 KFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIV 88
>gi|189011874|emb|CAQ30467.1| heat shock protein [Helicobacter pylori] (118 aa)
Score = 186, Expect = 6.9e-13, Identities = 37/88 (42%), Positives = 62/88 (70%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+D LG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDNLGIV 89
>gi|57168105|ref|ZP_00367244.1| chaperonin, 10 kDa [Campylobacter coli RM2228] >gi|57020479|gb|EAL57148.1| chaperonin, 10 kDa [Campylobacter coli RM2228] (86 aa)
Score = 185, Expect = 8.8e-13, Identities = 42/88 (47%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KP  G + ++S EI  +++  G  + F +Y   +IK+DN EYLV+ LDDILG+L
  S:     1 MNFQPLGKRVLVKRVEETKTTASGIIIPD-NAKEKPLMGEVVAVSKEI--TDIANGDKIVFAKYGGTEIKIDNSEYLVLNLDDILGIL 85
>gi|153952133|ref|YP_001397689.1| co-chaperonin GroES [Campylobacter jejuni subsp. doylei 269.97] >gi|166233991|sp|A7H2F9|CH10_CAMJD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|107784846|gb|ABF83914.1| 10 kDa chaperonin [Campylobacter jejuni subsp. doylei] >gi|152939579|gb|ABS44320.1| chaperonin GroES [Campylobacter jejuni subsp. doylei 269.97] (86 aa)
Score = 184, Expect = 1.0e-12, Identities = 42/88 (47%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KP  G + ++S EI  +++  G  + F +Y   +IK+DN EYLV+ LDDILG+L
  S:     1 MNFQPLGKRVLVKRVEETKTTASGIIIPD-NAKEKPLMGEVVAVSKEI--TDIANGDKIMFAKYGGTEIKLDNNEYLVLNLDDILGIL 85
>gi|86151001|ref|ZP_01069217.1| chaperonin GroES [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842171|gb|EAQ59417.1| chaperonin GroES [Campylobacter jejuni subsp. jejuni 260.94] (86 aa)
Score = 184, Expect = 1.2e-12, Identities = 42/88 (47%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KP  G + ++S EI  +++  G  + F +Y   +IK+DN EYLV+ LDDILG+L
  S:     1 MNFQPLGKRVLVKRVEETKTTASGIIIPD-NAKEKPLMGEVVAVSKEI--TDIANGDKIVFAKYGGTEIKLDNSEYLVLNLDDILGIL 85
>gi|15792544|ref|NP_282367.1| co-chaperonin GroES [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57238092|ref|YP_179342.1| co-chaperonin GroES [Campylobacter jejuni RM1221] >gi|86152698|ref|ZP_01070903.1| chaperonin, 10 kDa [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596158|ref|ZP_01099395.1| chaperonin GroES [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612930|ref|YP_001000894.1| co-chaperonin GroES [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926220|ref|ZP_01809905.1| 10 kD chaperonin (cpn10) [Campylobacter jejuni subsp. jejuni CG8486] >gi|157415483|ref|YP_001482739.1| co-chaperonin GroES [Campylobacter jejuni subsp. jejuni 81116] >gi|167005806|ref|ZP_02271564.1| cpn10; 10 kDa chaperonin [Campylobacter jejuni subsp. jejuni 81-176] >gi|166233992|sp|A1W0K3|CH10_CAMJJ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|172047163|sp|A8FMS5|CH10_CAMJ8 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|9296952|sp|P56970|CH10_CAMJE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|81819501|sp|Q5HTP3|CH10_CAMJR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|3063760|emb|CAA73777.1| heat shock protein [Campylobacter jejuni] >gi|57166896|gb|AAW35675.1| chaperonin GroES [Campylobacter jejuni RM1221] >gi|85843583|gb|EAQ60793.1| chaperonin, 10 kDa [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88190999|gb|EAQ94971.1| chaperonin GroES [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360538|emb|CAL35335.1| 10 kD chaperonin (cpn10) [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|121504210|gb|EAQ72237.2| chaperonin GroES [Campylobacter jejuni subsp. jejuni 81-176] >gi|145845391|gb|EDK22484.1| 10 kD chaperonin (cpn10) [Campylobacter jejuni subsp. jejuni CG8486] >gi|157386447|gb|ABV52762.1| cpn10; 10 kDa chaperonin [Campylobacter jejuni subsp. jejuni 81116] (86 aa)
Score = 183, Expect = 1.4e-12, Identities = 42/88 (47%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KP  G + ++S EI  +++  G  + F +Y   +IK+DN EYLV+ LDDILG+L
  S:     1 MNFQPLGKRVLVKRVEETKTTASGIIIPD-NAKEKPLMGEVVAVSKEI--TDIANGDKIVFAKYGGTEIKLDNNEYLVLNLDDILGIL 85
>gi|189011844|emb|CAQ30439.1| heat shock protein [Helicobacter pylori] (89 aa)
Score = 179, Expect = 4.8e-12, Identities = 38/88 (43%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+RVL++R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 MKFQPLGERVLVERLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 89
>gi|57242680|ref|ZP_00370617.1| chaperonin, 10 kDa [Campylobacter upsaliensis RM3195] >gi|57016609|gb|EAL53393.1| chaperonin, 10 kDa [Campylobacter upsaliensis RM3195] (97 aa)
Score = 173, Expect = 2.0e-11, Identities = 38/88 (43%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KP  G + ++S E+  S++  G  + F +Y   ++K+++ EYLV+ LDD+LG+L
  S:    12 MNFQPLGKRVLVKRVEETKTTASGIIIPD-NAKEKPLIGEVVAVSKEV--SDIASGDKIVFAKYGGTEVKLNDGEYLVLNLDDVLGIL 96
>gi|152993542|ref|YP_001359263.1| co-chaperonin GroES [Sulfurovum sp. NBC37-1] >gi|166198418|sp|A6QBP7|CH10_SULNB 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|151425403|dbj|BAF72906.1| co-chaperonin GroES [Sulfurovum sp. NBC37-1] (86 aa)
Score = 170, Expect = 5.3e-11, Identities = 37/88 (42%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLG R+L++R E   TT +GI++P+ N  +KPS G + ++ SE+ + N  V  TV F +Y  N+I +D +E+L++E  DI G+L
  S:     1 MNFKPLGDRLLIQRVEEANTTASGIIIPD-NAKEKPSKGKVIAVGSEVEDIN--VDDTVVFGKYSGNEIILDGEEFLIMESSDIFGIL 85
>gi|57240445|ref|ZP_00368394.1| chaperonin, 10 kDa [Campylobacter lari RM2100] >gi|57018786|gb|EAL55559.1| chaperonin, 10 kDa [Campylobacter lari RM2100] (86 aa)
Score = 169, Expect = 6.1e-11, Identities = 38/88 (43%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKR+L+KR E   TT +GI++P+ N  +KP  G + ++S EI   ++ V   V F +Y   +IK+DN+EYLV+ ++D+LG++
  S:     1 MNFQPLGKRILVKRLEEMKTTASGIIIPD-NAKEKPLNGEVAAVSKEI--EDVKVNDKVMFAKYGGTEIKLDNEEYLVLNIEDVLGII 85
>gi|118475328|ref|YP_891875.1| co-chaperonin GroES [Campylobacter fetus subsp. fetus 82-40] >gi|166233989|sp|A0RNU2|CH10_CAMFF 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|118414554|gb|ABK82974.1| chaperonin GroS [Campylobacter fetus subsp. fetus 82-40] (87 aa)
Score = 168, Expect = 7.4e-11, Identities = 37/88 (42%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F PLGKRVL++R E   TT +GI++P++   +KPS G + + S E     ++VG  V F +Y  ++I +++++YLV+ L+DILGV+
  S:     1 MKFEPLGKRVLVEREEEVKTTASGIIIPDNASKEKPSKGKVVAASKEA--EGVSVGDIVVFAKYAGSEISLEDKKYLVLNLEDILGVI 86
>gi|34556745|ref|NP_906560.1| co-chaperonin GroES [Wolinella succinogenes DSM 1740] >gi|60389701|sp|Q7MAE2|CH10_WOLSU 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|34482459|emb|CAE09460.1| HEAT SHOCK PROTEIN GROES [Wolinella succinogenes] (89 aa)
Score = 167, Expect = 1.0e-10, Identities = 34/88 (38%), Positives = 61/88 (69%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLG+RVL++R E +T T +GI++P+ N  +KP  G +K++S E+     L  G+ V F +Y    +K++ +EYL+++++D+LG +
  S:     1 MNFKPLGQRVLVERLEEDTKTASGIIIPD-NAKEKPLMGTVKALSEEVAKEGLLKAGSQVVFAKYSGTDVKLEGKEYLILKVEDLLGTI 88
>gi|78776831|ref|YP_393146.1| co-chaperonin GroES [Sulfurimonas denitrificans DSM 1251] >gi|123768649|sp|Q30SX0|CH10_THIDN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|78497371|gb|ABB43911.1| Chaperonin Cpn10 [Sulfurimonas denitrificans DSM 1251] (86 aa)
Score = 166, Expect = 1.3e-10, Identities = 33/88 (37%), Positives = 60/88 (68%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL+KR E   TT +GI++P+ N  +KPS G + ++SSE+    +  G  V F ++  +++ +D +++L+++ +DI G++
  S:     1 MNFQPLGKRVLVKRVEEANTTASGIIIPD-NAQEKPSRGEVVAVSSEVK--EMLCGDKVLFGKFSGSEVTLDGEKFLIIDSEDIFGII 85
>gi|157165660|ref|YP_001466609.1| co-chaperonin GroES [Campylobacter concisus 13826] >gi|166233987|sp|A7ZCV1|CH10_CAMC1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|112800723|gb|EAT98067.1| chaperonin GroS [Campylobacter concisus 13826] (86 aa)
Score = 166, Expect = 1.5e-10, Identities = 37/88 (42%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL++R E   TT +GI++P+ N  +KP  G +K++ +E     + VG  V F +Y   ++ +D++ YLV+ +DDILGV+
  S:     1 MNFQPLGKRVLVERVEETKTTASGIIIPD-NAKEKPLSGEVKAVGAEA--EGVKVGEKVVFAKYAGTEVNLDDKTYLVLNIDDILGVI 85
>gi|118595282|ref|ZP_01552629.1| chaperonins cpn10 (10 kDa subunit) [Methylophilales bacterium HTCC2181] >gi|118441060|gb|EAV47687.1| chaperonins cpn10 (10 kDa subunit) [Methylophilales bacterium HTCC2181] (96 aa)
Score = 163, Expect = 2.9e-10, Identities = 38/88 (43%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E TT +GIV+P S  A+KP  G I++I +        I   ++ VG  V F +Y    +KVD  E LV+  +DI+G++
  S:     1 MKIRPLHDRVIVKRLEEERTTASGIVIPESASAEKPDQGTIEAIGNGKVLEDGSIRALDVKVGDKVLFGKYAGQAVKVDGDELLVMREEDIMGIV 95
>gi|154173727|ref|YP_001408486.1| co-chaperonin GroES [Campylobacter curvus 525.92] >gi|166233988|sp|A7GZ44|CH10_CAMC5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|112802725|gb|EAU00069.1| chaperonin GroS [Campylobacter curvus 525.92] (86 aa)
Score = 162, Expect = 3.9e-10, Identities = 36/88 (40%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLGKRVL++R E   TT +GI++P+ N  +KP  G +K++  E+    +  G  V F +Y   +I +D++ YLV+ +DD+LGV+
  S:     1 MNFQPLGKRVLVERVEETKTTASGIIIPD-NAKEKPLSGEVKAVGPEV--EGVKTGDKVVFAKYGGTEINLDDKTYLVLNIDDVLGVI 85
>gi|94264997|ref|ZP_01288767.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1] >gi|94267187|ref|ZP_01290803.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1] >gi|93452096|gb|EAT02776.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1] >gi|93454544|gb|EAT04825.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1] (96 aa)
Score = 162, Expect = 4.2e-10, Identities = 37/90 (41%), Positives = 60/90 (66%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  R+L+KR E E  TK GI++P+S   +KP+ G ++++ +  +N         L VG  V F +Y   ++K+D +EYL++  DD+LGV+ K
  S:     1 MKIRPLNDRILVKRLEEEEKTKGGIIIPDSAK-EKPAEGTVEAVGNGRHNDKGERMPVELKVGDRVLFSKYGGTEVKIDGEEYLIMREDDVLGVVEK 96
>gi|157736692|ref|YP_001489375.1| 10 kDa chaperonin [Arcobacter butzleri RM4018] >gi|157698546|gb|ABV66706.1| 10 kDa chaperonin [Arcobacter butzleri RM4018] (85 aa)
Score = 161, Expect = 6.0e-10, Identities = 32/88 (36%), Positives = 63/88 (71%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLG+RVL+KR+EVE  T +GI +P+ N  +KP    + +I +++   ++ VG T+ F++Y+  + K++ +EYL++ +++++GV+
  S:     1 MNFKPLGERVLVKRTEVENKTASGIYIPD-NAKEKPQTAKVVAIGNKV--EDVKVGDTIVFEQYRGTEFKLEGEEYLILNIENVIGVM 85
>gi|154149215|ref|YP_001406155.1| co-chaperonin GroES [Campylobacter hominis ATCC BAA-381] >gi|166233990|sp|A7I0W4|CH10_CAMHC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|153805224|gb|ABS52231.1| chaperonin GroS [Campylobacter hominis ATCC BAA-381] (87 aa)
Score = 160, Expect = 7.2e-10, Identities = 31/88 (35%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLGKRVL++R E    T +GI++P++   +KPS G I  + +E +   +  G  V F +Y  +++ + +++YL++ L+D+LG++
  S:     1 MKFQPLGKRVLIEREEESNKTASGIIIPDNASKEKPSTGKIVEVGTECD--CVKAGDKVAFAKYSGSELTLGDKKYLILNLEDVLGII 86
>gi|53720527|ref|YP_109513.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243] >gi|53725721|ref|YP_103981.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344] >gi|67643519|ref|ZP_00442264.1| COG0234: Co-chaperonin GroES (HSP10) [Burkholderia mallei GB8 horse 4] >gi|121599729|ref|YP_991695.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1] >gi|124385950|ref|YP_001027190.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229] >gi|126448232|ref|YP_001082142.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247] >gi|166998507|ref|ZP_02264365.1| chaperonin, 10 kDa [Burkholderia mallei PRL-20] >gi|167740175|ref|ZP_02412949.1| chaperonin, 10 kDa [Burkholderia pseudomallei 14] >gi|167817390|ref|ZP_02449070.1| chaperonin, 10 kDa [Burkholderia pseudomallei 91] >gi|167912517|ref|ZP_02499608.1| chaperonin, 10 kDa [Burkholderia pseudomallei 112] >gi|194318285|ref|YP_002014057.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399] >gi|194505319|ref|YP_002034890.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] >gi|194522933|ref|YP_002058466.1| chaperonin, 10 kDa [Burkholderia mallei FMH] >gi|194527920|ref|YP_002063443.1| chaperonin, 10 kDa [Burkholderia mallei JHU] >gi|52210941|emb|CAH36929.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243] >gi|52429144|gb|AAU49737.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344] >gi|121228539|gb|ABM51057.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1] >gi|124293970|gb|ABN03239.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229] >gi|126241102|gb|ABO04195.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247] >gi|147746943|gb|EDK54020.1| chaperonin, 10 kDa [Burkholderia mallei FMH] >gi|147751930|gb|EDK58997.1| chaperonin, 10 kDa [Burkholderia mallei JHU] >gi|160694898|gb|EDP84906.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399] >gi|184211206|gb|EDU08249.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] (105 aa)
Score = 160, Expect = 7.5e-10, Identities = 39/88 (44%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E + TT +GIV+P+S  A+KP  G I ++ +        +    L VG  V F EY    IKVD +++LV+  +D+LGVL
  S:     1 MHVRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEIVALGNGRLLQDGTLRALQLEVGDQVIFGEYAGQSIKVDGEDFLVIREEDVLGVL 94
>gi|115522887|ref|YP_779798.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53] >gi|115516834|gb|ABJ04818.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53] (98 aa)
Score = 158, Expect = 1.0e-09, Identities = 38/86 (44%), Positives = 58/86 (67%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RVL+KR + ET TK GI++P+S   +KPS G I ++       + ++   +L VG  V F ++   +IK+D QE L+++  DI+GVL
  S:     6 FRPLHDRVLVKRVDAETKTKGGIIIPDSAK-EKPSQGEIVAVGPGGRDEAGKLLPIDLKVGDRVLFGKWSGTEIKLDGQELLIMKESDIMGVL 97
>gi|167895868|ref|ZP_02483270.1| chaperonin, 10 kDa [Burkholderia pseudomallei 7894] >gi|167920468|ref|ZP_02507559.1| chaperonin, 10 kDa [Burkholderia pseudomallei BCC215] (105 aa)
Score = 158, Expect = 1.1e-09, Identities = 39/88 (44%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E + TT +GIV+P+S  A+KP  G I ++ +        +    L VG  V F EY    IKVD +++LV+  +D+LGVL
  S:     1 MHVRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEIVALGNGRLLQDGTLRALQLEVGDQVIFGEYAGQSIKVDGEDFLVMREEDVLGVL 94
>gi|152990259|ref|YP_001355981.1| co-chaperonin GroES [Nitratiruptor sp. SB155-2] >gi|151422120|dbj|BAF69624.1| co-chaperonin GroES [Nitratiruptor sp. SB155-2] (95 aa)
Score = 157, Expect = 1.4e-09, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PLG RVL++R +    T +GI++P+ N  +KP  G + +I  E+    ++ VG  V F +Y    I +D +EYL+++ DDILG+L
  S:     7 MNFQPLGNRVLVERVDEPEKTPSGIIIPD-NAKEKPLEGNVLAIGPEVEEEGHIKVGDRVVFAKYSGTDITLDGKEYLILQTDDILGIL 94
>gi|71906065|ref|YP_283652.1| co-chaperonin GroES [Dechloromonas aromatica RCB] >gi|123733379|sp|Q47IZ9|CH10_DECAR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|71845686|gb|AAZ45182.1| Chaperonin Cpn10 [Dechloromonas aromatica RCB] (96 aa)
Score = 155, Expect = 2.4e-09, Identities = 38/88 (43%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E TT +GIV+P+S   +KP  G + ++     + N       + VG  V F +Y    +KVD QE LV+  +DI+GVL
  S:     1 MNIRPLHDRVIVKRVEAERTTASGIVIPDSA-GEKPDQGEVLAVGPGKRDDNGKQIALDVKVGDRVLFGKYAGQAVKVDGQEVLVMREEDIMGVL 94
>gi|119898656|ref|YP_933869.1| chaperonin GroES [Azoarcus sp. BH72] >gi|119671069|emb|CAL94982.1| chaperonin GroES [Azoarcus sp. BH72] (95 aa)
Score = 155, Expect = 2.5e-09, Identities = 37/88 (42%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E TT TGIV+P+S   +KP  G + ++       + E+    L  G  V F +Y    +K+D +E LVV  +DI GV+
  S:     1 MAIRPLHDRVIVKRLEAERTTATGIVIPDSA-GEKPDQGEVIAVGRGKILDNGELRAPQLKAGDRVLFGKYAGQAVKIDGEEVLVVREEDIFGVI 94
>gi|29655008|ref|NP_820700.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 493] >gi|153209038|ref|ZP_01947217.1| 10 kDa chaperonin GroS [Coxiella burnetii 'MSU Goat Q177'] >gi|154706333|ref|YP_001423709.1| co-chaperonin GroES [Coxiella burnetii Dugway 5J108-111] >gi|161831078|ref|YP_001597542.1| co-chaperonin GroES [Coxiella burnetii RSA 331] >gi|165924023|ref|ZP_02219855.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 334] >gi|189044100|sp|A9KC14|CH10_COXBN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|189044101|sp|A9NA83|CH10_COXBR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|116194|sp|P19422|CH10_COXBU 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein A) >gi|144997|gb|AAA23308.1| heat shock protein A (htpA) >gi|29542277|gb|AAO91214.1| chaperonin, 10 kDa [Coxiella burnetii RSA 493] >gi|120575520|gb|EAX32144.1| 10 kDa chaperonin GroS [Coxiella burnetii 'MSU Goat Q177'] >gi|154355619|gb|ABS77081.1| 10 kDa chaperonin GroS [Coxiella burnetii Dugway 5J108-111] >gi|161762945|gb|ABX78587.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 331] >gi|165916527|gb|EDR35131.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 334] (96 aa)
Score = 154, Expect = 3.1e-09, Identities = 36/90 (40%), Positives = 60/90 (66%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R E E T+  GIV+P+S  A+KPS G + S+       + E+ + ++ VG  + F +Y   ++K+   EY+V+  DDI+GV+ K
  S:     1 MKIRPLHDRVVVRRLEEERTSAGGIVIPDSA-AEKPSRGEVISVGPGKPLDNGEVRSLDVKVGDQILFGKYAGTEVKLAGDEYIVMREDDIMGVIEK 96
>gi|95930573|ref|ZP_01313308.1| chaperonin Cpn10 [Desulfuromonas acetoxidans DSM 684] >gi|95133408|gb|EAT15072.1| chaperonin Cpn10 [Desulfuromonas acetoxidans DSM 684] (97 aa)
Score = 154, Expect = 3.2e-09, Identities = 36/90 (40%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  R++++  E ETTT  GI++P++   +KP  G+I        +   ++   ++ VG  V F +Y   +IKVD + YL++  DDILGVL K
  S:     1 MNIRPLQDRLIVECVEEETTTAGGIIIPDTASKEKPQEGVIIAAGKGKVTAEGKVLGMDVQVGDRVLFGKYAGTEIKVDGKAYLMMREDDILGVLEK 97
>gi|76810985|ref|YP_334800.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b] >gi|126438432|ref|YP_001060402.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668] >gi|126453076|ref|YP_001067662.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a] >gi|134280125|ref|ZP_01766836.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|161360686|ref|ZP_02106548.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b] >gi|161373505|ref|ZP_02113060.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a] >gi|167721203|ref|ZP_02404439.1| chaperonin, 10 kDa [Burkholderia pseudomallei DM98] >gi|167825796|ref|ZP_02457267.1| chaperonin, 10 kDa [Burkholderia pseudomallei 9] >gi|167847280|ref|ZP_02472788.1| chaperonin, 10 kDa [Burkholderia pseudomallei B7210] >gi|167904256|ref|ZP_02491461.1| chaperonin, 10 kDa [Burkholderia pseudomallei NCTC 13177] >gi|194508080|ref|YP_002020615.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] >gi|194520532|ref|YP_002055973.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] >gi|76580438|gb|ABA49913.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b] >gi|126217925|gb|ABN81431.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668] >gi|126226718|gb|ABN90258.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a] >gi|134248132|gb|EBA48215.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|157938575|gb|EDO94245.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] >gi|169656956|gb|EDS88353.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] (105 aa)
Score = 154, Expect = 3.5e-09, Identities = 38/88 (43%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E + TT +GIV+P+S  A+KP  G I ++ +        +    L VG  V F +Y    IKVD +++LV+  +D+LGVL
  S:     1 MHVRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEIVALGNGRLLQDGTLRALQLKVGDQVIFGKYAGQSIKVDGEDFLVMREEDVLGVL 94
>gi|194569544|ref|YP_002104547.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] >gi|157809127|gb|EDO86297.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] (105 aa)
Score = 154, Expect = 3.6e-09, Identities = 38/88 (43%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E + TT +GIV+P+S  A+KP  G I ++ +        +    L VG  V F +Y    IKVD +++LV+  +D+LGVL
  S:     1 MHVRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEIVALGNGRLLQDGTLRALQLEVGDQVIFGKYAGQSIKVDGEDFLVMREEDVLGVL 94
>gi|196184301|gb|EDX79277.1| chaperonin GroS [Brevundimonas sp. BAL3] (95 aa)
Score = 153, Expect = 4.0e-09, Identities = 34/88 (38%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPLG RVL+KR E E+ TK GI++P++   +KP  G + S+       S ++N   L  G  + F ++   ++K+D  + ++++  D+LGVL
  S:     1 MAFRPLGDRVLVKRVEEESKTKGGIIIPDTAK-EKPQEGEVVSVGPGVRDESGKVNALELKAGDRILFGKWSGTEVKIDGDDLIIMKESDVLGVL 94
>gi|90424662|ref|YP_533032.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB18] >gi|90106676|gb|ABD88713.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB18] (105 aa)
Score = 153, Expect = 4.2e-09, Identities = 37/88 (42%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P+S   +KPS G I S+       S ++   +L VG  V F ++   ++K+D QE L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEILSVGPGGRDESGKLIPIDLAVGDRVLFGKWSGTEVKLDGQEVLIMKESDIMGVL 94
>gi|77920361|ref|YP_358176.1| 10 Kd chaperone GroES [Pelobacter carbinolicus DSM 2380] >gi|123729386|sp|Q3A0V1|CH10_PELCD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|77546444|gb|ABA90006.1| 10 Kd chaperone GroES [Pelobacter carbinolicus DSM 2380] (95 aa)
Score = 153, Expect = 4.2e-09, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R++++R E ETTT  G+++P+S   +KP  GI+K++          +   ++ VG  V F +Y  ++IK+D  EY ++  DDILGVL
  S:     1 MNIRPLRDRIIVERIEEETTTAGGLIIPDSAK-EKPQQGIVKAVGKGKVLEDGTVLPMDIKVGDRVLFGKYAGSEIKIDGLEYQIMREDDILGVL 94
>gi|158520566|ref|YP_001528436.1| chaperonin Cpn10 [Desulfococcus oleovorans Hxd3] >gi|158509392|gb|ABW66359.1| chaperonin Cpn10 [Desulfococcus oleovorans Hxd3] (95 aa)
Score = 153, Expect = 4.5e-09, Identities = 36/88 (40%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  R+L+KR E ET TK GI++P++   +KP  G + ++ +       ++    +  G  V F +Y   ++K+D QEYL++  DDILG+L
  S:     1 MKFRPLHDRILVKRVEEETKTKGGIIIPDTAK-EKPIEGKVMAVGNGRLGEDGKLIPLEVKKGDRVLFGKYGGTEVKMDGQEYLIMREDDILGIL 94
>gi|16124939|ref|NP_419503.1| co-chaperonin GroES [Caulobacter crescentus CB15] >gi|13637896|sp|P48222|CH10_CAUCR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|13421907|gb|AAK22671.1| chaperonin, 10 kDa [Caulobacter crescentus CB15] (96 aa)
Score = 153, Expect = 4.5e-09, Identities = 34/88 (38%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPLG RVL+KR E ET TK GI++P++   +KP  G + ++     N        ++  G  + F ++   ++KVD Q+ L+++  D+LGV+
  S:     1 MKFRPLGDRVLVKRVEEETKTKGGIIIPDTAK-EKPQEGEVVAVGPGARNDKGDVVALDVKAGDRILFGKWSGTEVKVDGQDLLIMKESDVLGVV 94
>gi|120609640|ref|YP_969318.1| chaperonin Cpn10 [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166233973|sp|A1TKQ6|CH10_ACIAC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|120588104|gb|ABM31544.1| chaperonin Cpn10 [Acidovorax avenae subsp. citrulli AAC00-1] (96 aa)
Score = 151, Expect = 7.2e-09, Identities = 38/90 (42%), Positives = 58/90 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ETTT +GIV+P+ N A+KP  G++       K+   E++  ++ VG  V F +Y    +KV+  E LV++ DD+  V+ K
  S:     1 MSLRPLHDRVIVKRIESETTTASGIVIPD-NAAEKPDQGVVLAVGPGKKNDKGELSVLSVKVGDRVLFGKYSGQTVKVNGDELLVMKEDDLFAVVEK 96
>gi|87121880|ref|ZP_01077766.1| putative Chaperonin [Marinomonas sp. MED121] >gi|86162909|gb|EAQ64188.1| putative Chaperonin [Marinomonas sp. MED121] (95 aa)
Score = 151, Expect = 7.4e-09, Identities = 36/88 (40%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R E ETTT +GIVLP S   +KP+ G I ++ +       E+    ++VG TV F +Y    IK+D +E L+++ ++I G++
  S:     1 MNIRPLHDRVVVRRKEEETTTASGIVLPGSA-TEKPTQGEIVAVGTGRIQANGEVAALAVSVGETVVFGQYSGQTIKLDGEELLIMKEEEIYGII 94
>gi|149194850|ref|ZP_01871944.1| co-chaperonin GroES [Caminibacter mediatlanticus TB-2] >gi|149135009|gb|EDM23491.1| co-chaperonin GroES [Caminibacter mediatlanticus TB-2] (91 aa)
Score = 151, Expect = 8.0e-09, Identities = 38/88 (43%), Positives = 56/88 (63%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEIN---NSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           F+PLG+RVL++R E E  T +GI++P+ N  +KP  G + +IS E+    N  +  G  V F +Y    I ++ +EYLV+  DDILG L K
  S:     2 FKPLGQRVLVERLEEEAKTASGIIIPD-NAKEKPLEGKVIAISKEVEEDENMPIKEGDIVVFAKYAGTDITIEGKEYLVLNTDDILGKLEK 91
>gi|94500715|ref|ZP_01307244.1| Co-chaperonin GroES (HSP10) [Oceanobacter sp. RED65] >gi|94427037|gb|EAT12018.1| Co-chaperonin GroES (HSP10) [Oceanobacter sp. RED65] (95 aa)
Score = 151, Expect = 8.6e-09, Identities = 35/88 (39%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R++++R E ET T  GIVLP +  A+KP+ G + ++ S       E+    +  G TV F +Y AN +K+D +E L++   D+LG++
  S:     1 MKIRPLHDRIVVRRKEEETKTAGGIVLPGAA-AEKPNQGEVVAVGSGRILQNGEVQPLAVKEGDTVLFGQYGANTVKIDGEELLIMNESDVLGII 94
>gi|167587511|ref|ZP_02379899.1| chaperonin Cpn10 [Burkholderia ubonensis Bu] (105 aa)
Score = 150, Expect = 9.3e-09, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E++ TT +GIV+P+S  A+KP  G + ++ S        +    L VG  V F +Y    +KV+ +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEMQRTTASGIVIPDSA-AEKPEQGEVVAVGSGRLLQDGTLRALQLKVGDQVLFGKYAGQTVKVNGEELLVMREEDVMGVL 94
>gi|15895961|ref|NP_349310.1| Co-chaperonin GroES [Clostridium acetobutylicum ATCC 824] >gi|231746|sp|P30719|CH10_CLOAB 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|15025737|gb|AAK80650.1|AE007768_4 Co-chaperonin GroES, HSP10 family [Clostridium acetobutylicum ATCC 824] >gi|144826|gb|AAA23242.1| groES (95 aa)
Score = 150, Expect = 9.3e-09, Identities = 40/88 (45%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-------IIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPLG RV++KR E E TTK+GIVLP+S   +KP                 EI    +  G  V+F +Y   +IKVDN+E L++  DDILG++
  S:     1 MKIRPLGDRVVIKRLEAEETTKSGIVLPSSAK-EKPQMAEVVAVGPGGVVDGKEI-QMQVKTGDKVFFSKYSGTEIKVDNEELLILRQDDILGIV 93
>gi|172065374|ref|YP_001816086.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] >gi|171997616|gb|ACB68533.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] (105 aa)
Score = 150, Expect = 9.7e-09, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ S        ++   + VG  V F +Y    +KVD  E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIETQRTTASGIVIPDSA-AEKPEQGEVVAVGSGRLLQDGTLHALQVKVGDQVLFGKYAGQTVKVDGDELLVMREEDVMGVL 94
>gi|169837922|ref|ZP_02871110.1| chaperonin Cpn10 [candidate division TM7 single-cell isolate TM7a] (87 aa)
Score = 150, Expect = 1.1e-08, Identities = 32/88 (36%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG+RVL+K++E E  TK+GIVLP +   +KP  G + +I +++   ++ VG  V F++Y   ++K  ++ YL++E D++L ++
  S:     1 MIIKPLGERVLIKQTEQEEVTKSGIVLPGTASKEKPIIGEVLAIGAKV--EDIKVGNKVIFEKYSGTEVKDGDESYLILEKDNVLAIV 86
>gi|167648110|ref|YP_001685773.1| co-chaperonin GroES [Caulobacter sp. K31] >gi|189044096|sp|B0SXR3|CH10_CAUSK 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|167350540|gb|ABZ73275.1| chaperonin Cpn10 [Caulobacter sp. K31] (96 aa)
Score = 149, Expect = 1.1e-08, Identities = 33/88 (37%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPLG RVL+KR E ET TK GI++P++   +KP  G + ++     N        ++  G  + F ++   ++KVD Q+ L+++  D+LG++
  S:     1 MKFRPLGDRVLVKRVEEETKTKGGIIIPDTVK-EKPQEGEVVAVGPGARNDKGDIVALDVKAGDRILFGKWSGTEVKVDGQDLLIMKESDVLGIV 94
>gi|115360015|ref|YP_777153.1| co-chaperonin GroES [Burkholderia ambifaria AMMD] >gi|115285303|gb|ABI90819.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD] (96 aa)
Score = 149, Expect = 1.2e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDADGQRLVPDLRVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 94
>gi|118602569|ref|YP_903784.1| chaperonin Cpn10 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166198407|sp|A1AWK6|CH10_RUTMC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|118567508|gb|ABL02313.1| chaperonin Cpn10 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (95 aa)
Score = 149, Expect = 1.3e-08, Identities = 37/88 (42%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R++ E TT++G+++P+S   +KPS G I +I +   N N       + VG  V F +Y  N+IKVD +  LVV  DDI+ ++
  S:     1 MNIRPLHDRVIVRRTQEEKTTESGLIIPDSA-TEKPSKGEILAIGNGKINDNGDVIALDVKVGDQVLFGQYAGNEIKVDGETLLVVREDDIVAII 94
>gi|29839358|sp|Q8KJ25|CH10_CLOBO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|22036119|dbj|BAC06586.1| GroES homolog [Clostridium botulinum] (94 aa)
Score = 149, Expect = 1.3e-08, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E  TK+GIVLP S      +A+  + G    +  +  N  + VG  V F +Y  N++K+D +EY+++  +DIL ++
  S:     1 MRIKPLGDRVVIKRLEAEEKTKSGIVLPGSAKEKPQEAEIVAVGPGGLVDGKEVNMEVKVGDRVLFSQYAGNEVKIDGEEYIILRQNDILAIV 93
>gi|78063462|ref|YP_373370.1| co-chaperonin GroES [Burkholderia sp. 383] >gi|77971347|gb|ABB12726.1| Chaperonin Cpn10/GroES [Burkholderia sp. 383] (96 aa)
Score = 149, Expect = 1.3e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDADGQRIVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 94
>gi|170697257|ref|ZP_02888351.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] >gi|172062484|ref|YP_001810135.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] >gi|170137877|gb|EDT06111.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] >gi|171995001|gb|ACB65919.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] (96 aa)
Score = 149, Expect = 1.3e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDADGQRLVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 94
>gi|170698818|ref|ZP_02889881.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] >gi|170136296|gb|EDT04561.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] (105 aa)
Score = 149, Expect = 1.4e-08, Identities = 36/88 (40%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ S        +    + VG  V F +Y    +KVD  E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIETQRTTASGIVIPDSA-AEKPEQGEVVAVGSGRLLQDGTLRALQVKVGDQVLFGKYAGQTVKVDGDELLVMREEDVMGVL 94
>gi|88799070|ref|ZP_01114651.1| Co-chaperonin GroES (HSP10) [Reinekea sp. MED297] >gi|88778297|gb|EAR09491.1| Co-chaperonin GroES (HSP10) [Reinekea sp. MED297] (95 aa)
Score = 149, Expect = 1.4e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E TT  GI+LP S   +KPS G + ++ +       E+   ++ VG TV F +Y  + +KVD +E L++   DI GV+
  S:     1 MKIRPLHDRVVVRRKEEEETTAGGILLPGSAK-EKPSQGEVLAVGNGRVLDNGEVRAVDVKVGDTVVFGQYSGSTVKVDGEELLIMSESDIFGVI 94
>gi|170736377|ref|YP_001777637.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] >gi|169818565|gb|ACA93147.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] (96 aa)
Score = 148, Expect = 1.5e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDHETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDTDGQRIVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 94
>gi|194560082|ref|YP_002095107.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] >gi|124875598|gb|EAY65588.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] (109 aa)
Score = 148, Expect = 1.6e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:    14 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDTDGQRIVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 107
>gi|163816519|ref|ZP_02207883.1| hypothetical protein COPEUT_02709 [Coprococcus eutactus ATCC 27759] >gi|158448219|gb|EDP25214.1| hypothetical protein COPEUT_02709 [Coprococcus eutactus ATCC 27759] (117 aa)
Score = 148, Expect = 1.6e-08, Identities = 35/90 (38%), Positives = 61/90 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPLG RV+LK+S  E TTK+GIVLP     +KP Y  +        +  ++   ++ VG TV ++++  +++K+D++EY+V++ D IL ++ K
  S:    23 MKLRPLGDRVVLKQSVAEETTKSGIVLPGQAK-EKPQYAEVIEVGPGAVVDGKLVPMDVKVGDTVIYQKFAGSEVKLDDEEYIVIKQDSILAIVEK 117
>gi|153953100|ref|YP_001393865.1| co-chaperonin GroES [Clostridium kluyveri DSM 555] >gi|189044098|sp|A5N5D6|CH10_CLOK5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|146345981|gb|EDK32517.1| GroS [Clostridium kluyveri DSM 555] (94 aa)
Score = 148, Expect = 1.6e-08, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPLG RV++K+ E E TTK+GIVLP S      +A+  + G    I  +     + VG  V F +Y  N++K+D  EY ++  DDIL ++
  S:     1 MKIRPLGDRVVIKKIEAEETTKSGIVLPGSAKEKPQEAEIVAVGPGGVIDGKEIKMEVKVGDRVLFSKYAGNEVKIDGVEYTILRQDDILAII 93
>gi|194565923|ref|YP_002100945.1| co-chaperonin GroES [Burkholderia dolosa AUO158] >gi|124899583|gb|EAY71426.1| co-chaperonin GroES [Burkholderia dolosa AUO158] (109 aa)
Score = 148, Expect = 1.6e-08, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +D++ V+
  S:    14 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDADGQRIVPDLKVGERVLFGKYAGQAVKVDGSEFLVLREEDVVAVV 107
>gi|115361134|ref|YP_778271.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD] >gi|171319178|ref|ZP_02908297.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] >gi|115286462|gb|ABI91937.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD] >gi|171095606|gb|EDT40567.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] (105 aa)
Score = 148, Expect = 1.6e-08, Identities = 36/88 (40%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ S        +    + VG  V F +Y    +KVD  E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIETQRTTASGIVIPDSA-AEKPEQGEVVAVGSGRLLQDGTLRALQVKVGDQVLFGKYAGQTVKVDGDELLVMREEDVMGVL 94
>gi|116691622|ref|YP_837155.1| co-chaperonin GroES [Burkholderia cenocepacia HI2424] >gi|116649622|gb|ABK10262.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424] (96 aa)
Score = 148, Expect = 1.6e-08, Identities = 36/88 (40%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDTDGQRIVPDLQVGERVLFGKYAGQAVKVDGNEFLVLREEDIVAVV 94
>gi|115524295|ref|YP_781206.1| co-chaperonin GroES [Rhodopseudomonas palustris BisA53] >gi|115518242|gb|ABJ06226.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53] (104 aa)
Score = 148, Expect = 1.7e-08, Identities = 35/88 (39%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P+S   +KPS G I ++       + ++   +L VG  V F ++   ++K+D+QE L+++  DILGV+
  S:     1 MNFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEIVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIDSQELLIMKESDILGVI 94
>gi|83647305|ref|YP_435740.1| Co-chaperonin GroES (HSP10) [Hahella chejuensis KCTC 2396] >gi|123753566|sp|Q2SDF9|CH10_HAHCH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|83635348|gb|ABC31315.1| Co-chaperonin GroES (HSP10) [Hahella chejuensis KCTC 2396] (96 aa)
Score = 148, Expect = 1.7e-08, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL +RV+++R E ET T  GIVLP  N A+KPS G + ++       + ++    + VG  V F +Y  + +K+D +E L++   DI GV+
  S:     1 MKIRPLHERVVVRRKEEETKTAGGIVLP-GNAAEKPSQGEVLAVGEGRILDNGDVRPLAVKVGDKVVFGQYAGSTVKIDGEELLIMSESDIFGVI 94
>gi|170788827|gb|EDT29871.1| chaperonin GroS [Oligotropha carboxidovorans OM5] (104 aa)
Score = 148, Expect = 1.9e-08, Identities = 35/88 (39%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G I S+       + ++   +L VG  V F ++   ++K+D Q+ L+++  DILGVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEILSVGPGGRDEAGKLIPIDLKVGDIVLFGKWSGTEVKIDGQDLLIMKESDILGVL 94
>gi|121593124|ref|YP_985020.1| chaperonin Cpn10 [Acidovorax sp. JS42] >gi|166233975|sp|A1W3W9|CH10_ACISJ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|120605204|gb|ABM40944.1| chaperonin Cpn10 [Acidovorax sp. JS42] (96 aa)
Score = 147, Expect = 1.9e-08, Identities = 39/90 (43%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ETTT +GIV+P+ N A+KP  G +       K+   E+   N+ VG  V F +Y    +KV+  E LV++ DD+  V+ K
  S:     1 MNLRPLHDRVIVKRIESETTTASGIVIPD-NAAEKPDQGEVLAVGPGKKNDKGELIALNVKVGDRVLFGKYSGQTVKVNGDELLVMKEDDLFAVVEK 96
>gi|161521789|ref|YP_001585216.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616] >gi|189352049|ref|YP_001947676.1| chaperonin GroES [Burkholderia multivorans ATCC 17616] >gi|160345839|gb|ABX18924.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616] >gi|189336071|dbj|BAG45140.1| chaperonin GroES [Burkholderia multivorans ATCC 17616] (105 aa)
Score = 147, Expect = 2.0e-08, Identities = 37/88 (42%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ S             L VG  V F +Y    +KVD +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEVIAVGSGRLLQDGSQRPLQLKVGDQVLFGKYAGQTVKVDGEELLVMREEDVMGVL 94
>gi|146339891|ref|YP_001204939.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278] >gi|146192697|emb|CAL76702.1| 10kDa chaperonin (Protein Cpn10) (groES protein) [Bradyrhizobium sp. ORS278] (104 aa)
Score = 147, Expect = 2.0e-08, Identities = 34/88 (38%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P+S   +KPS G + ++       S ++   ++ VG  V F ++   ++K+D QE L+++  DI+GVL
  S:     1 MAFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEVIAVGPGARDESGKLVPLDVQVGDRVLFGKWSGTEVKIDGQELLIMKESDIMGVL 94
>gi|78044510|ref|YP_359660.1| chaperonin, 10 kDa [Carboxydothermus hydrogenoformans Z-2901] >gi|77996625|gb|ABB15524.1| chaperonin, 10 kDa [Carboxydothermus hydrogenoformans Z-2901] (94 aa)
Score = 147, Expect = 2.1e-08, Identities = 35/86 (40%), Positives = 55/86 (63%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RVL+K    E  TK+GIV+P++   +KP  G +K++ S       E     + VG  V++ +Y   ++K+D +EYL++   DILG+L
  S:     2 FRPLHDRVLVKPLPTEEVTKSGIVIPDTAK-EKPQQGEVKAVGSGRILENGERVPMEVKVGDRVFYSKYAGTEVKIDGEEYLILRESDILGIL 93
>gi|171057173|ref|YP_001789522.1| chaperonin Cpn10 [Leptothrix cholodnii SP-6] >gi|170774618|gb|ACB32757.1| chaperonin Cpn10 [Leptothrix cholodnii SP-6] (96 aa)
Score = 147, Expect = 2.1e-08, Identities = 37/90 (41%), Positives = 54/90 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV++KR E ET T +GIV+P+ N A+KP  G + ++     N        N+ VG  V F +Y    +KVD  E LV+  +D+  V+ K
  S:     1 MKLRPLHDRVIVKRLEQETKTASGIVIPD-NAAEKPDQGEVLAVGPGKRNDKGDFVALNVAVGDRVLFGKYSGQTVKVDGDELLVMREEDLFAVVGK 96
>gi|121609522|ref|YP_997329.1| chaperonin Cpn10 [Verminephrobacter eiseniae EF01-2] >gi|166198422|sp|A1WL04|CH10_VEREI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|121554162|gb|ABM58311.1| chaperonin Cpn10 [Verminephrobacter eiseniae EF01-2] (96 aa)
Score = 147, Expect = 2.3e-08, Identities = 39/90 (43%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ETTT +GIV+P+ N A+KP  G +       K+   E+   N+ VG  V F +Y    +KV   E LV++ DD+  V+ K
  S:     1 MNLRPLHDRVIVKRIESETTTASGIVIPD-NAAEKPDQGEVLAVGPGKKNDKGELIALNVKVGDRVLFGKYSGQTVKVHRDELLVMKEDDLFAVVEK 96
>gi|171464108|ref|YP_001798221.1| chaperonin Cpn10 [Polynucleobacter necessarius STIR1] >gi|171193646|gb|ACB44607.1| chaperonin Cpn10 [Polynucleobacter necessarius STIR1] (96 aa)
Score = 146, Expect = 2.6e-08, Identities = 33/90 (36%), Positives = 58/90 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS-------SEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + E+ T +GI++P++  A+KP  G + ++         ++N  ++ VG  V F +Y    +KVD++E +V+  DDI+ V+ K
  S:     1 MNLRPLHDRVIIKRLDQESKTASGIIIPDAA-AEKPDQGEVLAVGPGKRDDGGKLNAPDVKVGDRVLFGKYAGQTVKVDSEELIVMREDDIMAVVQK 96
>gi|87198060|ref|YP_495317.1| chaperonin Cpn10 [Novosphingobium aromaticivorans DSM 12444] >gi|123736336|sp|Q2GCC7|CH10_NOVAD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|87133741|gb|ABD24483.1| chaperonin Cpn10 [Novosphingobium aromaticivorans DSM 12444] (95 aa)
Score = 146, Expect = 2.7e-08, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV-------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P+S   +KP+ GI+ ++ S     N T+          V F ++   ++KVD ++ L+++  DILGV+
  S:     1 MTFRPLHDRVLVRRVEAEEKTAGGIIIPDSAK-EKPAEGIVVAVGSGARAENGTITPLDVKANDRVLFGKWSGTEVKVDGEDLLIMKESDILGVI 94
>gi|189011850|emb|CAQ30445.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 146, Expect = 3.0e-08, Identities = 31/75 (41%), Positives = 50/75 (66%)
  Q:    14 RSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           R E E  T +GI++P+ N  +KP  G+IK++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 RLEEENKTSSGIIIPD-NAKEKPLMGVIKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|124265620|ref|YP_001019624.1| 10 kDa chaperonin [Methylibium petroleiphilum PM1] >gi|166198382|sp|A2SCV0|CH10_METPP 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|124258395|gb|ABM93389.1| 10 kDa chaperonin [Methylibium petroleiphilum PM1] (96 aa)
Score = 146, Expect = 3.0e-08, Identities = 37/90 (41%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV++KR E ET T +GIV+P+ N A+KP  G + ++     N        N  VG  V F +Y    +KVD  E LV+  +D+  V+ K
  S:     1 MKLRPLHDRVIVKRLEQETKTASGIVIPD-NAAEKPDQGEVLAVGPGKRNDKGDFIALNCKVGDRVLFGKYSGQTVKVDGDELLVMREEDLFAVVEK 96
>gi|120554948|ref|YP_959299.1| chaperonin Cpn10 [Marinobacter aquaeolei VT8] >gi|166198381|sp|A1U293|CH10_MARAV 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|120324797|gb|ABM19112.1| chaperonin Cpn10 [Marinobacter aquaeolei VT8] (95 aa)
Score = 146, Expect = 3.0e-08, Identities = 38/88 (43%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E  T  GIVLP  N  +KPS G + ++ +       E     + VG TV F +Y  N +KVD +E L++  +DI GVL
  S:     1 MKIRPLHDRVVVRRKEEEEKTAGGIVLP-GNAKEKPSQGEVIAVGNGRILDNGETRALAVKVGDTVVFGQYAGNTVKVDGEELLIMSENDIYGVL 94
>gi|149378295|ref|ZP_01896005.1| Co-chaperonin GroES (HSP10) [Marinobacter algicola DG893] >gi|149357429|gb|EDM45941.1| Co-chaperonin GroES (HSP10) [Marinobacter algicola DG893] (95 aa)
Score = 146, Expect = 3.2e-08, Identities = 37/88 (42%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E  T  GIVLP  N  +KPS G + ++ +       E     + VG TV F +Y  N +KVD ++ L++  +DI GVL
  S:     1 MKIRPLHDRVVVRRKEEEEKTAGGIVLP-GNAKEKPSQGEVIAVGNGRILDNGETRALAVKVGDTVVFGQYAGNTVKVDGEDLLIMSENDIFGVL 94
>gi|148256590|ref|YP_001241175.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1] >gi|146408763|gb|ABQ37269.1| 10kDa chaperonin (protein Cpn10) (groES protein) [Bradyrhizobium sp. BTAi1] (104 aa)
Score = 146, Expect = 3.2e-08, Identities = 34/88 (38%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P+S   +KPS G + ++       S ++   ++ VG  V F ++   ++K+D QE L+++  DI+GVL
  S:     1 MAFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEVIAVGPGARDESGKLVPLDVQVGDRVLFGKWSGTEVKIDGQELLIMKESDIMGVL 94
>gi|134293864|ref|YP_001117600.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4] >gi|134137021|gb|ABO58135.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4] (105 aa)
Score = 146, Expect = 3.3e-08, Identities = 37/88 (42%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ S             L VG  V F +Y    +KVD +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEVIAVGSGRLLQDGSQQPLQLKVGDRVLFGKYAGQTVKVDGEELLVMREEDVMGVL 94
>gi|188584509|ref|YP_001927954.1| chaperonin Cpn10 [Methylobacterium populi BJ001] >gi|179348007|gb|ACB83419.1| chaperonin Cpn10 [Methylobacterium populi BJ001] (96 aa)
Score = 145, Expect = 3.5e-08, Identities = 32/88 (36%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G I ++          +N  ++ VG  V F ++   ++K+D Q+ L+++  DI+GV+
  S:     1 MKFRPLHDRVVVRRIESEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDEQGRVNALDVKVGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVV 94
>gi|85715614|ref|ZP_01046594.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A] >gi|85697553|gb|EAQ35430.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A] (105 aa)
Score = 145, Expect = 3.7e-08, Identities = 33/88 (37%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G + ++       S ++   +L VG  V F ++   ++K+D Q+ L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEVVAVGPGGRDESGKLLPIDLKVGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVL 94
>gi|32476529|ref|NP_869523.1| GroES/HSP10-like protein [Rhodopirellula baltica SH 1] >gi|77416390|sp|Q7TTZ0|CH102_RHOBA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES protein 2) >gi|32447075|emb|CAD76884.1| GroES/HSP10 homolog [Rhodopirellula baltica SH 1] (93 aa)
Score = 145, Expect = 3.7e-08, Identities = 33/85 (38%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG+R++++R E ETTT  GIVLP+S   +KP+ G + ++ +          +  L  G  V F  Y    ++VD+ EYL++  DD+L V+
  S:     2 QPLGERIVVQREESETTTAGGIVLPDSAK-EKPARGTVVALGTGKLLDDGSRADFQLAAGDRVLFSSYAGETVEVDDTEYLLMREDDVLAVI 92
>gi|118047735|ref|ZP_01516364.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485] >gi|117995722|gb|EAV09934.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485] (100 aa)
Score = 145, Expect = 3.7e-08, Identities = 33/85 (38%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG RV++K  E E  TKTGI LP++   ++P  G + ++     + N       + VG  V F +Y   + K+D+ EYL++   DILG++
  S:     7 RPLGDRVVVKPVEREEKTKTGIFLPDTASKERPMEGTVLAVGEGRRDDNGKLIPMSVKVGDRVIFAKYSGTEFKLDDVEYLILSEKDILGIV 98
>gi|52840924|ref|YP_094723.1| co-chaperonin GroES [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54293670|ref|YP_126085.1| co-chaperonin GroES [Legionella pneumophila str. Lens] >gi|54296711|ref|YP_123080.1| co-chaperonin GroES [Legionella pneumophila str. Paris] >gi|148360661|ref|YP_001251868.1| co-chaperonin GroES [Legionella pneumophila str. Corby] >gi|81679282|sp|Q5WYL3|CH10_LEGPL 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|81679534|sp|Q5X763|CH10_LEGPA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|81680517|sp|Q5ZXP4|CH10_LEGPH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166198380|sp|A5IGM2|CH10_LEGPC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|116197|sp|P26879|CH10_LEGPN 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein A) >gi|149688|gb|AAA25297.1| htpA >gi|52628035|gb|AAU26776.1| Hsp10, 10 kDa chaperonin GroES [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750496|emb|CAH11890.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein A) [Legionella pneumophila str. Paris] >gi|53753502|emb|CAH14957.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein A) [Legionella pneumophila str. Lens] >gi|148282434|gb|ABQ56522.1| Hsp10, 10 kDa chaperonin GroES [Legionella pneumophila str. Corby] (96 aa)
Score = 145, Expect = 4.1e-08, Identities = 36/90 (40%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R E E TT  GIV+P+S   +KP  G I ++ +       ++    + VG  V F +Y   ++KVD +E +V+  DDI+GV+ K
  S:     1 MKIRPLHDRVVVRRMEEERTTAGGIVIPDSA-TEKPMRGEIIAVGAGKVLENGDVRALAVKVGDVVLFGKYSGTEVKVDGKELVVMREDDIMGVIEK 96
>gi|156452421|ref|ZP_02058792.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4] >gi|163854179|ref|YP_001642222.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] >gi|156188681|gb|EDO20879.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4] >gi|163665784|gb|ABY33151.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] (96 aa)
Score = 145, Expect = 4.2e-08, Identities = 32/88 (36%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G I ++          +N  ++ VG  V F ++   ++K+D Q+ L+++  DI+GV+
  S:     1 MKFRPLHDRVVVRRIESEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDEQGRVNALDVKVGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVV 94
>gi|53805104|ref|YP_113216.1| co-chaperonin GroES [Methylococcus capsulatus str. Bath] >gi|53758865|gb|AAU93156.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath] (96 aa)
Score = 144, Expect = 4.3e-08, Identities = 37/88 (42%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E T+  GIV+P+S  A+KP  G I ++ +       E+    + VG  V F +Y   ++KVD ++ +V+  DDIL VL
  S:     1 MKIRPLHDRVIIKRLEEERTSAGGIVIPDSA-AEKPMRGEILAVGNGKVLDNGEVRALQVKVGDKVLFGKYAGTEVKVDGEDVVVMREDDILAVL 94
>gi|85375708|ref|YP_459770.1| 10 kDa chaperonin, GroES [Erythrobacter litoralis HTCC2594] >gi|84788791|gb|ABC64973.1| 10 kDa chaperonin, GroES [Erythrobacter litoralis HTCC2594] (95 aa)
Score = 144, Expect = 4.4e-08, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV-------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P+S   +KPS G I S+ S     + TV       G  V F ++   ++ VD +E L+++  DI+GV+
  S:     1 MAFRPLHDRVLVRRIEAEEKTAGGIIIPDSAK-EKPSEGEIVSVGSGAKAEDGTVTPLDVKAGDRVLFGKWSGTEVTVDGEELLIMKESDIMGVI 94
>gi|75676757|ref|YP_319178.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255] >gi|74421627|gb|ABA05826.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255] (98 aa)
Score = 144, Expect = 4.5e-08, Identities = 33/87 (37%), Positives = 58/87 (66%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV++KR + E  TK GI++P+S   +KPS G + ++       + ++   ++ VG  V F ++   +IK+D QE L+++  DI+GV+
  S:     5 KFRPLHDRVVVKRIDAEEKTKGGIIIPDSAK-EKPSQGEVVAVGPGGRDETGKLTPVDIKVGDKVLFGKWSGTEIKLDGQELLIMKESDIMGVV 97
>gi|51035593|emb|CAH17404.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 144, Expect = 4.6e-08, Identities = 30/75 (40%), Positives = 50/75 (66%)
  Q:    14 RSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 RLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035583|emb|CAH17399.1| heat shock protein [Helicobacter pylori] >gi|51035585|emb|CAH17400.1| heat shock protein [Helicobacter pylori] >gi|51035589|emb|CAH17402.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 144, Expect = 4.6e-08, Identities = 30/75 (40%), Positives = 50/75 (66%)
  Q:    14 RSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 RLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035581|emb|CAH17398.1| heat shock protein [Helicobacter pylori] (104 aa)
Score = 144, Expect = 4.6e-08, Identities = 30/75 (40%), Positives = 50/75 (66%)
  Q:    14 RSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 RLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035595|emb|CAH17405.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 144, Expect = 4.6e-08, Identities = 30/75 (40%), Positives = 50/75 (66%)
  Q:    14 RSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           R E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     1 RLEEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|145589986|ref|YP_001156583.1| chaperonin Cpn10 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189044113|sp|A4SZV5|CH10_POLSQ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|145048392|gb|ABP35019.1| chaperonin Cpn10 [Polynucleobacter sp. QLW-P1DMWA-1] (96 aa)
Score = 144, Expect = 4.8e-08, Identities = 34/90 (37%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + E+ T +GI++P++  A+KP  G I ++       + ++N  ++ VG  V F +Y    +KVD  E +V+  DDI+ V+ K
  S:     1 MNLRPLHDRVIIKRLDQESKTASGIIIPDAA-AEKPDQGEILAVGPGKRDEAGKLNPLDVKVGDRVLFGKYAGQTVKVDGDELIVMREDDIMAVVQK 96
>gi|84516670|ref|ZP_01004029.1| Chaperonin Cpn10 (GroES) [Loktanella vestfoldensis SKA53] >gi|84509706|gb|EAQ06164.1| Chaperonin Cpn10 (GroES) [Loktanella vestfoldensis SKA53] (94 aa)
Score = 144, Expect = 4.9e-08, Identities = 32/88 (36%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E +T TK G+++P++   +KP+ G I S+       S E+    +  G TV F ++   ++++D +E L+++  DILG++
  S:     1 MAFKPLHDRVLVRRIESDTKTKGGLLIPDTAK-EKPAEGEIVSVGEGARKDSGELIPMAVKAGDTVLFGKWSGTEVRIDGEELLIMKESDILGIM 94
>gi|163848287|ref|YP_001636331.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl] >gi|187601251|ref|ZP_02987480.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl] >gi|163669576|gb|ABY35942.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl] >gi|187486478|gb|EDU24450.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl] (100 aa)
Score = 144, Expect = 5.0e-08, Identities = 33/85 (38%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG RV++K  E E  TKTGI LP++   ++P  G + ++       + ++   N+ VG  V F +Y   + K+D+ EYL++   DILG++
  S:     7 RPLGDRVVVKPVEREEKTKTGIYLPDTASKERPMEGTVLAVGEGRRDDNGKLIPMNVKVGDRVIFAKYSGTEFKLDDVEYLILSEKDILGIV 98
>gi|39998428|ref|NP_954379.1| co-chaperonin GroES [Geobacter sulfurreducens PCA] >gi|81700923|sp|Q747C8|CH10_GEOSL 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|39985375|gb|AAR36729.1| chaperonin, 10 kDa [Geobacter sulfurreducens PCA] (95 aa)
Score = 144, Expect = 5.2e-08, Identities = 37/88 (42%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R+L+KR E ET T  GI +P++   +KP  G I       K+   ++   +L VG  V F +Y    IK++ QE+L++  DDILGV+
  S:     1 MNLRPLQDRILVKRIEEETKTAGGIFIPDTAK-EKPQRGEIVAVGNGKKTEDGKVIPVDLKVGDKVLFGKYAGTDIKIEGQEFLIMREDDILGVI 94
>gi|163852750|ref|YP_001640793.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] >gi|163664355|gb|ABY31722.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] (96 aa)
Score = 144, Expect = 5.3e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVLL+R E +  TK GI++P++   +KP  G + ++          +   ++  G  V F ++   +IKVD Q+ L+++  DILGV+
  S:     1 MAFRPLHDRVLLRRIESDERTKGGIIIPDTAK-EKPQEGEVVAVGPGARDDQGRVTALDVKTGDRVLFGKWSGTEIKVDGQDLLILKESDILGVI 94
>gi|27382643|ref|NP_774172.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110] >gi|27355815|dbj|BAC52797.1| 10 KD chaperonin (protein CPN10) [Bradyrhizobium japonicum USDA 110] (98 aa)
Score = 144, Expect = 5.5e-08, Identities = 32/87 (36%), Positives = 59/87 (67%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV++KR + E  TK GI++P++   +KPS G + ++       + ++   +L VG  V F ++   ++K+DN+E L+++  DI+GV+
  S:     5 KFRPLHDRVVVKRIDAEEKTKGGIIIPDTAK-EKPSQGEVVAVGPGGRDETGKLIPIDLKVGDRVLFGKWSGTEVKIDNEELLIMKESDIMGVM 97
>gi|154248185|ref|YP_001419143.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2] >gi|154162270|gb|ABS69486.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2] (104 aa)
Score = 143, Expect = 6.1e-08, Identities = 34/88 (38%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E  T  GI++P+S   +KP  G + S+     N        ++  G  V F ++   ++K+D Q+ L+++  DILGVL
  S:     1 MGFRPLHDRVVVKRIEAEQKTAGGIIIPDSAK-EKPQQGEVVSVGPGARNEKGELVALDVKAGDLVLFGKWSGTEVKIDGQDLLIMKESDILGVL 94
>gi|169832149|ref|YP_001718131.1| chaperonin Cpn10 [Candidatus Desulforudis audaxviator MP104C] >gi|169638993|gb|ACA60499.1| chaperonin Cpn10 [Candidatus Desulforudis audaxviator MP104C] (94 aa)
Score = 143, Expect = 6.3e-08, Identities = 35/85 (41%), Positives = 58/85 (68%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSE--INNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG+RV++K   +E  TK GIVLP++   +KP  G + ++     ++N      +L VG  V + +Y  N++K+D +EYL++  +D+LGVL
  S:     3 RPLGERVVIKPLPLEEVTKGGIVLPDTAK-EKPQKGEVVAVGPGRLLDNGQRVAIDLKVGDQVLYSKYAGNEVKIDGEEYLILRENDVLGVL 93
>gi|116196|sp|P26195|CH10_LEGMI 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein A) >gi|227655|prf||1708212A heat shock protein (96 aa)
Score = 143, Expect = 6.3e-08, Identities = 35/90 (38%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R E E TT  GIV+P+S   +KP+ G I ++       + ++    + VG  V F +Y   ++K+  QE +V+  DDI+GV+ K
  S:     1 MKIRPLHDRVVVRRMEEERTTAGGIVIPDSA-TEKPTRGEIIAVGPGKVLENGDVRALAVKVGDVVLFGKYSGTEVKISGQELVVMREDDIMGVIEK 96
>gi|152996058|ref|YP_001340893.1| chaperonin Cpn10 [Marinomonas sp. MWYL1] >gi|189044108|sp|A6VWX9|CH10_MARMS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|150836982|gb|ABR70958.1| chaperonin Cpn10 [Marinomonas sp. MWYL1] (96 aa)
Score = 143, Expect = 6.4e-08, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R E ETTT +GIVLP S   +KP+ G + ++ +    SN       + VG TV F +Y    +K++  E L+++ D+I G++
  S:     1 MNIRPLHDRVVVRRKEEETTTASGIVLPGSAK-EKPTQGEVLAVGTGRIQSNGDVQALAVKVGDTVLFGQYSGQTVKIEGDELLIMKEDEIYGIV 94
>gi|156450376|ref|ZP_02056756.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4] >gi|156190871|gb|EDO23060.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4] (96 aa)
Score = 143, Expect = 6.6e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVLL+R E +  TK GI++P++   +KP  G + ++          +   ++  G  V F ++   +IKVD Q+ L+++  DILGV+
  S:     1 MAFRPLHDRVLLRRIESDERTKGGIIIPDTAK-EKPQEGEVVAVGPGARDDQGRVTALDVKTGDRVLFGKWSGTEIKVDGQDLLILKESDILGVI 94
>gi|171319826|ref|ZP_02908909.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] >gi|171094921|gb|EDT39950.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] (96 aa)
Score = 143, Expect = 7.1e-08, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KV+  E+LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRKDTDGQRIVPDLQVGERVLFGKYAGQAVKVNGNEFLVLREEDIVAVV 94
>gi|149185485|ref|ZP_01863801.1| 10 kDa chaperonin, GroES [Erythrobacter sp. SD-21] >gi|148830705|gb|EDL49140.1| 10 kDa chaperonin, GroES [Erythrobacter sp. SD-21] (95 aa)
Score = 143, Expect = 7.2e-08, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV-------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P+S   +KPS G I ++ S     + TV       G  V F ++   +IK+D ++ L+++  DI+G++
  S:     1 MAFRPLHDRVLVRRIEAEEKTAGGIIIPDSAK-EKPSEGEIVAVGSGSKAEDGTVTPLDVKAGDRVLFGKWSGTEIKLDGEDLLIMKESDIMGIM 94
>gi|103485946|ref|YP_615507.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256] >gi|98976023|gb|ABF52174.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256] (95 aa)
Score = 142, Expect = 7.3e-08, Identities = 31/88 (35%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RVL++R E E  T  GI++P++   +KP  G + S+ +       ++   ++  G  + F ++   ++KVD +E L+++  DILGV+
  S:     1 MQFRPLHDRVLVRRIEAEEKTAGGIIIPDTAK-EKPQEGEVVSVGTGARADDGKVTPLDVKAGDRILFGKWSGTEVKVDGEELLIMKESDILGVI 94
>gi|187776784|ref|ZP_02993257.1| hypothetical protein CLOSPO_00300 [Clostridium sporogenes ATCC 15579] >gi|187775443|gb|EDU39245.1| hypothetical protein CLOSPO_00300 [Clostridium sporogenes ATCC 15579] (95 aa)
Score = 142, Expect = 7.5e-08, Identities = 35/88 (39%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS------ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPLG RV++KR E E TTK+GIVLP +   +KP    + +      +  +     L VG  V F +Y  N++K++ +E  +++ DDIL V+
  S:     1 MKIRPLGDRVVIKRVEAEETTKSGIVLPGAAK-EKPQVAEVIAVGPGGLVDGKEVKMELKVGDKVLFSKYAGNEVKIEGEEVTILKQDDILAVV 93
>gi|91783187|ref|YP_558393.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400] >gi|91783217|ref|YP_558423.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400] >gi|91687141|gb|ABE30341.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400] >gi|91687171|gb|ABE30371.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400] (105 aa)
Score = 142, Expect = 7.7e-08, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++               L VG  V F +Y    +KVD +E LV+  +D++GVL
  S:     1 MKIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEVIAVGDGRLLQDGTRRPLQLKVGDHVLFGKYSGQTVKVDGEELLVMREEDVMGVL 94
>gi|121999118|ref|YP_001003905.1| chaperonin Cpn10 [Halorhodospira halophila SL1] >gi|166198376|sp|A1WZJ1|CH10_HALHL 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|121590523|gb|ABM63103.1| chaperonin Cpn10 [Halorhodospira halophila SL1] (96 aa)
Score = 142, Expect = 8.0e-08, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R E E T+  GIV+P++  A+KP  G + ++       + E     + VG  V F +Y   ++K+D Q+YLV+  DDI+ V 
  S:     1 MSIRPLHDRVVIQRLEEERTSPGGIVIPDTA-AEKPMKGKVIAVGHGKTLDNGERRPVEVNVGDQVLFGKYAGTEVKIDGQDYLVMREDDIMAVF 94
>gi|167590160|ref|ZP_02382548.1| co-chaperonin GroES [Burkholderia ubonensis Bu] (96 aa)
Score = 142, Expect = 8.3e-08, Identities = 36/88 (40%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ETTT +GIV+P+S  A+KP  G + ++     ++       +L VG  V F +Y    +KVD  E LV+  +DI+ V+
  S:     1 MSLRPLHDRVIVKRLDQETTTASGIVIPDSA-AEKPDQGEVIAVGPGRRDNDGQRIVPDLKVGERVLFGKYAGQTVKVDGSELLVLREEDIVAVV 94
>gi|89210571|ref|ZP_01188959.1| Chaperonin Cpn10 [Halothermothrix orenii H 168] >gi|89159833|gb|EAR79493.1| Chaperonin Cpn10 [Halothermothrix orenii H 168] (94 aa)
Score = 142, Expect = 8.3e-08, Identities = 32/90 (35%), Positives = 54/90 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII----KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  +PL  RV +K  E E  T++GIVLP++   +KP  G I    K  + E  +  + VG  V F +Y   ++ +D ++Y+++ L+D+L V+ K
  S:     1 MNIKPLNDRVAVKYLEEEEKTRSGIVLPDTAKEEKPQQGEIVAVGKGCTPEDGDPEVKVGDLVVFDKYSGTKVTIDGEDYIILNLEDVLAVIEK 94
>gi|163850180|ref|YP_001638223.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] >gi|163661785|gb|ABY29152.1| chaperonin Cpn10 [Methylobacterium extorquens PA1] (95 aa)
Score = 142, Expect = 8.6e-08, Identities = 31/88 (35%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G + ++       +  IN  ++  G  V F ++   ++K+D Q+ L+++  DI+GV+
  S:     1 MKFRPLHDRVVVRRIEGEEKTKGGIIIPDTVK-EKPQEGEVIAVGPGARDEAGRINAPDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVV 94
>gi|163725736|ref|ZP_02133256.1| chaperonin Cpn10 [Desulfatibacillum alkenivorans AK-01] >gi|161400977|gb|EDQ25225.1| chaperonin Cpn10 [Desulfatibacillum alkenivorans AK-01] (95 aa)
Score = 142, Expect = 8.7e-08, Identities = 33/88 (37%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLT-------VGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ +PL  R+L+KR   ET TK GI++P++   +KP+ G I ++    N  + T       VG  V F +Y   ++K++ +EYL++  DD+LG++
  S:     1 MKLQPLADRILVKRLAEETKTKGGIIIPDTAK-EKPAEGEIVAVGPGRNAEDGTKIALEVKVGDRVLFGKYSGTEVKIEGEEYLIMREDDVLGIV 94
>gi|148655230|ref|YP_001275435.1| chaperonin Cpn10 [Roseiflexus sp. RS-1] >gi|148567340|gb|ABQ89485.1| chaperonin Cpn10 [Roseiflexus sp. RS-1] (98 aa)
Score = 142, Expect = 8.7e-08, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPLG RV++K    E  TK G++LP++   ++P  G + ++    +  +       + VG  V F +Y   + K+D++EYL+++  D+LG++
  S:     1 MHVRPLGDRVVVKPKPREEKTKGGVILPDTASKERPMQGEVIAVGPGRHTDDGKLIPISVEVGQQVLFAKYAGTEFKIDDEEYLILQERDLLGII 95
>gi|91976705|ref|YP_569364.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB5] >gi|91683161|gb|ABE39463.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB5] (105 aa)
Score = 142, Expect = 9.2e-08, Identities = 33/88 (37%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P+S   +KPS G I ++       + ++   +L VG  V F ++   ++K+D +E L+++  DI+GV+
  S:     1 MNFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEIVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIDGKELLIMKESDIMGVI 94
>gi|170740039|ref|YP_001768694.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] >gi|168194313|gb|ACA16260.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] (95 aa)
Score = 142, Expect = 9.3e-08, Identities = 31/88 (35%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G I ++       + ++   ++  G  V F ++   ++K+D Q+ L+++  DI+GVL
  S:     1 MQFRPLHDRVVVRRIESEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDETGKVTPLDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVL 94
>gi|86750344|ref|YP_486840.1| co-chaperonin GroES [Rhodopseudomonas palustris HaA2] >gi|86573372|gb|ABD07929.1| Chaperonin Cpn10 [Rhodopseudomonas palustris HaA2] (105 aa)
Score = 141, Expect = 9.6e-08, Identities = 33/88 (37%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P+S   +KPS G I ++       + ++   +L VG  V F ++   ++K+D +E L+++  DI+GV+
  S:     1 MNFRPLHDRVVVKRIDAEEKTAGGIIIPDSAK-EKPSQGEIVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIDGKELLIMKESDIMGVI 94
>gi|49074882|gb|AAT49435.1| PA4386 [synthetic construct] (98 aa)
Score = 141, Expect = 9.6e-08, Identities = 40/88 (45%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N IKVD +E LV+   +IL VL
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVL 95
>gi|27380337|ref|NP_771866.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110] >gi|27353501|dbj|BAC50491.1| heat shock protein [Bradyrhizobium japonicum USDA 110] (106 aa)
Score = 141, Expect = 9.8e-08, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M FRPL  RVL++R + E  T  GI++P++   +KP  G I +  S   N        ++  G  V F ++   ++K+D Q+YL+++  D+LGV+ K
  S:     3 MHFRPLHDRVLVRRIDAEEKTAGGIIIPDTAK-EKPQEGEIIAAGSGGRNEQGQLIPIDVKPGDRVLFGKWSGTEVKIDGQDYLIMKESDLLGVVDK 98
>gi|92116747|ref|YP_576476.1| co-chaperonin GroES [Nitrobacter hamburgensis X14] >gi|91799641|gb|ABE62016.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14] (105 aa)
Score = 141, Expect = 9.9e-08, Identities = 35/88 (39%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS----SEINN---SNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P++   +KPS G I ++      E  N    +L VG  V F ++   ++K+D Q+ L+++  DI+GVL
  S:     1 MNFRPLHDRVVVKRIDAEDKTAGGIIIPDTVK-EKPSQGEITAVGPGGRDEAGNLIPIDLKVGDRVLFGKWSGTEVKLDGQDLLIMKESDIMGVL 94
>gi|77166373|ref|YP_344898.1| co-chaperonin GroES [Nitrosococcus oceani ATCC 19707] >gi|123593295|sp|Q3J728|CH10_NITOC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|76884687|gb|ABA59368.1| Chaperonin Cpn10 [Nitrosococcus oceani ATCC 19707] (96 aa)
Score = 141, Expect = 1.0e-07, Identities = 35/88 (39%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E T+  GIV+P++  A+KP  G + ++       S E+   ++ VG  V F +Y    +KV+++E LV+  DDI+ VL
  S:     1 MKIRPLHDRVIVRRMEEEKTSSGGIVIPDTA-AEKPIRGEVVAVGNGKILESGEVRALDVKVGDKVLFGKYSGTDVKVESEELLVMREDDIMAVL 94
>gi|148381242|ref|YP_001255783.1| chaperonin, 10 kDa [Clostridium botulinum A str. ATCC 3502] >gi|153931242|ref|YP_001385617.1| chaperonin, 10 kDa [Clostridium botulinum A str. ATCC 19397] >gi|153935387|ref|YP_001389023.1| chaperonin, 10 kDa [Clostridium botulinum A str. Hall] >gi|153941478|ref|YP_001392644.1| chaperonin, 10 kDa [Clostridium botulinum F str. Langeland] >gi|168179054|ref|ZP_02613718.1| chaperonin, 10 kDa [Clostridium botulinum NCTC 2916] >gi|168182076|ref|ZP_02616740.1| chaperonin, 10 kDa [Clostridium botulinum Bf] >gi|170754876|ref|YP_001782922.1| chaperonin, 10 kDa [Clostridium botulinum B1 str. Okra] >gi|170761038|ref|YP_001788615.1| chaperonin, 10 kDa [Clostridium botulinum A3 str. Loch Maree] >gi|166233995|sp|A7FYP4|CH10_CLOB1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166233996|sp|A5I724|CH10_CLOBH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166233997|sp|A7GIN4|CH10_CLOBL 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|148290726|emb|CAL84857.1| 10 kDa chaperonin GroES [Clostridium botulinum A str. ATCC 3502] >gi|152927286|gb|ABS32786.1| chaperonin, 10 kDa [Clostridium botulinum A str. ATCC 19397] >gi|152931301|gb|ABS36800.1| chaperonin, 10 kDa [Clostridium botulinum A str. Hall] >gi|152937374|gb|ABS42872.1| chaperonin, 10 kDa [Clostridium botulinum F str. Langeland] >gi|169120088|gb|ACA43924.1| chaperonin, 10 kDa [Clostridium botulinum B1 str. Okra] >gi|169408027|gb|ACA56438.1| chaperonin, 10 kDa [Clostridium botulinum A3 str. Loch Maree] >gi|182669984|gb|EDT81960.1| chaperonin, 10 kDa [Clostridium botulinum NCTC 2916] >gi|182674825|gb|EDT86786.1| chaperonin, 10 kDa [Clostridium botulinum Bf] (95 aa)
Score = 141, Expect = 1.0e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS------ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPLG RV++KR E E TTK+GIVLP +   +KP    + +      +  +     L VG  V F +Y  N++K++ +E  +++ DDIL V+
  S:     1 MNIRPLGDRVVIKRVEAEETTKSGIVLPGAAK-EKPQVAEVIAVGPGGLVDGKEVKMELKVGDKVLFSKYAGNEVKIEGEEVTILKQDDILAVV 93
>gi|27377171|ref|NP_768700.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110] >gi|543989|sp|P35864|CH103_BRAJA 10 kDa chaperonin 3 (Protein Cpn10 3) (groES protein 3) >gi|12620754|gb|AAG61030.1|AF322013_149 GroES3 [Bradyrhizobium japonicum] >gi|312975|emb|CAA80315.1| GroES3 [Bradyrhizobium japonicum] >gi|27350314|dbj|BAC47325.1| GroES3 chaperonin [Bradyrhizobium japonicum USDA 110] (104 aa)
Score = 141, Expect = 1.1e-07, Identities = 31/88 (35%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G + ++       S ++   ++ VG  V F ++   ++K+D Q+ L+++  D++GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEVIAVGPGGHDDSGKLIPIDIEVGDRVLFGKWSGTEVKIDGQDLLIMKESDVMGVL 94
>gi|51035597|emb|CAH17406.1| heat shock protein [Helicobacter pylori] >gi|51035599|emb|CAH17407.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 141, Expect = 1.1e-07, Identities = 29/73 (39%), Positives = 49/73 (67%)
  Q:    16 EVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     3 EEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035579|emb|CAH17397.1| heat shock protein [Helicobacter pylori] (104 aa)
Score = 141, Expect = 1.1e-07, Identities = 29/73 (39%), Positives = 49/73 (67%)
  Q:    16 EVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     3 EEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035587|emb|CAH17401.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 141, Expect = 1.1e-07, Identities = 29/73 (39%), Positives = 49/73 (67%)
  Q:    16 EVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     3 EEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|51035591|emb|CAH17403.1| heat shock protein [Helicobacter pylori] (105 aa)
Score = 141, Expect = 1.1e-07, Identities = 29/73 (39%), Positives = 49/73 (67%)
  Q:    16 EVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           E E  T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     3 EEENKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 76
>gi|39934216|ref|NP_946492.1| co-chaperonin GroES [Rhodopseudomonas palustris CGA009] >gi|167368297|ref|ZP_02302437.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] >gi|192289742|ref|YP_001990347.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] >gi|42558895|sp|P60366|CH101_RHOPA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) >gi|39648064|emb|CAE26584.1| chaperonin GroES1, cpn10 [Rhodopseudomonas palustris CGA009] >gi|192283491|gb|ACE99871.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] (98 aa)
Score = 141, Expect = 1.1e-07, Identities = 32/88 (36%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + FRPL  RV++KR + ET TK GI++P+S   +KP  G + ++       + ++   ++ VG  V F ++   +IK+D +E L+++  DI+GV+
  S:     4 INFRPLHDRVVVKRIDAETKTKGGIIIPDSAK-EKPQEGQVIAVGPGGRDETGKLTPIDVKVGDRVLFGKWSGTEIKLDGEELLIMKESDIMGVV 97
>gi|27382089|ref|NP_773618.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110] >gi|543988|sp|P35863|CH102_BRAJA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES protein 2) >gi|312978|emb|CAA80317.1| GroES2 [Bradyrhizobium japonicum] >gi|27355259|dbj|BAC52243.1| chaperonin [Bradyrhizobium japonicum USDA 110] (104 aa)
Score = 141, Expect = 1.1e-07, Identities = 33/88 (37%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G + ++       S ++   ++ VG  V F ++   ++K+D QE L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTVK-EKPSQGEVIAVGPGGRDESGKLIPIDVRVGDRVLFGKWSGTEVKIDTQELLIMKESDIMGVL 94
>gi|182704246|ref|ZP_02956657.1| chaperonin Cpn10 [Methylocella silvestris BL2] >gi|172066760|gb|EDT52885.1| chaperonin Cpn10 [Methylocella silvestris BL2] (95 aa)
Score = 141, Expect = 1.2e-07, Identities = 33/88 (37%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E  TK GI++P++   +KP  G I ++       S ++   ++  G  V F ++   ++K+D Q+ L+++  DILGV+
  S:     1 MSFRPLHDRVVVKRLEGEEKTKGGIIIPDTAK-EKPQEGEIIAVGPGGRDDSGKLTPLDVKAGDKVLFGKWSGTEVKIDGQDLLIMKESDILGVV 94
>gi|40714529|dbj|BAD06925.1| molecular chaperone GroES [Ralstonia pickettii] (96 aa)
Score = 141, Expect = 1.2e-07, Identities = 35/90 (38%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET + +GIV+P+ N A+KP  G + ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKSASGIVIPD-NAAEKPDQGEVPAVGPGKKDDKGHNIALDVKVGDRVLFGKYAGQGVKVDGQELLVMREEDIMAVVAK 96
>gi|15599582|ref|NP_253076.1| co-chaperonin GroES [Pseudomonas aeruginosa PAO1] >gi|107100029|ref|ZP_01363947.1| hypothetical protein PaerPA_01001050 [Pseudomonas aeruginosa PACS2] >gi|116052421|ref|YP_792732.1| co-chaperonin GroES [Pseudomonas aeruginosa UCBPP-PA14] >gi|152988628|ref|YP_001350293.1| co-chaperonin GroES [Pseudomonas aeruginosa PA7] >gi|194549936|ref|YP_002084964.1| GroES protein [Pseudomonas aeruginosa C3719] >gi|194555788|ref|YP_002090815.1| GroES protein [Pseudomonas aeruginosa 2192] >gi|122257574|sp|Q02H54|CH10_PSEAB 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166198397|sp|A6VB58|CH10_PSEA7 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|231747|sp|P30720|CH10_PSEAE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|9950616|gb|AAG07774.1|AE004854_10 GroES protein [Pseudomonas aeruginosa PAO1] >gi|151242|gb|AAA25829.1| heat shock protein >gi|999193|gb|AAB34345.1| GroES [Pseudomonas aeruginosa] >gi|115587642|gb|ABJ13657.1| Hsp10 protein [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170882|gb|EAZ56393.1| GroES protein [Pseudomonas aeruginosa C3719] >gi|126198181|gb|EAZ62244.1| GroES protein [Pseudomonas aeruginosa 2192] >gi|150963786|gb|ABR85811.1| GroES protein [Pseudomonas aeruginosa PA7] (97 aa)
Score = 141, Expect = 1.2e-07, Identities = 40/88 (45%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N IKVD +E LV+   +IL VL
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVL 95
>gi|153886079|ref|ZP_02007234.1| chaperonin Cpn10 [Ralstonia pickettii 12D] >gi|187930494|ref|YP_001900981.1| chaperonin Cpn10 [Ralstonia pickettii 12J] >gi|151577044|gb|EDN41445.1| chaperonin Cpn10 [Ralstonia pickettii 12D] >gi|187727384|gb|ACD28549.1| chaperonin Cpn10 [Ralstonia pickettii 12J] (105 aa)
Score = 141, Expect = 1.2e-07, Identities = 35/88 (39%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++ +             L VG  V F +Y    +KVD +E LV+  +D++GV+
  S:     1 MKIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AEKPEQGEVIAVGTGRLLQDGTQRELQLKVGDQVLFGKYAGQTVKVDGEELLVMREEDVMGVI 94
>gi|170735221|ref|YP_001774335.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] >gi|169821259|gb|ACA95840.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] >gi|195944958|emb|CAR57570.1| 10 kDa chaperonin 3 [Burkholderia cenocepacia J2315] (105 aa)
Score = 141, Expect = 1.2e-07, Identities = 35/88 (39%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A++P  G + ++ S             L VG  V F +Y    +KV+ +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AERPEQGEVIAVGSGRLLQDGSQRPLQLQVGDQVLFGKYAGQTVKVNGEELLVMREEDVMGVL 94
>gi|85709558|ref|ZP_01040623.1| co-chaperonin GroES [Erythrobacter sp. NAP1] >gi|85688268|gb|EAQ28272.1| co-chaperonin GroES [Erythrobacter sp. NAP1] (95 aa)
Score = 140, Expect = 1.3e-07, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R E +T T  GI++P+S   +KPS G I S+     +        ++  G  V F ++   ++K+D ++ L+++  DI+G++
  S:     1 MAFRPLHDRVVVRRIEADTKTAGGIIIPDSAQ-EKPSEGEIVSVGEGARDDAGNRVAMDVKAGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGII 94
>gi|194520641|ref|YP_002056230.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] >gi|169657065|gb|EDS88459.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] (98 aa)
Score = 140, Expect = 1.3e-07, Identities = 35/89 (39%), Positives = 55/89 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLY 89
           M  RPL  RV++KR + ET T +GIV+P+S  A+KP  G I ++     ++       ++ VG  V F +Y    +KVD  E LV+  +DI+ V++
  S:     3 MSLRPLHDRVIVKRLDQETKTASGIVIPDSA-AEKPDQGEIVAVGPGRRDADGKRVEPDVKVGERVLFGKYAGQSVKVDGNELLVLREEDIVAVVH 97
>gi|76817441|ref|YP_337180.1| co-chaperonin GroES [Burkholderia pseudomallei 1710b] >gi|161374568|ref|ZP_02114114.1| co-chaperonin GroES [Burkholderia pseudomallei 1710a] >gi|167913869|ref|ZP_02500960.1| co-chaperonin GroES [Burkholderia pseudomallei 112] >gi|76581914|gb|ABA51388.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b] (96 aa)
Score = 140, Expect = 1.3e-07, Identities = 35/89 (39%), Positives = 55/89 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLY 89
           M  RPL  RV++KR + ET T +GIV+P+S  A+KP  G I ++     ++       ++ VG  V F +Y    +KVD  E LV+  +DI+ V++
  S:     1 MSLRPLHDRVIVKRLDQETKTASGIVIPDSA-AEKPDQGEIVAVGPGRRDADGKRVEPDVKVGERVLFGKYAGQSVKVDGNELLVLREEDIVAVIH 95
>gi|126665042|ref|ZP_01736025.1| Co-chaperonin GroES (HSP10) [Marinobacter sp. ELB17] >gi|126630412|gb|EBA01027.1| Co-chaperonin GroES (HSP10) [Marinobacter sp. ELB17] (95 aa)
Score = 140, Expect = 1.4e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E  T  GIVLP  N  +KPS G + ++ +       E+    +  G TV F +Y  N +K+D ++ L++   DI GVL
  S:     1 MKIRPLHDRVVVRRKEEEEKTAGGIVLP-GNAKEKPSQGEVIAVGNGRVQDNGEVRPLAVKAGDTVVFGQYAGNTVKIDGEDLLIMSESDIYGVL 94
>gi|85714224|ref|ZP_01045212.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A] >gi|85698671|gb|EAQ36540.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A] (98 aa)
Score = 140, Expect = 1.4e-07, Identities = 32/87 (36%), Positives = 58/87 (66%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV++KR + E  TK GI++P++   +KPS G + ++       + ++   ++ VG  V F ++   +IK+D QE L+++  DI+GV+
  S:     5 KFRPLHDRVVVKRIDAEEKTKGGIIIPDTAK-EKPSQGEVVAVGPGGRDETGKLTPIDVKVGDKVLFGKWSGTEIKLDGQELLIMKESDIMGVV 97
>gi|194561788|ref|YP_002096812.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] >gi|124879937|gb|EAY67293.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] (105 aa)
Score = 140, Expect = 1.4e-07, Identities = 35/88 (39%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A++P  G + ++ S             L VG  V F +Y    +KV+ +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AERPEQGEVIAVGSGRLLQDGSQRPLQLQVGDQVLFGKYAGQTVKVNGEELLVMREEDVMGVL 94
>gi|196480062|gb|ACG79590.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum HLK1] (103 aa)
Score = 140, Expect = 1.5e-07, Identities = 31/88 (35%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPLG RVL+KR E E  T+ GI++P++   +KP  G + ++       + ++   ++ VG  + F ++   ++K+  ++ L+++  DILGVL
  S:     1 MAFRPLGDRVLVKRVEEEEKTRGGIIIPDTAK-EKPQEGEVIAVGPGARDETGKVQPLDVKVGDRILFGKWSGTEVKLGGEDLLIMKESDILGVL 94
>gi|149203313|ref|ZP_01880283.1| chaperonin Cpn10 [Roseovarius sp. TM1035] >gi|149143146|gb|EDM31185.1| chaperonin Cpn10 [Roseovarius sp. TM1035] (95 aa)
Score = 140, Expect = 1.5e-07, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P+S   +KPS G + S        N       +  G T+ F ++   ++ VD +E L+++  DILGV+
  S:     1 MAFKPLHDRVLVRRVESEAKTAGGLIIPDSAK-EKPSQGQVVSCGDGARKDNGELIAMAVKAGDTILFGKWSGTEVTVDGEELLIMKESDILGVI 94
>gi|17545360|ref|NP_518762.1| co-chaperonin GroES [Ralstonia solanacearum GMI1000] >gi|23813787|sp|Q8Y1P9|CH10_RALSO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|17427652|emb|CAD14171.1| probable 10 kda chaperonin (protein cpn10) (groes protein). [Ralstonia solanacearum] (96 aa)
Score = 140, Expect = 1.5e-07, Identities = 36/90 (40%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPDAA-AEKPDQGEVLAIGPGKKDDKGNPIALDVKVGDRVLFGKYAGQAVKVDGQELLVMREEDIMAVVTK 96
>gi|73542342|ref|YP_296862.1| co-chaperonin GroES [Ralstonia eutropha JMP134] >gi|94309560|ref|YP_582770.1| co-chaperonin GroES [Ralstonia metallidurans CH34] >gi|194288825|ref|YP_002004732.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Cupriavidus taiwanensis] >gi|123260360|sp|Q1LQS5|CH10_RALME 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|123774039|sp|Q46XW5|CH10_RALEJ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|72119755|gb|AAZ62018.1| Chaperonin Cpn10 [Ralstonia eutropha JMP134] >gi|93353412|gb|ABF07501.1| chaperonin Cpn10 [Ralstonia metallidurans CH34] >gi|193222660|emb|CAQ68663.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Cupriavidus taiwanensis] (96 aa)
Score = 140, Expect = 1.5e-07, Identities = 37/90 (41%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P+ N A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPD-NAAEKPDQGEVLAIGPGKKDDKGNNIALDVKVGDRVLFGKYAGQGVKVDGQELLVMREEDIMAVVNK 96
>gi|89899933|ref|YP_522404.1| chaperonin Cpn10 [Rhodoferax ferrireducens T118] >gi|123091421|sp|Q21ZD0|CH10_RHOFD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|89344670|gb|ABD68873.1| chaperonin Cpn10 [Rhodoferax ferrireducens T118] (96 aa)
Score = 140, Expect = 1.5e-07, Identities = 38/90 (42%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV++KR E ET T +GIV+P+S  A+KP  G +       K+   EI+   + VG  V F +Y    +KV   E LV++ DD+  V+ K
  S:     1 MKLRPLHDRVIVKRVENETKTASGIVIPDSA-AEKPDQGEVLAVGPGKKNDKGEISPMAVKVGDRVLFGKYSGQTVKVAGDELLVMKEDDLFAVVEK 96
>gi|195540554|emb|CAQ30443.1| heat shock protein [Helicobacter pylori] (102 aa)
Score = 140, Expect = 1.5e-07, Identities = 28/71 (39%), Positives = 49/71 (69%)
  Q:    18 ETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           E+ T +GI++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     2 ESKTSSGIIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 73
>gi|85703817|ref|ZP_01034920.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. 217] >gi|85671137|gb|EAQ25995.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. 217] (95 aa)
Score = 140, Expect = 1.5e-07, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P+S   +KPS G + S        N       +  G T+ F ++   ++ VD +E L+++  DILGV+
  S:     1 MAFKPLHDRVLVRRVESEAKTAGGLIIPDSAK-EKPSQGEVVSCGDGARKDNGELIAMAVKAGDTILFGKWSGTEVTVDGEELLIMKESDILGVI 94
>gi|170746969|ref|YP_001753229.1| chaperonin Cpn10 [Methylobacterium radiotolerans JCM 2831] >gi|170653491|gb|ACB22546.1| chaperonin Cpn10 [Methylobacterium radiotolerans JCM 2831] (96 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/88 (34%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G + ++          +N  ++  G  V F ++   ++K+D Q+ L+++  DI+GV+
  S:     1 MKFRPLHDRVVVRRIESEEKTKGGIIIPDTAK-EKPQEGEVVAVGPGARDEQGRVNALDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVV 94
>gi|83719093|ref|YP_442003.1| co-chaperonin GroES [Burkholderia thailandensis E264] >gi|167563843|ref|ZP_02356759.1| co-chaperonin GroES [Burkholderia oklahomensis EO147] >gi|167570981|ref|ZP_02363855.1| co-chaperonin GroES [Burkholderia oklahomensis C6786] >gi|167580840|ref|ZP_02373714.1| co-chaperonin GroES [Burkholderia thailandensis TXDOH] >gi|167618942|ref|ZP_02387573.1| co-chaperonin GroES [Burkholderia thailandensis Bt4] >gi|167837624|ref|ZP_02464507.1| co-chaperonin GroES [Burkholderia thailandensis MSMB43] >gi|83652918|gb|ABC36981.1| chaperonin, 10 kDa [Burkholderia thailandensis E264] (97 aa)
Score = 140, Expect = 1.6e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAIGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 94
>gi|158423935|ref|YP_001525227.1| heat shock protein [Azorhizobium caulinodans ORS 571] >gi|158330824|dbj|BAF88309.1| heat shock protein [Azorhizobium caulinodans ORS 571] (104 aa)
Score = 140, Expect = 1.6e-07, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E  T  GI++P++   +KP  G + ++ + + N        ++  G  V F ++   ++K+D Q+ L+++  DILGV+
  S:     1 MGFRPLHDRVVVKRIEAEQKTAGGIIIPDTAK-EKPQEGEVVAVGAGVRNEKGELVALDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDILGVV 94
>gi|34499470|ref|NP_903685.1| co-chaperonin GroES [Chromobacterium violaceum ATCC 12472] >gi|34105322|gb|AAQ61677.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472] (95 aa)
Score = 139, Expect = 1.7e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G + ++ +       E     L VG  V F +Y    +KVD +E LV+  +D++G++
  S:     1 MAIRPLHDRVVIKRLEAEEKTASGIVLPGAA-AEKPDMGQVLAVGNGKILENGERRPLELKVGDKVIFGKYSGQTVKVDGEEVLVMREEDVMGIV 94
>gi|53720308|ref|YP_109294.1| co-chaperonin GroES [Burkholderia pseudomallei K96243] >gi|53725993|ref|YP_103589.1| co-chaperonin GroES [Burkholderia mallei ATCC 23344] >gi|67643862|ref|ZP_00442605.1| COG0234: Co-chaperonin GroES (HSP10) [Burkholderia mallei GB8 horse 4] >gi|76808812|ref|YP_334548.1| co-chaperonin GroES [Burkholderia pseudomallei 1710b] >gi|115350786|ref|YP_772625.1| co-chaperonin GroES [Burkholderia ambifaria AMMD] >gi|121600115|ref|YP_992251.1| co-chaperonin GroES [Burkholderia mallei SAVP1] >gi|124385024|ref|YP_001028693.1| co-chaperonin GroES [Burkholderia mallei NCTC 10229] >gi|126440709|ref|YP_001060130.1| co-chaperonin GroES [Burkholderia pseudomallei 668] >gi|126448254|ref|YP_001081401.1| co-chaperonin GroES [Burkholderia mallei NCTC 10247] >gi|126453024|ref|YP_001067392.1| co-chaperonin GroES [Burkholderia pseudomallei 1106a] >gi|134280542|ref|ZP_01767253.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|134294905|ref|YP_001118640.1| co-chaperonin GroES [Burkholderia vietnamiensis G4] >gi|161356839|ref|ZP_02102716.1| co-chaperonin GroES [Burkholderia pseudomallei 1106b] >gi|161371169|ref|ZP_02110734.1| co-chaperonin GroES [Burkholderia pseudomallei 1710a] >gi|167000849|ref|ZP_02266654.1| co-chaperonin GroES [Burkholderia mallei PRL-20] >gi|167590188|ref|ZP_02382576.1| co-chaperonin GroES [Burkholderia ubonensis Bu] >gi|167720888|ref|ZP_02404124.1| co-chaperonin GroES [Burkholderia pseudomallei DM98] >gi|167739868|ref|ZP_02412642.1| co-chaperonin GroES [Burkholderia pseudomallei 14] >gi|167817089|ref|ZP_02448769.1| co-chaperonin GroES [Burkholderia pseudomallei 91] >gi|167825499|ref|ZP_02456970.1| co-chaperonin GroES [Burkholderia pseudomallei 9] >gi|167846989|ref|ZP_02472497.1| co-chaperonin GroES [Burkholderia pseudomallei B7210] >gi|167895572|ref|ZP_02482974.1| co-chaperonin GroES [Burkholderia pseudomallei 7894] >gi|167908574|ref|ZP_02495779.1| co-chaperonin GroES [Burkholderia pseudomallei NCTC 13177] >gi|167912220|ref|ZP_02499311.1| co-chaperonin GroES [Burkholderia pseudomallei 112] >gi|167920181|ref|ZP_02507272.1| co-chaperonin GroES [Burkholderia pseudomallei BCC215] >gi|170701766|ref|ZP_02892701.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] >gi|171319259|ref|ZP_02908374.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] >gi|172059809|ref|YP_001807461.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] >gi|194316506|ref|YP_002012262.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399] >gi|194505553|ref|YP_002035124.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] >gi|194516672|ref|YP_002052333.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] >gi|194522517|ref|YP_002058050.1| chaperonin, 10 kDa [Burkholderia mallei FMH] >gi|194527497|ref|YP_002063020.1| chaperonin, 10 kDa [Burkholderia mallei JHU] >gi|194577225|ref|YP_002112106.1| chaperonin, 10 kDa [Burkholderia mallei 2002721280] >gi|23813837|sp|Q9ZFE1|CH10_BURCE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|3916735|gb|AAC79086.1| 10 kDa heat shock protein GroES [Burkholderia cepacia] >gi|52210722|emb|CAH36706.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243] >gi|52429416|gb|AAU50009.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344] >gi|76578265|gb|ABA47740.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b] >gi|115280774|gb|ABI86291.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD] >gi|121228925|gb|ABM51443.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1] >gi|124293044|gb|ABN02313.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229] >gi|126220202|gb|ABN83708.1| chaperonin GroS [Burkholderia pseudomallei 668] >gi|126226666|gb|ABN90206.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a] >gi|126241124|gb|ABO04217.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247] >gi|134138062|gb|ABO53805.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4] >gi|134248549|gb|EBA48632.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|147746527|gb|EDK53604.1| chaperonin, 10 kDa [Burkholderia mallei FMH] >gi|147751507|gb|EDK58574.1| chaperonin, 10 kDa [Burkholderia mallei JHU] >gi|148025483|gb|EDK83637.1| chaperonin, 10 kDa [Burkholderia mallei 2002721280] >gi|160696804|gb|EDP86774.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399] >gi|169652798|gb|EDS85491.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13] >gi|170133314|gb|EDT01707.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10] >gi|171095516|gb|EDT40481.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5] >gi|171992326|gb|ACB63245.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6] >gi|184211440|gb|EDU08483.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] (97 aa)
Score = 139, Expect = 1.7e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAIGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 94
>gi|170743665|ref|YP_001772320.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] >gi|168197939|gb|ACA19886.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] (95 aa)
Score = 139, Expect = 1.7e-07, Identities = 30/88 (34%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G + ++       S ++   ++  G  V F ++   ++++D Q+ L+++  DI+GVL
  S:     1 MKFRPLHDRVVVRRIEAEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARDESGKVAPLDVKAGDRVLFGKWSGTEVRLDGQDLLIMKESDIMGVL 94
>gi|53721513|ref|YP_110498.1| co-chaperonin GroES [Burkholderia pseudomallei K96243] >gi|126442428|ref|YP_001061736.1| co-chaperonin GroES [Burkholderia pseudomallei 668] >gi|126456944|ref|YP_001074681.1| co-chaperonin GroES [Burkholderia pseudomallei 1106a] >gi|134283064|ref|ZP_01769766.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|161358524|ref|ZP_02104396.1| co-chaperonin GroES [Burkholderia pseudomallei 1106b] >gi|167722567|ref|ZP_02405803.1| co-chaperonin GroES [Burkholderia pseudomallei DM98] >gi|167741544|ref|ZP_02414318.1| co-chaperonin GroES [Burkholderia pseudomallei 14] >gi|167818738|ref|ZP_02450418.1| co-chaperonin GroES [Burkholderia pseudomallei 91] >gi|167827113|ref|ZP_02458584.1| co-chaperonin GroES [Burkholderia pseudomallei 9] >gi|167838938|ref|ZP_02465715.1| co-chaperonin GroES [Burkholderia thailandensis MSMB43] >gi|167848611|ref|ZP_02474119.1| co-chaperonin GroES [Burkholderia pseudomallei B7210] >gi|167897185|ref|ZP_02484587.1| co-chaperonin GroES [Burkholderia pseudomallei 7894] >gi|167905558|ref|ZP_02492763.1| co-chaperonin GroES [Burkholderia pseudomallei NCTC 13177] >gi|167921782|ref|ZP_02508873.1| co-chaperonin GroES [Burkholderia pseudomallei BCC215] >gi|194507152|ref|YP_002036653.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] >gi|194511865|ref|YP_002024392.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] >gi|194571750|ref|YP_002106749.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] >gi|52211927|emb|CAH37932.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243] >gi|126221919|gb|ABN85424.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668] >gi|126230712|gb|ABN94125.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a] >gi|134245712|gb|EBA45804.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305] >gi|157806695|gb|EDO83865.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] >gi|157934970|gb|EDO90640.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] >gi|184209638|gb|EDU06681.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655] (96 aa)
Score = 139, Expect = 1.7e-07, Identities = 35/89 (39%), Positives = 55/89 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLY 89
           M  RPL  RV++KR + ET T +GIV+P+S  A+KP  G I ++     ++       ++ VG  V F +Y    +KVD  E LV+  +DI+ V++
  S:     1 MSLRPLHDRVIVKRLDQETKTASGIVIPDSA-AEKPDQGEIVAVGPGRRDADGKRVEPDVKVGERVLFGKYAGQSVKVDGNELLVLREEDIVAVVH 95
>gi|121603569|ref|YP_980898.1| chaperonin Cpn10 [Polaromonas naphthalenivorans CJ2] >gi|166198392|sp|A1VJZ9|CH10_POLNA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|120592538|gb|ABM35977.1| chaperonin Cpn10 [Polaromonas naphthalenivorans CJ2] (96 aa)
Score = 139, Expect = 1.7e-07, Identities = 37/90 (41%), Positives = 54/90 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ET T +GIV+P+S  A+KP  G +       K+   E+    + VG  V F +Y    +KVD  E LV++ +D+  V+ K
  S:     1 MNLRPLHDRVIVKRVENETKTASGIVIPDSA-AEKPDQGEVLAVGPGKKNDKGELGAMAVKVGDRVLFGKYSGQTVKVDGDELLVMKEEDLFAVVEK 96
>gi|86748960|ref|YP_485456.1| co-chaperonin GroES [Rhodopseudomonas palustris HaA2] >gi|86571988|gb|ABD06545.1| Chaperonin Cpn10 [Rhodopseudomonas palustris HaA2] (98 aa)
Score = 139, Expect = 1.7e-07, Identities = 32/88 (36%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + FRPL  RV++KR + ET TK GI++P+S   +KP  G + ++       + ++   ++  G  V F ++   +IK+D QE L+++  DI+GV+
  S:     4 LNFRPLHDRVVVKRIDAETKTKGGIIIPDSAK-EKPQEGEVVAVGPGGRDEAGKLIPIDVKAGDRVLFGKWSGTEIKLDGQELLIMKESDIMGVV 97
>gi|114569156|ref|YP_755836.1| chaperonin Cpn10 [Maricaulis maris MCS10] >gi|122316674|sp|Q0AS39|CH10_MARMM 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|114339618|gb|ABI64898.1| chaperonin Cpn10 [Maricaulis maris MCS10] (95 aa)
Score = 139, Expect = 1.8e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL+KR E E+TTK GI++P++   +KP  G + +I          +   ++  G  + F ++   ++ VD  E L+++  DILGV+
  S:     1 MTFRPLHDRVLVKRVEEESTTKGGIIIPDTAK-EKPQEGEVVAIGGGAIKEDGSVRPLDVKAGDRILFGKWSGTEVTVDGVELLIMKESDILGVM 94
>gi|23813836|sp|Q9ZFD9|CH10_BURVI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|3916738|gb|AAC79088.1| 10 kDa heat shock protein GroES [Burkholderia vietnamiensis] (97 aa)
Score = 139, Expect = 1.8e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAIGPGKRDDKGALIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 94
>gi|152237|gb|AAA26286.1| groES (101 aa)
Score = 139, Expect = 1.9e-07, Identities = 28/88 (31%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R E E  TK GI++P++   +KP  G + ++         +I   ++ VG  + F ++   +IK+D ++ L+++  D++G++
  S:     1 MAFRPLHDRILVRRVESEEKTKGGIIIPDTAK-EKPQEGEVLAVGPGARGEQGQIQPLDVKVGDRILFGKWSGTEIKIDGEDLLIMKESDVMGII 94
>gi|2493652|sp|P77828|CH101_BRAJA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) >gi|1613781|gb|AAC44752.1| heat shock protein GroES (104 aa)
Score = 139, Expect = 1.9e-07, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M FRPL  RVL++R + E  T  GI++P++   +KP  G I +  S   N        ++  G  V F ++   ++K+D Q+YL+++  D+LGV+ K
  S:     1 MHFRPLHDRVLVRRIDAEEKTAGGIIIPDTAK-EKPQEGEIIAAGSGGRNEQGQLIPIDVKPGDRVLFGKWSGTEVKIDGQDYLIMKESDLLGVVDK 96
>gi|83747557|ref|ZP_00944594.1| 10 kDa chaperonin GROES [Ralstonia solanacearum UW551] >gi|83725737|gb|EAP72878.1| 10 kDa chaperonin GROES [Ralstonia solanacearum UW551] (96 aa)
Score = 139, Expect = 1.9e-07, Identities = 36/90 (40%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPDAA-AEKPDQGEVLAIGPGKKDDKGNPISLDVKVGDRVLFGKYAGQAVKVDGQELLVMREEDIMAVVTK 96
>gi|182678710|ref|YP_001832856.1| chaperonin Cpn10 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634593|gb|ACB95367.1| chaperonin Cpn10 [Beijerinckia indica subsp. indica ATCC 9039] (95 aa)
Score = 139, Expect = 2.0e-07, Identities = 33/88 (37%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E  TK GI++P+S   +KP  G I ++       S ++   ++  G  + F ++   ++K+D Q+ L+++  DILGV+
  S:     1 MTFRPLHDRVVVKRLESEEKTKGGIIIPDSAK-EKPQEGEIIAVGPGGRDESGKLIPLDVKAGDKILFGKWSGTEVKIDGQDLLIMKESDILGVV 94
>gi|160901091|ref|YP_001566673.1| chaperonin Cpn10 [Delftia acidovorans SPH-1] >gi|160366675|gb|ABX38288.1| chaperonin Cpn10 [Delftia acidovorans SPH-1] (96 aa)
Score = 139, Expect = 2.0e-07, Identities = 38/90 (42%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ET T +GIV+P  N A+KP  G +       K+   E+   N+ VG  V F +Y    +KV   E LV++ DD+  V+ K
  S:     1 MNLRPLHDRVIVKRLENETKTASGIVIP-ENAAEKPDQGEVLAVGPGKKNDKGEVIALNVKVGDRVLFGKYSGQTVKVHGDELLVMKEDDLFAVVEK 96
>gi|39935234|ref|NP_947510.1| co-chaperonin GroES [Rhodopseudomonas palustris CGA009] >gi|167364615|ref|ZP_02298759.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] >gi|192290842|ref|YP_001991447.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] >gi|42558896|sp|P60367|CH102_RHOPA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES protein 2) >gi|39649085|emb|CAE27606.1| chaperonin GroES2, cpn10 [Rhodopseudomonas palustris CGA009] >gi|192284591|gb|ACF00972.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1] (104 aa)
Score = 139, Expect = 2.0e-07, Identities = 32/88 (36%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR + E  T  GI++P++   +KPS G I ++       + ++   +L VG  V F ++   ++K+D +E L+++  DI+GV+
  S:     1 MNFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEIVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIDGKELLIMKESDIMGVI 94
>gi|194507465|ref|YP_002020003.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] >gi|194569281|ref|YP_002104284.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] >gi|157809140|gb|EDO86310.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e] >gi|157939417|gb|EDO95087.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237] (99 aa)
Score = 139, Expect = 2.1e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + +I     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     3 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAIGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 96
>gi|167565157|ref|ZP_02358073.1| co-chaperonin GroES [Burkholderia oklahomensis EO147] >gi|167574792|ref|ZP_02367666.1| co-chaperonin GroES [Burkholderia oklahomensis C6786] (96 aa)
Score = 139, Expect = 2.1e-07, Identities = 35/89 (39%), Positives = 55/89 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLY 89
           M  RPL  RV++KR + ET T +GIV+P+S  A+KP  G I ++     ++       ++ VG  V F +Y    +KVD  E LV+  +DI+ V++
  S:     1 MSLRPLHDRVVVKRLDQETKTASGIVIPDSA-AEKPDQGEIVAVGPGRRDADGKRVEPDVKVGERVLFGKYAGQSVKVDGNELLVLREEDIVAVVH 95
>gi|85859339|ref|YP_461541.1| co-chaperonin [Syntrophus aciditrophicus SB] >gi|85722430|gb|ABC77373.1| co-chaperonin [Syntrophus aciditrophicus SB] (96 aa)
Score = 139, Expect = 2.1e-07, Identities = 35/90 (38%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  TK GI++P++   +KP  G + ++         ++   ++ VG  V F +Y   ++K D QEYL++  DDILG++ K
  S:     1 MNIRPLQDRVIVKRLEEEQKTKGGIIIPDTAK-EKPIEGEVVAVGKGKVTEDGKLLPLDVKVGDRVLFSKYGGTEVKFDGQEYLIMREDDILGIVEK 96
>gi|163708346|ref|ZP_02125185.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] >gi|162427373|gb|EDQ38072.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] (95 aa)
Score = 138, Expect = 2.3e-07, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E E  TK GI++P++   +KP  G I ++     +        ++  G  V F ++   ++K+D Q+ L+++  DI+GVL
  S:     1 MQFRPLHDRVVVRRIESEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDETGKLVPLDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGVL 94
>gi|195970073|ref|YP_002122333.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021] >gi|20141232|sp|P35474|CH105_RHIME 10 kDa chaperonin 5 (Protein Cpn10 5) (groES protein 5) >gi|186929512|emb|CAQ51294.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021] (104 aa)
Score = 138, Expect = 2.3e-07, Identities = 28/88 (31%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R E E  TK GI++P++   +KP  G + ++         +I   ++ VG  + F ++   +IK+D ++ L+++  D++G++
  S:     1 MAFRPLHDRILVRRVESEEKTKGGIIIPDTAK-EKPQEGEVLAVGPGARGEQGQIQPLDVKVGDRILFGKWSGTEIKIDGEDLLIMKESDVMGII 94
>gi|148244664|ref|YP_001219358.1| chaperonin GroES [Candidatus Vesicomyosocius okutanii HA] >gi|166198423|sp|A5CWP5|CH10_VESOH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|146326491|dbj|BAF61634.1| chaperonin GroES [Candidatus Vesicomyosocius okutanii HA] (95 aa)
Score = 138, Expect = 2.4e-07, Identities = 32/88 (36%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R E + TT +G+++P+S   +KPS G++ ++ +   N N       +T+G  V F +Y   +IKVD ++ L+++  DI+ V+
  S:     1 MNIRPLHDRVVVRRVEEKKTTSSGLIIPDSA-TEKPSEGVVVAVGNGKKNDNGDTIALDVTIGNKVLFAQYAGTEIKVDGKKLLIMKEGDIVAVI 94
>gi|13472059|ref|NP_103626.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099] >gi|23813804|sp|Q98IV4|CH101_RHILO 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) >gi|14022804|dbj|BAB49412.1| chaperonin GroES [Mesorhizobium loti MAFF303099] (104 aa)
Score = 138, Expect = 2.4e-07, Identities = 29/90 (32%), Positives = 58/90 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+FRPL  RV+++R+E +T +K GI++P+ N  +KP  G + ++     + N       +  G  + F ++   ++K+D ++ L+++  DI+GV+ K
  S:     1 MKFRPLHDRVVIRRAEGDTKSKGGIIIPD-NAKEKPQEGEVIAVGPGARDENGALVPLDVKAGDLILFGKWSGTEVKIDGEDLLIMKEADIMGVIDK 96
>gi|196480512|gb|ACG80039.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum HLK1] (97 aa)
Score = 138, Expect = 2.4e-07, Identities = 28/88 (31%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPLG R+L++R E +  T  GI++P++   +KP  G + ++     + +       L  G  V F ++  +++++D ++ L+++  D+LGVL
  S:     1 MTFRPLGDRILVRRVEEDAKTPGGIIIPDTAK-EKPQQGEVLAVGPGARDKDGRRLEPELKAGQKVLFGKWSGSEVRIDGEDLLIMKESDVLGVL 94
>gi|92118661|ref|YP_578390.1| co-chaperonin GroES [Nitrobacter hamburgensis X14] >gi|91801555|gb|ABE63930.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14] (98 aa)
Score = 138, Expect = 2.5e-07, Identities = 32/87 (36%), Positives = 58/87 (66%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV++KR + E  TK GI++P++   +KPS G + ++       + ++   ++ VG  V F ++   +IK+D Q+ L+++  DI+GVL
  S:     5 KFRPLHDRVVVKRIDAEEKTKGGIIIPDTA-REKPSQGEVIAVGPGGRDEAGKLVPIDIKVGDKVLFGKWSGTEIKLDGQDVLIMKESDIMGVL 97
>gi|161525698|ref|YP_001580710.1| co-chaperonin GroES [Burkholderia multivorans ATCC 17616] >gi|189349580|ref|YP_001945208.1| chaperonin GroES [Burkholderia multivorans ATCC 17616] >gi|160343127|gb|ABX16213.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616] >gi|189333602|dbj|BAG42672.1| chaperonin GroES [Burkholderia multivorans ATCC 17616] (97 aa)
Score = 138, Expect = 2.5e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 94
>gi|154245113|ref|YP_001416071.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2] >gi|154159198|gb|ABS66414.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2] (96 aa)
Score = 138, Expect = 2.7e-07, Identities = 31/90 (34%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M FRPL  RV++KR E E  T  GI++P++   +KP  G + ++ +   +        ++  G  V F ++   ++K+D Q+ L+++  DILGV+ K
  S:     1 MSFRPLHDRVVVKRIEAEQKTAGGIIIPDTAK-EKPQEGEVIAVGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDILGVITK 96
>gi|75676376|ref|YP_318797.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255] >gi|74421246|gb|ABA05445.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255] (105 aa)
Score = 138, Expect = 2.8e-07, Identities = 31/88 (35%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G + ++       + ++   +L VG  V F ++   ++K++ Q+ L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEVVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIEGQDLLIMKESDIMGVL 94
>gi|114319186|ref|YP_740869.1| co-chaperonin GroES [Alkalilimnicola ehrlichei MLHE-1] >gi|122312792|sp|Q0ACQ8|CH10_ALHEH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|114225580|gb|ABI55379.1| chaperonin Cpn10 [Alkalilimnicola ehrlichei MLHE-1] (95 aa)
Score = 137, Expect = 2.8e-07, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E T+  GIV+P+S  A+KP  G + ++       + E    +L VG  V F ++   ++KVD +E LV+  DD++ ++
  S:     1 MNIRPLHDRVVIKRMEEERTSPGGIVIPDSA-AEKPIKGEVVAVGNGKLLDNGETRPLDLKVGDKVLFGKFAGTEVKVDGEELLVMREDDVMAIV 94
>gi|158422049|ref|YP_001523341.1| chaperonin [Azorhizobium caulinodans ORS 571] >gi|158328938|dbj|BAF86423.1| chaperonin [Azorhizobium caulinodans ORS 571] (95 aa)
Score = 137, Expect = 2.9e-07, Identities = 31/88 (35%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E  T  GI++P++   +KP  G + ++     + N       +  G  V F ++   ++K+D Q+ L+++  DILGV+
  S:     1 MSFRPLHDRVVVKRIEAEQKTAGGIIIPDTAK-EKPQEGEVVAVGPGARDENGKVVALDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDILGVI 94
>gi|153886383|ref|ZP_02007538.1| chaperonin Cpn10 [Ralstonia pickettii 12D] >gi|151577348|gb|EDN41749.1| chaperonin Cpn10 [Ralstonia pickettii 12D] (96 aa)
Score = 137, Expect = 2.9e-07, Identities = 35/90 (38%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPDAA-AEKPDQGEVLAVGPGKKDDKGNAIALDVKVGDRVLFGKYAGQGVKVDGQEVLVMREEDIMAVVQK 96
>gi|187927674|ref|YP_001898161.1| chaperonin Cpn10 [Ralstonia pickettii 12J] >gi|187724564|gb|ACD25729.1| chaperonin Cpn10 [Ralstonia pickettii 12J] (96 aa)
Score = 137, Expect = 2.9e-07, Identities = 35/90 (38%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPDAA-AEKPDQGEVLAVGPGKKDDKGNAIALDVKVGDRVLFGKYAGQGVKVDGQEVLVMREEDIMAVVAK 96
>gi|107023132|ref|YP_621459.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054] >gi|116686628|ref|YP_839875.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424] >gi|105893321|gb|ABF76486.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054] >gi|116652343|gb|ABK12982.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424] (105 aa)
Score = 137, Expect = 3.0e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E + TT +GIV+P+S  A++P  G + ++ S             L VG  V F +Y    +K + +E LV+  +D++GVL
  S:     1 MQIRPLYDRVIVKRIEQQRTTASGIVIPDSA-AERPEQGEVIAVGSGRLLQDGSQRPLQLQVGDQVLFGKYAGQTVKANGEELLVMREEDVMGVL 94
>gi|114330236|ref|YP_746458.1| co-chaperonin GroES [Nitrosomonas eutropha C91] >gi|122314705|sp|Q0AJH8|CH10_NITEC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|114307250|gb|ABI58493.1| chaperonin Cpn10 [Nitrosomonas eutropha C91] (96 aa)
Score = 137, Expect = 3.0e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  T +GIV+P++  A+KP  G I ++         +I    + VG  V F +Y    +K+  +E+LV+  +DI+GV+
  S:     1 MNIRPLHDRVIVKRLEEERKTASGIVIPDTA-AEKPDQGEIIAVGKGKAGEDGKIRTLEVKVGDKVLFGKYAGQAVKIKGEEFLVMREEDIMGVI 94
>gi|146283473|ref|YP_001173626.1| co-chaperonin GroES [Pseudomonas stutzeri A1501] >gi|166198400|sp|A4VP83|CH10_PSEU5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|145571678|gb|ABP80784.1| chaperonin, 10 kDa [Pseudomonas stutzeri A1501] (97 aa)
Score = 137, Expect = 3.1e-07, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRAPAVKVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVI 95
>gi|144898662|emb|CAM75526.1| Chaperonin Cpn10 [Magnetospirillum gryphiswaldense MSR-1] (95 aa)
Score = 137, Expect = 3.1e-07, Identities = 29/88 (32%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RVL+KR + E  T  GI++P++   +KP  G + ++ S +          ++  G  + F ++   ++K+D ++ L+++  DILG+L
  S:     1 MKFRPLHDRVLVKRLDAEEKTAGGIIIPDTAK-EKPMQGEVIAVGSGVRGEDGKIVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKESDILGIL 94
>gi|94497511|ref|ZP_01304081.1| 10 kDa chaperonin, GroES [Sphingomonas sp. SKA58] >gi|94423142|gb|EAT08173.1| 10 kDa chaperonin, GroES [Sphingomonas sp. SKA58] (95 aa)
Score = 137, Expect = 3.2e-07, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P++   +KP  G I S+ +       ++   ++  G  + F ++   ++KVD ++ L+++  DILGV+
  S:     1 MAFRPLHDRVLVRRVEAEEKTAGGIIIPDTAK-EKPQEGEIVSVGTGSKAEDGKVTPLDVKTGDRILFGKWSGTEVKVDGEDLLIMKESDILGVI 94
>gi|146342933|ref|YP_001207981.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278] >gi|148253203|ref|YP_001237788.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1] >gi|146195739|emb|CAL79766.1| 10kDa chaperonin (Protein Cpn10) (groES protein) [Bradyrhizobium sp. ORS278] >gi|146405376|gb|ABQ33882.1| 10kDa chaperonin (protein Cpn10) (groES protein) [Bradyrhizobium sp. BTAi1] (98 aa)
Score = 137, Expect = 3.2e-07, Identities = 32/87 (36%), Positives = 58/87 (66%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV++KR + E  TK GI++P+S   +KPS G + ++       S ++   ++ VG  V F ++   ++K+D +E L+++  DI+GV+
  S:     5 KFRPLHDRVVVKRIDAEEKTKGGIIIPDSAK-EKPSQGEVVAVGPGGRDESGKLIPIDVKVGDRVLFGKWSGTEVKLDGEELLIMKESDIMGVV 97
>gi|194564076|ref|YP_002099099.1| Chaperonin Cpn10 [Burkholderia dolosa AUO158] >gi|124895700|gb|EAY69580.1| Chaperonin Cpn10 [Burkholderia dolosa AUO158] (99 aa)
Score = 137, Expect = 3.2e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     3 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 96
>gi|107021935|ref|YP_620262.1| co-chaperonin GroES [Burkholderia cenocepacia AU 1054] >gi|116688882|ref|YP_834505.1| co-chaperonin GroES [Burkholderia cenocepacia HI2424] >gi|170732183|ref|YP_001764130.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] >gi|105892124|gb|ABF75289.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054] >gi|116646971|gb|ABK07612.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424] >gi|169815425|gb|ACA90008.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3] (97 aa)
Score = 137, Expect = 3.2e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P +  A+KP  G I ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPEAA-AEKPDQGEILAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 94
>gi|88811317|ref|ZP_01126572.1| co-chaperonin GroES [Nitrococcus mobilis Nb-231] >gi|88791206|gb|EAR22318.1| co-chaperonin GroES [Nitrococcus mobilis Nb-231] (96 aa)
Score = 137, Expect = 3.4e-07, Identities = 33/88 (37%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E T+  GIV+P++  A+KP  G I ++       + EI   ++TVG  V F ++   ++K+ +++ LV+  DD++ V+
  S:     1 MKLRPLHDRVVIKRLEEERTSPGGIVIPDTA-AEKPIRGEIIAVGNGKQLDNGEIRPLDVTVGDQVLFGKFAGTEVKIGDEDLLVMREDDVMAVV 94
>gi|91774721|ref|YP_544477.1| chaperonin Cpn10 [Methylobacillus flagellatus KT] >gi|123078960|sp|Q1H4F1|CH10_METFK 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|91708708|gb|ABE48636.1| chaperonin Cpn10 [Methylobacillus flagellatus KT] (96 aa)
Score = 137, Expect = 3.4e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  T +GIV+P++  A+KP  G + ++     + N       + VG  V F +Y    +KV+ +E LV+  DDILG++
  S:     1 MAIRPLQDRVIVKRLEEERKTASGIVIPDTA-AEKPDQGEVIAVGPGKKDDNGKSIPLDVKVGDKVLFGKYAGQAVKVNGEEVLVLREDDILGIV 94
>gi|83591501|ref|YP_425253.1| chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170] >gi|83574415|gb|ABC20966.1| Chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170] (104 aa)
Score = 137, Expect = 3.5e-07, Identities = 33/88 (37%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E +  TK GI++P++   +KP  G I       +     ++  ++T G  V F ++   ++K+D  EYL+++  DILGV+
  S:     1 MAFRPLQDRVLVRRLEEDEKTKGGIIIPDTAK-EKPMRGEIIATGPGARGEDGVLHPLDVTSGDIVLFGKWTGTEVKIDGVEYLIMKESDILGVI 94
>gi|170690651|ref|ZP_02881817.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] >gi|170143900|gb|EDT12062.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] (105 aa)
Score = 137, Expect = 3.5e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E + TT +GIV+P+S  A+KP  G + ++               L VG  V F +Y    +K+D +E LV+  +D++GVL
  S:     1 MNIRPLYDRVVVKRIERQRTTASGIVIPDSA-AEKPEQGEVIAVGDGRLLKDGTRRPPELKVGDHVLFGKYAGQTVKIDGEELLVMREEDVIGVL 94
>gi|194557148|ref|YP_002092174.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] >gi|124870939|gb|EAY62655.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184] (99 aa)
Score = 137, Expect = 3.5e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P +  A+KP  G I ++     +        ++ VG  V F +Y    +KVD QE LV+  +DI+ V+
  S:     3 MNLRPLHDRVIVKRLDQETKTASGIVIPEAA-AEKPDQGEILAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVV 96
>gi|53803987|ref|YP_114146.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath] >gi|53757748|gb|AAU92039.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath] (96 aa)
Score = 136, Expect = 3.8e-07, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++ R E E T+  GIV+P++   +KP  G I ++ +       ++    +  G TV F +Y   +IK+D  EYL++  DDI+GV+
  S:     1 MKIRPLHDRVVVIRREEEKTSPGGIVIPDTAK-EKPIKGEIVAVGTGKVLDNGQVRPLAVKAGDTVLFGKYSGTEIKIDGTEYLMLREDDIMGVI 94
>gi|89093987|ref|ZP_01166931.1| chaperonin, 10 kDa [Oceanospirillum sp. MED92] >gi|89081661|gb|EAR60889.1| chaperonin, 10 kDa [Oceanospirillum sp. MED92] (95 aa)
Score = 136, Expect = 3.9e-07, Identities = 39/88 (44%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSE--INNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R+E E TT +GIVLP S   +KP+ G + ++     +NN       + VG TV F  Y AN +KVD +E L++  ++I GVL
  S:     1 MKIRPLHDRVVVRRNEEEATTASGIVLPGSAQ-EKPNQGKVIAVGEGRILNNGERQALTVQVGDTVLFGGY-ANTVKVDGEELLILSENEIYGVL 93
>gi|91786662|ref|YP_547614.1| chaperonin Cpn10 [Polaromonas sp. JS666] >gi|123356095|sp|Q12FH6|CH10_POLSJ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|91695887|gb|ABE42716.1| chaperonin Cpn10 [Polaromonas sp. JS666] (96 aa)
Score = 136, Expect = 3.9e-07, Identities = 35/90 (38%), Positives = 54/90 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV++KR E ET T +GIV+P+S  A+KP  G + ++     N         + +G  V F +Y    +KVD  E LV++ +D+  V+ K
  S:     1 MKLRPLHDRVIVKRVENETKTASGIVIPDSA-AEKPDQGEVLAVGPGKKNDKGDLSPMAVKIGDRVLFGKYSGQTVKVDGDELLVMKEEDLFAVVEK 96
>gi|83854817|ref|ZP_00948347.1| chaperonin, 10 kDa [Sulfitobacter sp. NAS-14.1] >gi|83941340|ref|ZP_00953802.1| chaperonin, 10 kDa [Sulfitobacter sp. EE-36] >gi|83842660|gb|EAP81827.1| chaperonin, 10 kDa [Sulfitobacter sp. NAS-14.1] >gi|83847160|gb|EAP85035.1| chaperonin, 10 kDa [Sulfitobacter sp. EE-36] (95 aa)
Score = 136, Expect = 3.9e-07, Identities = 32/88 (36%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R+E E  TK G+++P+S   +KPS G + S        S E+    +  G  V F ++   ++ +D +E L+++  DI+G+L
  S:     1 MAFKPLHDRVLVRRTESEEKTKGGLIIPDSAK-EKPSEGEVVSCGEGARKDSGELIAMAVKAGDKVLFGKWSGTEVTLDGEELLMMKESDIMGIL 94
>gi|119897264|ref|YP_932477.1| chaperonin GroES [Azoarcus sp. BH72] >gi|119669677|emb|CAL93590.1| chaperonin GroES [Azoarcus sp. BH72] (96 aa)
Score = 136, Expect = 4.0e-07, Identities = 33/88 (37%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E  T +GIV+P+S   +KP  G + ++ +       ++    + VG  V F +Y    +KV+ +E LV+  +DI+GV+
  S:     1 MKIRPLHDRVIVKRLEAERKTASGIVIPDSA-GEKPDQGEVLAVGNGKILDDGKVRPMAVQVGDKVLFGKYAGQSVKVEGEELLVMREEDIMGVV 94
>gi|30248058|ref|NP_840128.1| co-chaperonin GroES [Nitrosomonas europaea ATCC 19718] >gi|60389764|sp|Q82Y61|CH10_NITEU 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|30179943|emb|CAD83938.1| Chaperonins cpn10 (10 Kd subunit) [Nitrosomonas europaea ATCC 19718] (96 aa)
Score = 136, Expect = 4.1e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  T +GIV+P++  A+KP  G I ++         +I    + VG  V F +Y    +K+  +E+LV+  +DI+GV+
  S:     1 MNIRPLHDRVIVKRLEEERKTASGIVIPDTA-AEKPDQGEIIAVGKGKTGEDGKIRALEVKVGDRVLFGKYAGQAVKIKGEEFLVMREEDIMGVI 94
>gi|150398980|ref|YP_001322747.1| chaperonin Cpn10 [Methanococcus vannielii SB] >gi|150011683|gb|ABR54135.1| chaperonin Cpn10 [Methanococcus vannielii SB] (88 aa)
Score = 136, Expect = 4.1e-07, Identities = 27/88 (30%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +P G+R+L+K  E+E  T  GI++PNS+  +K + G I ++S      +  +G  + F +Y   +   DNQ+Y++++++D+L  +
  S:     1 MALKPYGERILVKPIEIEEKTAGGIIIPNSSK-EKSNIGTIVAVSDSEKVKDFKIGQKIVFSKYSGTEFNEDNQKYIIIKIEDVLAFI 87
>gi|28871513|ref|NP_794132.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato str. DC3000] >gi|66047300|ref|YP_237141.1| co-chaperonin GroES [Pseudomonas syringae pv. syringae B728a] >gi|71734896|ref|YP_276204.1| co-chaperonin GroES [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81307949|sp|Q4ZP19|CH10_PSEU2 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|123747554|sp|Q48EI4|CH10_PSE14 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|60389775|sp|Q87X13|CH10_PSESM 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|28854764|gb|AAO57827.1| chaperonin, 10 kDa [Pseudomonas syringae pv. tomato str. DC3000] >gi|63258007|gb|AAY39103.1| Chaperonin Cpn10 [Pseudomonas syringae pv. syringae B728a] >gi|71555449|gb|AAZ34660.1| chaperonin, 10 kDa [Pseudomonas syringae pv. phaseolicola 1448A] (97 aa)
Score = 136, Expect = 4.1e-07, Identities = 38/88 (43%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G I ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEIVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95
>gi|110601398|ref|ZP_01389587.1| Chaperonin Cpn10 [Geobacter sp. FRC-32] >gi|110547907|gb|EAT61144.1| Chaperonin Cpn10 [Geobacter sp. FRC-32] (96 aa)
Score = 136, Expect = 4.2e-07, Identities = 34/90 (37%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RP+  R+++KR E ET T  GI +P +   +KP  G + ++ +       +I   ++ VG  V F +Y   ++KV+ Q+YL++  DDILGV+ K
  S:     1 MKLRPMQDRIIVKRVEEETKTAGGIYIPETAK-EKPQEGEVVAVGNGKRTEDGKILPLDVKVGDKVLFGKYSGTEVKVEGQDYLIMREDDILGVIEK 96
>gi|148652451|ref|YP_001279544.1| co-chaperonin GroES [Psychrobacter sp. PRwf-1] >gi|172048508|sp|A5WD53|CH10_PSYWF 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|148571535|gb|ABQ93594.1| chaperonin Cpn10 [Psychrobacter sp. PRwf-1] (96 aa)
Score = 136, Expect = 4.3e-07, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R++++R E E  T  GI+LP S   +KPS G I ++ +       E+   ++ VG  V F +Y    +KV+ +E L+++  D+LGVL
  S:     1 MNIRPLHDRIVVRRVEEEQKTAGGILLPGSAQ-EKPSQGEILAVGNGQIRENGEVRALDVKVGDKVLFGQYAGQTVKVNGEELLIMKESDVLGVL 94
>gi|113866732|ref|YP_725221.1| co-chaperonin GroES [Ralstonia eutropha H16] >gi|123134359|sp|Q0KDR8|CH10_RALEH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|40714532|dbj|BAD06927.1| molecular chaperone GroES [Ralstonia pickettii] >gi|113525508|emb|CAJ91853.1| Co-chaperonin GroES (HSP10) [Ralstonia eutropha H16] (96 aa)
Score = 136, Expect = 4.5e-07, Identities = 36/90 (40%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P+ N A+KP  G + +I     +        ++ VG  V F +Y    +KV+ QE LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDNETKTASGIVIPD-NAAEKPDQGEVLAIGPGKKDDKGNNIALDVKVGDRVLFGKYAGQAVKVEGQELLVMREEDIMAVVNK 96
>gi|92118106|ref|YP_577835.1| co-chaperonin GroES [Nitrobacter hamburgensis X14] >gi|91801000|gb|ABE63375.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14] (105 aa)
Score = 136, Expect = 4.6e-07, Identities = 31/88 (35%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  +  GI++P++   +KPS G I ++       + ++   ++ VG  V F ++   ++K+D Q+ L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKSAGGIIIPDTVK-EKPSQGEIVAVGPGGRDEAGKLIPIDVNVGDKVLFGKWSGTEVKIDGQDLLIMKESDIMGVL 94
>gi|83950580|ref|ZP_00959313.1| Chaperonin Cpn10 (GroES) [Roseovarius nubinhibens ISM] >gi|83838479|gb|EAP77775.1| Chaperonin Cpn10 (GroES) [Roseovarius nubinhibens ISM] (95 aa)
Score = 136, Expect = 4.7e-07, Identities = 32/88 (36%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P+S   +KPS G +       +  S E+    +  G  V F ++   +I +D +E L+++  DILGV+
  S:     1 MAFKPLHDRVLVRRVESEEKTSGGLIIPDSAK-EKPSEGEVVACGDGARKDSGELIEMAVKAGDRVLFGKWSGTEITIDGEELLIMKESDILGVM 94
>gi|33594371|ref|NP_882015.1| co-chaperonin GroES [Bordetella pertussis Tohama I] >gi|33595553|ref|NP_883196.1| co-chaperonin GroES [Bordetella parapertussis 12822] >gi|33599951|ref|NP_887511.1| co-chaperonin GroES [Bordetella bronchiseptica RB50] >gi|61220904|sp|P0A339|CH10_BORPE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|61220906|sp|P0A340|CH10_BORBR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|61220907|sp|P0A341|CH10_BORPA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|968919|gb|AAA74966.1| Cpn10 (GroES) >gi|33564446|emb|CAE43757.1| 10 kDa chaperonin [Bordetella pertussis Tohama I] >gi|33565631|emb|CAE40278.1| 10 kDa chaperonin [Bordetella parapertussis] >gi|33567548|emb|CAE31462.1| 10 kDa chaperonin [Bordetella bronchiseptica RB50] (95 aa)
Score = 135, Expect = 4.9e-07, Identities = 36/88 (40%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + E  T +GIV+P+S  A+KP  G +       K+   +I   +L  G  V F +Y    +KVD +E LV+  D+IL V+
  S:     1 MALRPLHDRVIVKRLDNERKTASGIVIPDSA-AEKPDQGEVVAVGPGKKTEDGKILPVDLKAGDKVLFGKYAGQTVKVDGEELLVIREDEILAVI 94
>gi|93005370|ref|YP_579807.1| co-chaperonin GroES [Psychrobacter cryohalolentis K5] >gi|123386767|sp|Q1QDD0|CH10_PSYCK 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|92393048|gb|ABE74323.1| chaperonin Cpn10 [Psychrobacter cryohalolentis K5] (96 aa)
Score = 135, Expect = 5.0e-07, Identities = 34/88 (38%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R++++R E ET T  GI+LP S   +KPS G ++ + + +I ++      ++  G  V F +Y    +KVD +E L+++  D+LGVL
  S:     1 MNIRPLHDRIVVRRIEEETKTAGGILLPGSAQ-EKPSQGEVLATGNGQIRDNGETRALDVKAGDKVLFGQYAGQTVKVDGEELLIMKESDVLGVL 94
>gi|74316110|ref|YP_313850.1| chaperonin GroES (Hsp10, Cpn10)) [Thiobacillus denitrificans ATCC 25259] >gi|123773101|sp|Q3SMK0|CH10_THIDA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|74055605|gb|AAZ96045.1| chaperonin GroES (Hsp10, Cpn10)) [Thiobacillus denitrificans ATCC 25259] (96 aa)
Score = 135, Expect = 5.0e-07, Identities = 34/88 (38%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E  T +GIV+P++  A+KP  G I ++ +       ++ + ++ VG  V F +Y    +KV+ +E LV+  +DI+GV+
  S:     1 MKIRPLHDRVIVKRMEEERKTASGIVIPDTA-AEKPDQGEIVAVGAGKKDDQGKLISLDVKVGDRVLFGKYAGQTVKVEGEELLVMREEDIMGVV 94
>gi|159900195|ref|YP_001546442.1| chaperonin Cpn10 [Herpetosiphon aurantiacus ATCC 23779] >gi|159893234|gb|ABX06314.1| chaperonin Cpn10 [Herpetosiphon aurantiacus ATCC 23779] (100 aa)
Score = 135, Expect = 5.1e-07, Identities = 30/85 (35%), Positives = 53/85 (62%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV++K    E  TK+G+ LP++ + +KP  G++ ++     + N       + VG  V F +Y   +IK+D+++YL++   DIL V+
  S:     7 RPLADRVVIKPQAKEEKTKSGLFLPDTANKEKPQEGLVVAVGEGKLDDNGKRVPVAVQVGDRVLFAKYAGTEIKLDDEDYLILAEKDILAVV 98
>gi|91778538|ref|YP_553746.1| co-chaperonin GroES [Burkholderia xenovorans LB400] >gi|91691198|gb|ABE34396.1| GroES [Burkholderia xenovorans LB400] (96 aa)
Score = 135, Expect = 5.1e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R+++KR + ET T +GIV+P S  A+KP  G + +I     +S       +L VG  V F +Y    +KVD  E LV+  +D++ V+
  S:     1 MSLRPLHDRLIVKRLDQETKTASGIVIPESA-AEKPDQGEVIAIGPGRRDSDGKRIEPDLKVGERVLFGKYAGQSVKVDGNELLVLREEDVVAVV 94
>gi|170790569|gb|EDT31613.1| chaperonin GroS [Oligotropha carboxidovorans OM5] (98 aa)
Score = 135, Expect = 5.3e-07, Identities = 31/86 (36%), Positives = 57/86 (66%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV++KR + E  TK GI++P++   +KPS G + ++       + ++   +L VG  V F ++   ++K+D ++ L+++  DI+GVL
  S:     6 FRPLHDRVVVKRLDAEEKTKGGIIIPDTAK-EKPSEGKVVAVGPGGRDETGKLIPIDLKVGDRVLFGKWSGTEVKLDGEDLLIMKESDIMGVL 97
>gi|117923612|ref|YP_864229.1| chaperonin Cpn10 [Magnetococcus sp. MC-1] >gi|117607368|gb|ABK42823.1| chaperonin Cpn10 [Magnetococcus sp. MC-1] (97 aa)
Score = 135, Expect = 5.3e-07, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + FRPL  RV++KR+E +  T  GI++P++   +KP  G + ++ S + N         + VG  V F +Y   ++++D +E L++   DI+G+L
  S:     3 INFRPLHDRVVVKRTESDAKTAGGIIIPDTAK-EKPVQGEVLAVGSGVVNDAGNVRPLEVKVGDKVLFSKYGGTEVRIDGEELLIMRESDIVGIL 96
>gi|163705220|ref|ZP_02123226.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] >gi|162429368|gb|EDQ39997.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] (95 aa)
Score = 135, Expect = 5.4e-07, Identities = 30/88 (34%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R E E  TK GI++P++   +KP  G I ++     +        ++  G  V F ++   ++++D Q+ L+++  DI+GVL
  S:     1 MTFRPLHDRVVVRRIEAEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDETGKLVPLDVKTGDRVLFGKWSGTEVRIDGQDLLIMKESDIMGVL 94
>gi|190894864|ref|YP_001985157.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] >gi|190700525|gb|ACE94607.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] (104 aa)
Score = 135, Expect = 5.5e-07, Identities = 27/88 (30%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++       + +I   ++ VG  + F ++   +IK++ +E L+++ +D++G++
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNDAGQIQALDVKVGDHILFGKWSGTEIKINGEELLIMKENDVMGII 94
>gi|6831504|sp|Q9Z463|CH10_PARDE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|4115771|dbj|BAA36515.1| chaperonin 10 [Paracoccus denitrificans] (95 aa)
Score = 135, Expect = 5.5e-07, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R + +  TK G+++P+S   +KP+ G I S+       S E+    +  G  V F ++   ++ VD +E L+++  DILG++
  S:     1 MAFKPLHDRVLVRRVQSDEKTKGGLIIPDSAK-EKPAEGEITSVGEGARKDSGELIAPAVKAGDRVLFGKWSGTEVTVDGEELLIMKESDILGII 94
>gi|27380736|ref|NP_772265.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110] >gi|27353901|dbj|BAC50890.1| 10 KD chaperonin [Bradyrhizobium japonicum USDA 110] (104 aa)
Score = 135, Expect = 5.6e-07, Identities = 31/88 (35%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV++KR + E  T  GI++P++   +KPS G + ++       + ++   +L VG  V F ++   ++K+D+ + L+++  DI+GVL
  S:     1 MKFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK-EKPSQGEVVAVGPGGRDEAGKLIPIDLKVGDRVLFGKWSGTEVKIDSVDLLIMKESDIMGVL 94
>gi|116188|sp|P26005|CH10_AMOPS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|155401|gb|AAC09380.1| groES [Amoeba proteus symbiotic bacterium] (96 aa)
Score = 135, Expect = 5.6e-07, Identities = 36/90 (40%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R E E TT   IV+P+S   +KP  G I +I +       ++    + VG  V F +Y   ++KV  QE +V+  DDI+GV+ K
  S:     1 MKIRPLHDRVVVRRLEEERTTAGWIVIPDSA-TEKPMRGEIIAIGAGKILDNGDVRAFVVKVGDVVLFGKYSGTEVKVAGQELVVMREDDIMGVIEK 96
>gi|78221256|ref|YP_383003.1| co-chaperonin GroES [Geobacter metallireducens GS-15] >gi|123756541|sp|Q39ZP6|CH10_GEOMG 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|78192511|gb|ABB30278.1| Chaperonin Cpn10 [Geobacter metallireducens GS-15] (95 aa)
Score = 135, Expect = 5.8e-07, Identities = 35/88 (39%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R+L+KR E E  T  GI +P++   +KP  G I       K+   ++   +L VG  V F +Y    IKV+ +++L++  DDILGV+
  S:     1 MKLRPLQDRILVKRIEEEQVTAGGIFIPDTAK-EKPQRGEIVAVGNGKKTEDGKVIPIDLKVGDKVLFGKYAGTDIKVEGEDFLIMREDDILGVI 94
>gi|170696125|ref|ZP_02887260.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] >gi|170138940|gb|EDT07133.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] (96 aa)
Score = 135, Expect = 6.0e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R+++KR + ET T +GIV+P S  A+KP  G + +I     +S       +L VG  V F +Y    +KVD  E LV+  +D++ V+
  S:     1 MSLRPLHDRLIVKRLDQETKTASGIVIPESA-AEKPDQGEVIAIGPGKRDSDGKRVEPDLKVGERVLFGKYAGQSVKVDGNELLVLREEDVVAVV 94
>gi|163787653|ref|ZP_02182100.1| hypothetical protein FBALC1_03902 [Flavobacteriales bacterium ALC-1] >gi|159877541|gb|EDP71598.1| hypothetical protein FBALC1_03902 [Flavobacteriales bacterium ALC-1] (91 aa)
Score = 135, Expect = 6.1e-07, Identities = 31/88 (35%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLT--VGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RVL++  E ETTT +GI++P+ N  +KP  G + +I +   +  LT  VG TV + +Y   ++K++ ++YL++   DIL ++
  S:     3 LNIKPLADRVLVEPMEAETTTASGIIIPD-NAKEKPQKGTVVAIGNGKKDEPLTVKVGDTVLYGKYGGTELKLEGKDYLMMRESDILAII 91
>gi|83716291|ref|YP_440133.1| co-chaperonin GroES [Burkholderia thailandensis E264] >gi|167578705|ref|ZP_02371579.1| co-chaperonin GroES [Burkholderia thailandensis TXDOH] >gi|167616838|ref|ZP_02385469.1| co-chaperonin GroES [Burkholderia thailandensis Bt4] >gi|83650116|gb|ABC34180.1| chaperonin, 10 kDa [Burkholderia thailandensis E264] (96 aa)
Score = 135, Expect = 6.1e-07, Identities = 34/89 (38%), Positives = 55/89 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLY 89
           M  RPL  RV++KR + ET T +GIV+P+S  A+KP  G I ++     ++       ++ VG  V F +Y    +KVD  E LV+  ++I+ V++
  S:     1 MSLRPLHDRVIVKRLDQETKTASGIVIPDSA-AEKPDQGEIVAVGPGRRDADGVRVEPDVKVGERVLFGKYAGQPVKVDGNELLVLREEEIVAVVH 95
>gi|166031215|ref|ZP_02234044.1| hypothetical protein DORFOR_00902 [Dorea formicigenerans ATCC 27755] >gi|166029062|gb|EDR47819.1| hypothetical protein DORFOR_00902 [Dorea formicigenerans ATCC 27755] (110 aa)
Score = 134, Expect = 6.3e-07, Identities = 33/88 (37%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSN-----DAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG RV+LK+   E TTK+GIVLP  +      A+  + G   ++  +    N+TVG  V + +Y    ++++++EY+VV+ DDIL ++
  S:    17 MKLVPLGDRVVLKQIVAEETTKSGIVLPGQSKEKPQQAEVVAVGPGGTVDGKEVKMNVTVGQQVIYSKYAGTSVEIEDEEYIVVKQDDILAII 109
>gi|91780204|ref|YP_555411.1| co-chaperonin GroES [Burkholderia xenovorans LB400] >gi|91692864|gb|ABE36061.1| groES 10 kDa chaperonin [Burkholderia xenovorans LB400] (96 aa)
Score = 134, Expect = 6.3e-07, Identities = 35/88 (39%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R+++KR + ET T +GIV+P S  A+KP  G + +I     +S       +L VG  V F +Y    +KVD  E LV+  +D++ V+
  S:     1 MSLRPLHDRLIVKRLDQETKTASGIVIPESA-AEKPDQGEVIAIGPGKRDSDGKRIEPDLKVGERVLFGKYAGQSVKVDGTELLVLREEDVVAVV 94
>gi|71065120|ref|YP_263847.1| co-chaperonin GroES [Psychrobacter arcticus 273-4] >gi|123775629|sp|Q4FU95|CH10_PSYA2 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|71038105|gb|AAZ18413.1| putative Chaperonin HSP10 [Psychrobacter arcticus 273-4] >gi|189008659|gb|ACD68571.1| GroES [Psychrobacter frigidicola] (96 aa)
Score = 134, Expect = 6.4e-07, Identities = 34/88 (38%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  R++++R E ET T  GI+LP S   +KPS G ++ + + +I ++      ++  G  V F +Y    +KVD +E L+++  D+LGVL
  S:     1 MNIRPLHDRIVVRRIEEETKTAGGILLPGSAQ-EKPSQGEVLATGNGQIRDNGETRALDVKTGDKVLFGQYAGQTVKVDGEELLIMKESDVLGVL 94
>gi|69934985|ref|ZP_00630016.1| Chaperonin Cpn10 [Paracoccus denitrificans PD1222] >gi|119387311|ref|YP_918345.1| co-chaperonin GroES [Paracoccus denitrificans PD1222] >gi|119377886|gb|ABL72649.1| chaperonin Cpn10 [Paracoccus denitrificans PD1222] (95 aa)
Score = 134, Expect = 6.4e-07, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R + +  TK G+++P+S   +KP+ G I ++       S E+    +  G  V F ++   ++ VD +E L+++  DILG++
  S:     1 MTFRPLHDRVLVRRVQSDEKTKGGLIIPDSAK-EKPAEGEIIAVGEGARKDSGELIAPAVKAGDRVLFGKWSGTEVTVDGEELLIMKESDILGII 94
>gi|48474481|sp|Q8KTR9|CH10_TREPR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|21702582|gb|AAM75979.1|AF481102_15 chaperone Hsp10 [Candidatus Tremblaya princeps] (96 aa)
Score = 134, Expect = 6.6e-07, Identities = 34/87 (39%), Positives = 55/87 (63%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + RPLG RV++KRSE ET T  GIV+P+S  A+K   G + ++     +S        + +G  V F +Y    IKVD+++ +V+  +DI+ V+
  S:     3 KIRPLGDRVVVKRSEDETKTPCGIVIPDSA-AEKQDQGTVVALGPGKKDSEGARVPMEVRLGDRVLFGKYAGQSIKVDDEDLMVMREEDIVAVI 95
>gi|118054049|ref|ZP_01522591.1| chaperonin Cpn10 [Comamonas testosteroni KF-1] >gi|117998843|gb|EAV13005.1| chaperonin Cpn10 [Comamonas testosteroni KF-1] (96 aa)
Score = 134, Expect = 6.7e-07, Identities = 35/90 (38%), Positives = 52/90 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E ET T +GIVLP++   +KP  G + ++     N        N+ VG  V F +Y    +K+   E LV++ DD+  V+ K
  S:     1 MNLRPLHDRVIVKRLENETKTASGIVLPDAA-TEKPDQGEVLAVGPGKRNDKGELIALNVKVGDRVLFGKYSGQTVKIHGDELLVMKEDDLFAVVEK 96
>gi|15793473|ref|NP_283295.1| co-chaperonin GroES [Neisseria meningitidis Z2491] >gi|23813818|sp|Q9JWA3|CH10_NEIMA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|121051460|emb|CAM07753.1| chaperonin 10 Kd subunit [Neisseria meningitidis Z2491] (96 aa)
Score = 134, Expect = 6.8e-07, Identities = 35/90 (38%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++ VG  + F +Y    +K D +E LV+  +DI G++ K
  S:     1 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGARRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK 96
>gi|3913226|sp|O33499|CH10_PSEST 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock protein 10) >gi|2564287|emb|CAA74153.1| Hsp10 protein [Pseudomonas stutzeri] (97 aa)
Score = 134, Expect = 7.0e-07, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95
>gi|187477089|ref|YP_785113.1| 10 kDa chaperonin [Bordetella avium 197N] >gi|123738607|sp|Q2KXY8|CH10_BORA1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|115421675|emb|CAJ48185.1| 10 kDa chaperonin [Bordetella avium 197N] (95 aa)
Score = 134, Expect = 7.1e-07, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + E  T +GIV+P+S  A+KP  G +       K+   +I   +L VG  V F +Y    +KVD +E LV+  ++IL V+
  S:     1 MALRPLHDRVIVKRLDNERKTASGIVIPDSA-AEKPDQGEVLAVGPGKKTEDGKILPVDLKVGDKVLFGKYAGQGVKVDGEELLVIREEEILAVI 94
>gi|124483632|emb|CAM32689.1| Co-chaperonin GroES (HSP10) protein [Herbaspirillum seropedicae] (96 aa)
Score = 134, Expect = 7.3e-07, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIVLP++   +KP  G + ++ +       ++   ++ VG  V F +Y    +K+D QE LV+  +D+  V+ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVLPDAA-TEKPDQGEVLAVGNGKILEDGKVRPLSVKVGDRVLFGKYSGQAVKIDGQELLVMREEDLFAVVEK 96
>gi|70732164|ref|YP_261920.1| co-chaperonin GroES [Pseudomonas fluorescens Pf-5] >gi|123775847|sp|Q4K763|CH10_PSEF5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|68346463|gb|AAY94069.1| chaperonin, 10 kDa [Pseudomonas fluorescens Pf-5] (97 aa)
Score = 134, Expect = 7.4e-07, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G I ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEIVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95
>gi|148266316|ref|YP_001233022.1| co-chaperonin GroES [Geobacter uraniireducens Rf4] >gi|189044105|sp|A5G9I1|CH10_GEOUR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|146399816|gb|ABQ28449.1| chaperonin Cpn10 [Geobacter uraniireducens Rf4] (96 aa)
Score = 134, Expect = 7.4e-07, Identities = 33/90 (36%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RP+  R+++KR E ET T  GI +P +   +KP  G + ++ +       ++   ++ VG  V F +Y   +IKV+ Q++L++  DDILGV+ K
  S:     1 MKLRPMQDRIIVKRVEEETKTAGGIFIPETAK-EKPMEGEVVAVGNGKRTEDGKVLPLDVKVGDKVLFGKYSGTEIKVEGQDFLIMREDDILGVIEK 96
>gi|91782028|ref|YP_557234.1| co-chaperonin GroES [Burkholderia xenovorans LB400] >gi|187922866|ref|YP_001894508.1| chaperonin Cpn10 [Burkholderia phytofirmans PsJN] >gi|91685982|gb|ABE29182.1| 10 kDa chaperonin, GroES [Burkholderia xenovorans LB400] >gi|187714060|gb|ACD15284.1| chaperonin Cpn10 [Burkholderia phytofirmans PsJN] (96 aa)
Score = 134, Expect = 7.5e-07, Identities = 35/90 (38%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P +  A+KP  G I ++     +        ++ VG  V F +Y    +KVD  E LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPEAA-AEKPDQGEILAVGPGKRDDKGAQIALDVKVGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVVQK 96
>gi|90426196|ref|YP_534566.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB18] >gi|90108210|gb|ABD90247.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB18] (98 aa)
Score = 134, Expect = 7.7e-07, Identities = 31/86 (36%), Positives = 56/86 (65%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV++KR + E+ TK GI++P+S   +KP  G + ++       + ++   ++  G  V F ++   +IK+D +E L+++  DI+GVL
  S:     6 FRPLHDRVVVKRIDAESKTKGGIIIPDSAK-EKPQEGQVVAVGPGGRDEAGKLIPIDIKTGDRVLFGKWSGTEIKLDGEELLIMKESDIMGVL 97
>gi|186477085|ref|YP_001858555.1| chaperonin Cpn10 [Burkholderia phymatum STM815] >gi|184193544|gb|ACC71509.1| chaperonin Cpn10 [Burkholderia phymatum STM815] (96 aa)
Score = 134, Expect = 7.9e-07, Identities = 34/90 (37%), Positives = 54/90 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD  E LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVVNK 96
>gi|110833494|ref|YP_692353.1| chaperonin, 10 kDa [Alcanivorax borkumensis SK2] >gi|122959630|sp|Q0VRW7|CH10_ALCBS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|110646605|emb|CAL16081.1| chaperonin, 10 kDa [Alcanivorax borkumensis SK2] (96 aa)
Score = 134, Expect = 7.9e-07, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RVL++R E ET +  GIVLP S  A+KPS G + ++       + ++   ++  G TV F +Y  + +KV+ +E L++   +IL V+
  S:     1 MSIRPLHDRVLVRREEEETKSAGGIVLPGSA-AEKPSRGEVIAVGNGKITENGDVRPLDVKAGDTVIFGQYSGSTVKVEGEELLIMSEAEILAVV 94
>gi|108805099|ref|YP_645036.1| chaperonin Cpn10 [Rubrobacter xylanophilus DSM 9941] >gi|123367993|sp|Q1ATQ4|CH10_RUBXD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|108766342|gb|ABG05224.1| chaperonin Cpn10 [Rubrobacter xylanophilus DSM 9941] (88 aa)
Score = 134, Expect = 7.9e-07, Identities = 31/88 (35%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PLG+R L+K  E E  T +GIVLP++   +  +  +I    SE  +  +  G  V F +Y   +I ++  +Y++++ DDILGV+
  S:     1 MKFKPLGERALVKLVEREEKTASGIVLPDTAKEKPQTAEVIAVGDSE--DIKVKEGDVVVFAKYSGTEISLNGDDYMILDADDILGVV 86
>gi|1345749|sp|P48226|CH10_PSEPU 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|468559|emb|CAA55198.1| GroES [Pseudomonas putida] (97 aa)
Score = 134, Expect = 8.0e-07, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G I ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEIVAVGTGRILENGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95
>gi|163732279|ref|ZP_02139725.1| chaperonin, 10 kDa [Roseobacter litoralis Och 149] >gi|161394577|gb|EDQ18900.1| chaperonin, 10 kDa [Roseobacter litoralis Och 149] (103 aa)
Score = 134, Expect = 8.1e-07, Identities = 29/88 (32%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P S   +KP+ G++       +  S E+    ++ G T+ F ++   ++ +D +E L+++  DILG++
  S:     1 MTFKPLHDRVLVRRVESEEKTSGGLIIPESAK-EKPAEGVVVACGEGARKDSGELIEMAVSEGDTILFGKWSGTEVTLDGEELLIMKESDILGII 94
>gi|153854391|ref|ZP_01995669.1| hypothetical protein DORLON_01664 [Dorea longicatena DSM 13814] >gi|149752917|gb|EDM62848.1| hypothetical protein DORLON_01664 [Dorea longicatena DSM 13814] (94 aa)
Score = 133, Expect = 8.3e-07, Identities = 30/87 (34%), Positives = 52/87 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGV 87
           M+  PLG RV+LK+   E TTK+GIV+P  +  +     +I      + N      ++T G  V + +Y    +++D++EY++V+ DDIL +
  S:     1 MKLVPLGDRVVLKQCVAEETTKSGIVIPGQSKEKPQQAEVIAVGPGGMVNGKEVEMHVTAGQQVIYSKYAGTNVEIDDEEYIIVKQDDILAI 92
>gi|15677803|ref|NP_274967.1| co-chaperonin GroES [Neisseria meningitidis MC58] >gi|23813819|sp|Q9JXM4|CH10_NEIMB 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|7227235|gb|AAF42302.1| chaperonin, 10 kDa [Neisseria meningitidis MC58] (96 aa)
Score = 133, Expect = 8.3e-07, Identities = 35/90 (38%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++ VG  + F +Y    +K D +E LV+  +DI G++ K
  S:     1 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGSRRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK 96
>gi|56476062|ref|YP_157651.1| chaperonins cpn10 (10 kDa subunit) [Azoarcus sp. EbN1] >gi|169182751|ref|ZP_02843265.1| chaperonin Cpn10 [Thauera sp. MZ1T] >gi|81677557|sp|Q5P7G1|CH10_AZOSE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|56312105|emb|CAI06750.1| Chaperonins cpn10 (10 kDa subunit) [Azoarcus sp. EbN1] >gi|169010159|gb|EDS56927.1| chaperonin Cpn10 [Thauera sp. MZ1T] (96 aa)
Score = 133, Expect = 8.5e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E  T +GIV+P+S   +KP  G + ++ +       ++    + VG  V F +Y    +KV+  E LV+  +DI+GV+
  S:     1 MKIRPLHDRVIVKRLEAERKTASGIVIPDSA-GEKPDQGEVLAVGNGKILDDGKVRPMAVKVGDKVLFGKYAGQTVKVEGDELLVMREEDIMGVV 94
>gi|84701594|ref|ZP_01016169.1| co-chaperonin GroES [Parvularcula bermudensis HTCC2503] >gi|84690840|gb|EAQ16680.1| co-chaperonin GroES [Parvularcula bermudensis HTCC2503] (95 aa)
Score = 133, Expect = 8.8e-07, Identities = 30/88 (34%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E +  T  GI++P++   +KP  G + ++ S       EI    L  G  + F ++   ++KVD ++ ++++  D+LG+L
  S:     1 MAFRPLHDRVLVRRVEEDERTAGGIIIPDTAK-EKPQQGEVVAVGSGARGDDNEIVPLELKAGDKILFGKWSGTEVKVDGEDLIIMKESDVLGIL 94
>gi|91978587|ref|YP_571246.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB5] >gi|91685043|gb|ABE41345.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB5] (98 aa)
Score = 133, Expect = 8.9e-07, Identities = 30/88 (34%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + FRPL  RV++KR + +T TK GI++P+S   +KP  G + ++       + ++   ++  G  V F ++   +IK+D +E L+++  DI+GV+
  S:     4 LNFRPLHDRVVVKRIDADTKTKGGIIIPDSAK-EKPQEGQVVAVGPGGRDEAGKLIPIDVKAGDRVLFGKWSGTEIKLDGEELLIMKESDIMGVV 97
>gi|121635632|ref|YP_975877.1| co-chaperonin GroES [Neisseria meningitidis FAM18] >gi|120867338|emb|CAM11109.1| chaperonin 10 Kd subunit [Neisseria meningitidis FAM18] (108 aa)
Score = 133, Expect = 9.0e-07, Identities = 35/90 (38%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++ VG  + F +Y    +K D +E LV+  +DI G++ K
  S:    13 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGARRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK 108
>gi|82703462|ref|YP_413028.1| co-chaperonin GroES [Nitrosospira multiformis ATCC 25196] >gi|123727099|sp|Q2Y6I5|CH10_NITMU 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|82411527|gb|ABB75636.1| Chaperonin Cpn10 [Nitrosospira multiformis ATCC 25196] (96 aa)
Score = 133, Expect = 9.1e-07, Identities = 34/88 (38%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR E E  T +GIV+P+S  A+KP  G I ++          +    + VG  V F +Y    +K+  +E LV+  +DI+GV+
  S:     1 MQIRPLHDRVIVKRLEEERKTASGIVIPDSA-AEKPDQGEIIAVGKGKVGDDGNVRPLEVKVGDKVLFGKYSGQTVKISGEELLVMREEDIMGVV 94
>gi|114764192|ref|ZP_01443430.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. HTCC2601] >gi|114543344|gb|EAU46360.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. HTCC2601] (97 aa)
Score = 133, Expect = 9.6e-07, Identities = 28/87 (32%), Positives = 56/87 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGV 87
           M F+PL  RVL++R E +  TK G+++P+S   +KP+ G++       +  + E+ +  ++ G  V F ++   ++ +D +E L+++  DILG+
  S:     1 MAFKPLHDRVLVRRVESDEKTKGGLIIPDSAK-EKPAEGVVVACGEGARKDNGELISMAVSEGDRVLFGKWSGTEVSIDGEELLIMKESDILGI 93
>gi|34498687|ref|NP_902902.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472] >gi|34104539|gb|AAQ60897.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472] (105 aa)
Score = 133, Expect = 9.6e-07, Identities = 32/88 (36%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R+++KR E    T +GIV+P+S  A+KP  G + ++          +    + VG  V F +Y    +K+++QEYLV+  +D+ GV+
  S:     1 MQIRPLHDRIIVKRVEKVRQTASGIVIPDSA-AEKPEQGEVLAVGPGKRLPDGTLLPMQVQVGDLVLFGKYGGQTVKLNDQEYLVLREEDVFGVV 94
>gi|84499754|ref|ZP_00998042.1| chaperonin, 10 kDa [Oceanicola batsensis HTCC2597] >gi|84392898|gb|EAQ05109.1| chaperonin, 10 kDa [Oceanicola batsensis HTCC2597] (103 aa)
Score = 133, Expect = 1.0e-06, Identities = 30/88 (34%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL+KR E E  T  G+++P+S   +KP+ G + ++       N       +  G  V F ++   ++ +D QE L+++  DILG++
  S:     1 MAFKPLHDRVLVKRVESEEKTAGGLIIPDSAK-EKPAEGEVVAVGEGARKDNGELIEMAVKAGDKVLFGKWSGTEVTIDGQELLIMKESDILGII 94
>gi|77460723|ref|YP_350230.1| co-chaperonin GroES [Pseudomonas fluorescens PfO-1] >gi|123603461|sp|Q3K7L5|CH10_PSEPF 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|77384726|gb|ABA76239.1| Chaperonin Cpn10 [Pseudomonas fluorescens PfO-1] (97 aa)
Score = 133, Expect = 1.0e-06, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E  T  GIVLP S  A+K ++G I ++       S E+   ++ VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEEKKTAGGIVLPGSA-AEKANHGEILAVGPGKALESGEVRALSVKVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVI 95
>gi|170691218|ref|ZP_02882383.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] >gi|170143423|gb|EDT11586.1| chaperonin Cpn10 [Burkholderia graminis C4D1M] (96 aa)
Score = 133, Expect = 1.0e-06, Identities = 35/90 (38%), Positives = 53/90 (58%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +GIV+P +  A+KP  G I ++     +        ++ VG  V F +Y    +KVD  E LV+  +DI+ V+ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPEAA-AEKPDQGEILAVGPGKRDDKGAQIALDVKVGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVVNK 96
>gi|167586345|ref|ZP_02378733.1| co-chaperonin GroES [Burkholderia ubonensis Bu] (100 aa)
Score = 133, Expect = 1.1e-06, Identities = 33/88 (37%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M   PL  RVL++R E E  T TGIV+P++  A+KP  G + ++              ++ VG  V F +Y    +KV+ +E LV+  DD+L V+
  S:     1 MRLSPLHDRVLIRRLEQERKTATGIVIPDTA-AEKPDQGEVLAVGPGKRMEDGRRCEPDVKVGDRVLFGKYAGTTVKVEGEELLVMREDDLLAVI 94
>gi|163793753|ref|ZP_02187727.1| co-chaperonin GroES [alpha proteobacterium BAL199] >gi|159180864|gb|EDP65381.1| co-chaperonin GroES [alpha proteobacterium BAL199] (105 aa)
Score = 132, Expect = 1.1e-06, Identities = 30/88 (34%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R E +  T  GI++P++   +KP  G I ++       S +I   ++  G  V F ++   ++K+D ++ L+++  DI+GVL
  S:     1 MKFRPLHDRVVVRRIEADKKTAGGIIIPDTVK-EKPQEGEILAVGPGARDESGKIQPLDVKAGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGVL 94
>gi|104783430|ref|YP_609928.1| co-chaperonin GroES [Pseudomonas entomophila L48] >gi|123255323|sp|Q1I5E1|CH10_PSEE4 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|95112417|emb|CAK17144.1| chaperone Hsp10, affects cell division [Pseudomonas entomophila L48] (97 aa)
Score = 132, Expect = 1.1e-06, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEVVAVGTGRILDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95
>gi|29839400|sp|Q9F4F0|CH10_BUCPS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|10443157|emb|CAC10477.1| GroES [Buchnera aphidicola (Pemphigus spyrothecae)] (97 aa)
Score = 132, Expect = 1.1e-06, Identities = 37/88 (42%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR EVE+ +  GIVL  S  A K + GI+ ++       + E+   ++ +G TV F E Y A   K+DN+E+L++   DIL V+
  S:     1 MNIRPLHDRVIIKRQEVESKSAGGIVLTGSA-AGKSTRGIVTAVGNGRVLDNGELKALDVKIGDTVIFSEGYGAKIEKIDNEEFLILTESDILAVV 95
>gi|134047194|ref|YP_001102019.1| 10 kDa chaperonin GroS [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|133905113|gb|ABO41128.1| 10 kDa chaperonin GroS [Salmonella enterica subsp. enterica serovar Newport str. SL254] (106 aa)
Score = 132, Expect = 1.1e-06, Identities = 33/88 (37%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RV++KR+E E  +  GIV+P+S   +KP  G + ++       +  +    + VG  V F +Y   ++K+D  EYLVV+ DDI  VL
  S:    12 INIKPLYDRVVIKRTEEEKVSAGGIVIPDSA-TEKPIKGQVVAVGEGKVFDNGNVRAPKVKVGDQVLFGKYAGTEVKLDGTEYLVVKEDDIFAVL 105
>gi|147678942|ref|YP_001213157.1| Co-chaperonin GroES [Pelotomaculum thermopropionicum SI] >gi|146275039|dbj|BAF60788.1| Co-chaperonin GroES [Pelotomaculum thermopropionicum SI] (95 aa)
Score = 132, Expect = 1.1e-06, Identities = 35/87 (40%), Positives = 55/87 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSE--INNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           RPLG RV++K    E  TK GIVLP++   +KP  G + ++ S   + N      +L  G  + F +Y  N++K+D+ EYL++   D+LGV+ K
  S:     3 RPLGDRVVVKPLPSEERTKGGIVLPDTAK-EKPQEGEVVAVGSGRLLENGQRVPIDLKPGDRILFSKYAGNEVKIDDVEYLIMREADVLGVIEK 95
>gi|196193035|gb|EDX87994.1| chaperonin GroS [Alcanivorax sp. DG881] (96 aa)
Score = 132, Expect = 1.2e-06, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RVL++R E ET T  GIVLP S  A+KPS G + ++       + ++   ++  G  V F +Y  + +KV+ +E L++   +IL V+
  S:     1 MSIRPLHDRVLVRREEEETKTAGGIVLPGSA-AEKPSRGEVIAVGNGKITENGDVRPLDVKAGDKVIFGQYAGSTVKVEGEELLIMSEAEILAVV 94
>gi|189011840|emb|CAQ30436.1| heat shock protein [Helicobacter pylori] (100 aa)
Score = 132, Expect = 1.2e-06, Identities = 26/68 (38%), Positives = 47/68 (69%)
  Q:    21 TKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           T +G+++P+ N  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     3 TSSGVIIPD-NAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 71
>gi|118444966|ref|YP_878934.1| co-chaperonin GroES [Clostridium novyi NT] >gi|168186044|ref|ZP_02620679.1| chaperonin GroS [Clostridium botulinum C str. Eklund] >gi|166233998|sp|A0Q2T2|CH10_CLONN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|118135422|gb|ABK62466.1| chaperonin, 10 kDa [Clostridium novyi NT] >gi|169296076|gb|EDS78209.1| chaperonin GroS [Clostridium botulinum C str. Eklund] (94 aa)
Score = 132, Expect = 1.2e-06, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E  TK+GIVLP S      +A+  + G    +  +     + VG  V F +Y   ++K+D +EY ++  +DIL ++
  S:     1 MRIKPLGDRVVIKRLEAEEKTKSGIVLPGSAKEKPQEAEIVAVGPGGLVDGKEVRMEVKVGDKVLFSKYSGTEVKLDGEEYTILRQNDILAIV 93
>gi|399241|sp|Q02073|CH10C_SPIOL 20 kDa chaperonin, chloroplast precursor (Protein Cpn21) (Chloroplast chaperonin 10) (Chloroplast protein Cpn10) (Ch-CPN10) >gi|170107|gb|AAB59307.1| chaperonin 10 (255 aa)
Score = 132, Expect = 1.2e-06, Identities = 35/85 (41%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS--EINNSNLTV----GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RVL+K   VE  T +GI LP +   +KP  G + +I S  ++ +  L V    GA V + +Y   +I+VD   +L+V+ DDI+G+L
  S:    65 KPLGDRVLIKTKIVEEKTTSGIFLPTAAQ-KKPQSGEVVAIGSGKKVGDKKLPVAVKTGAEVVYSKYTGTEIEVDGSSHLIVKEDDIIGIL 154
Score = 115, Expect = 1.2e-04, Identities = 33/87 (37%), Positives = 54/87 (62%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS-----ISSEINNSNLTV--GATVYFKEYKANQIK-VDNQEYLVVELDDILGVL 88
           + +PL  R+L+K +EVE  T  G++L  S+  +KPS+G + +     +  E N   L V  G TV + +Y  N  K VD  +Y+V+ + D++ VL
  S:   161 DLKPLNDRLLIKVAEVENKTSGGLLLAESSK-EKPSFGTVVATGPGVLDEEGNRIPLPVCSGNTVLYSKYAGNDFKGVDGSDYMVLRVSDVMAVL 254
>gi|146308702|ref|YP_001189167.1| co-chaperonin GroES [Pseudomonas mendocina ymp] >gi|166198398|sp|A4XYL9|CH10_PSEMY 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|145576903|gb|ABP86435.1| chaperonin Cpn10 [Pseudomonas mendocina ymp] (97 aa)
Score = 132, Expect = 1.2e-06, Identities = 37/88 (42%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNQGEVVAVGTGKVLENGEVRPLAVKVGDKVVFGPYSGSNTVKVDGEDLLVMGENEILAVI 95
>gi|152983288|ref|YP_001354341.1| 10 kDa chaperonin [Janthinobacterium sp. Marseille] >gi|166198378|sp|A6T1E4|CH10_JANMA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|151283365|gb|ABR91775.1| 10 kDa chaperonin (Protein Cpn10) [Janthinobacterium sp. Marseille] (96 aa)
Score = 132, Expect = 1.2e-06, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +G+++P +  A+KP  G I +I +       ++   ++ VG  V F +Y    +KVD  E LV+  +DI+ ++ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGLIIPEAA-AEKPDQGEILAIGNGKILEDGKVRPLDVKVGDRVLFGKYAGQTVKVDGNEVLVMREEDIMAIVQK 96
>gi|156741198|ref|YP_001431327.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941] >gi|156232526|gb|ABU57309.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941] (101 aa)
Score = 132, Expect = 1.2e-06, Identities = 31/85 (36%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-EINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV++K  E E  TK GI LP++   ++P  G + ++    I+++      N+  G  V F +Y   + K+D+ EYL++   DILG++
  S:     8 RPLADRVVVKPVEREEKTKGGIYLPDTASKERPMEGTVLAVGEGRIDDNGKRIPMNVKAGDRVIFAKYSGTEFKIDDVEYLILSEKDILGII 99
>gi|167035480|ref|YP_001670711.1| co-chaperonin GroES [Pseudomonas putida GB-1] >gi|189044115|sp|B0KFQ3|CH10_PSEPG 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166861968|gb|ABZ00376.1| chaperonin Cpn10 [Pseudomonas putida GB-1] (97 aa)
Score = 132, Expect = 1.2e-06, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEVVAVGTGRILENGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95
>gi|161869235|ref|YP_001598402.1| co-chaperonin GroES [Neisseria meningitidis 053442] >gi|189044111|sp|A9M0Q5|CH10_NEIM0 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|161594788|gb|ABX72448.1| chaperonin 10 Kd subunit [Neisseria meningitidis 053442] (95 aa)
Score = 132, Expect = 1.3e-06, Identities = 34/88 (38%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++ VG  + F +Y    +K D +E LV+  +DI G++
  S:     1 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGARRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIV 94
>gi|23015494|ref|ZP_00055268.1| COG0234: Co-chaperonin GroES (HSP10) [Magnetospirillum magnetotacticum MS-1] (95 aa)
Score = 132, Expect = 1.3e-06, Identities = 30/88 (34%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RVL+KR + E  T  GI++P++   +KP  G + ++ S            ++  G  V F ++   ++K+D  + L+++  DILG+L
  S:     1 MKFRPLHDRVLVKRLDAEEKTAGGIIIPDTAK-EKPMQGEVVAVGSGTRGDDGKLVALDVKAGDRVLFGKWSGTEVKIDGVDLLIMKESDILGIL 94
>gi|189425978|ref|YP_001953155.1| chaperonin Cpn10 [Geobacter lovleyi SZ] >gi|189422237|gb|ACD96635.1| chaperonin Cpn10 [Geobacter lovleyi SZ] (96 aa)
Score = 132, Expect = 1.3e-06, Identities = 30/90 (33%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  R+++KR E E  T  G+ +P++   +KP  G + ++ +   N        ++ VG ++ F +Y   ++KVD  E+L++  DD+L V+ K
  S:     1 MKLRPLHDRIIVKRLEGEEKTAGGLFIPDTAK-EKPQKGEVIAVGNGKKNDEGKCAPLDVKVGDSILFGKYAGTEVKVDGDEFLMMREDDVLAVIEK 96
>gi|67156123|ref|ZP_00417749.1| Chaperonin Cpn10 [Azotobacter vinelandii AvOP] >gi|67086453|gb|EAM05922.1| Chaperonin Cpn10 [Azotobacter vinelandii AvOP] (97 aa)
Score = 132, Expect = 1.3e-06, Identities = 37/88 (42%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE ET T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N IKVD ++ LV+  ++I  V+
  S:     1 MKLRPLHDRVVIRRSEEETKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRPLAVKVGDKVVFGPYSGSNTIKVDGEDLLVMGENEIFAVV 95
>gi|134095719|ref|YP_001100794.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Herminiimonas arsenicoxydans] >gi|166198377|sp|A4G836|CH10_HERAR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|133739622|emb|CAL62673.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Herminiimonas arsenicoxydans] (96 aa)
Score = 132, Expect = 1.3e-06, Identities = 32/90 (35%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR + ET T +G+++P +  A+KP  G + +I +       ++   ++ VG  V F +Y    +KVD  E LV+  +DI+ ++ K
  S:     1 MNLRPLHDRVIVKRLDQETKTASGLIIPEAA-AEKPDQGEVLAIGNGKILDDGKVRPLDVKVGDRVLFGKYAGQSVKVDGNEVLVMREEDIMAIVQK 96
>gi|89069035|ref|ZP_01156416.1| Chaperonin Cpn10 (GroES) [Oceanicola granulosus HTCC2516] >gi|89045404|gb|EAR51469.1| Chaperonin Cpn10 (GroES) [Oceanicola granulosus HTCC2516] (103 aa)
Score = 132, Expect = 1.4e-06, Identities = 28/88 (31%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E +  TK G+++P+ N  +KP+ G++ ++ +   +        ++  G  + F ++   ++ VD +E L+++  DILGV+
  S:     1 MAFKPLHDRVLVRRVESDEKTKGGLIIPD-NAKEKPAEGLVIAVGAGAKDEDGDRIAMDVKEGDRILFGKWSGTEVTVDGEELLIMKESDILGVI 94
>gi|83591925|ref|YP_425677.1| chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170] >gi|83574839|gb|ABC21390.1| Chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170] (95 aa)
Score = 132, Expect = 1.4e-06, Identities = 28/88 (31%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RVL+KR E E  T  GI++P++   +KP  G + ++ S       ++   ++  G  + F ++   ++K+D  ++L+++  DI+G++
  S:     1 MKFRPLHDRVLVKRLEGEEKTAGGIIIPDTAK-EKPMEGEVVAVGSGARGDDGKVVALDVKAGDRILFGKWSGTEVKIDGTDFLIMKESDIMGIV 94
>gi|78065428|ref|YP_368197.1| co-chaperonin GroES [Burkholderia sp. 383] >gi|77966173|gb|ABB07553.1| Chaperonin Cpn10, groES protein [Burkholderia sp. 383] (97 aa)
Score = 131, Expect = 1.4e-06, Identities = 33/88 (37%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + ET T +GIV+P++  A+KP  G + ++     +        ++ VG  V F +Y    +KVD  E LV+  +DI+ V+
  S:     1 MNLRPLHDRVIVKRLDQETKTASGIVIPDAA-AEKPDQGEVLAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVV 94
>gi|170720153|ref|YP_001747841.1| chaperonin Cpn10 [Pseudomonas putida W619] >gi|169758156|gb|ACA71472.1| chaperonin Cpn10 [Pseudomonas putida W619] (97 aa)
Score = 131, Expect = 1.4e-06, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEVVAVGTGRILDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95
>gi|114797690|ref|YP_760662.1| chaperonin, 10 kDa [Hyphomonas neptunium ATCC 15444] >gi|123027971|sp|Q0C0T1|CH10_HYPNA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|114737864|gb|ABI75989.1| chaperonin, 10 kDa [Hyphomonas neptunium ATCC 15444] (96 aa)
Score = 131, Expect = 1.4e-06, Identities = 33/90 (36%), Positives = 58/90 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-SSEINNSNLTV------GATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R + E  TK GI++P+ N  +KP  GII ++ +  I + N  V      G  V F ++   ++K+D ++ L+++  DI+G+L K
  S:     1 MKLRPLHDRVVVRRVKEEEKTKGGIIIPD-NAKEKPQEGIIVAVGNGAIGDDNERVPLDVKKGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGILDK 96
>gi|26988094|ref|NP_743519.1| co-chaperonin GroES [Pseudomonas putida KT2440] >gi|148549569|ref|YP_001269671.1| co-chaperonin GroES [Pseudomonas putida F1] >gi|166198399|sp|A5W8M7|CH10_PSEP1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|60389776|sp|Q88N56|CH10_PSEPK 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|24982820|gb|AAN66983.1|AE016326_9 chaperonin, 10 kDa [Pseudomonas putida KT2440] >gi|148513627|gb|ABQ80487.1| chaperonin Cpn10 [Pseudomonas putida F1] (97 aa)
Score = 131, Expect = 1.4e-06, Identities = 36/88 (40%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++RSE E+ T  GIVLP S  A+KP+ G + ++ +       E+    + VG  V F  Y  +N +KVD ++ LV+  ++IL V+
  S:     1 MKLRPLHDRVVIRRSEEESKTAGGIVLPGSA-AEKPNRGEVVAVGTGRVLDNGEVRALAVKVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVV 95
>gi|162451052|ref|YP_001613419.1| GroES-like protein [Sorangium cellulosum 'So ce 56'] >gi|161161634|emb|CAN92939.1| GroES-like protein [Sorangium cellulosum 'So ce 56'] (98 aa)
Score = 131, Expect = 1.5e-06, Identities = 30/87 (34%), Positives = 57/87 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGV 87
           M+ RPL  R+++KR E ET TK GI++P++   +KP  G + ++ +       ++   ++ VG  V F +Y   ++K+D +E++++  DD+L V
  S:     1 MKIRPLQDRIVVKRVESETKTKGGIIIPDAAK-EKPIEGRVVAVGNGKVLKDGKVRPLDVKVGDKVLFGKYSGTEVKLDGEEHVLIREDDVLAV 93
>gi|91202876|emb|CAJ72515.1| strongly similar to chaperonin-10 [Candidatus Kuenenia stuttgartiensis] (95 aa)
Score = 131, Expect = 1.5e-06, Identities = 33/88 (37%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG+++LLKR E E  T  GI+LP +   +KP  G + ++       + E     +  G  V F  Y + ++K+D  EYL++  DDIL V+
  S:     1 MNVKPLGEKILLKRLEAEGKTAGGILLPETAK-EKPKQGTVIALGDGKLLENGERARFQVKNGDKVLFNSYGSTEVKIDGDEYLLMSEDDILAVI 94
>gi|167766271|ref|ZP_02438324.1| hypothetical protein CLOSS21_00775 [Clostridium sp. SS2/1] >gi|167711990|gb|EDS22569.1| hypothetical protein CLOSS21_00775 [Clostridium sp. SS2/1] (90 aa)
Score = 131, Expect = 1.5e-06, Identities = 32/88 (36%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI--SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG RV+LK+ E ETTTK+GIVL  +   +KP    + ++   +E     ++VG  V + +Y   ++K++++E+++V+ +DIL V+
  S:     1 MKLTPLGDRVVLKQLEAETTTKSGIVLTTATQ-EKPQEAEVVAVGPGTEDVKMEVSVGQKVIYSKYAGTEVKLEDEEFIIVKQNDILAVV 89
>gi|153006552|ref|YP_001380877.1| chaperonin Cpn10 [Anaeromyxobacter sp. Fw109-5] >gi|152030125|gb|ABS27893.1| chaperonin Cpn10 [Anaeromyxobacter sp. Fw109-5] (97 aa)
Score = 131, Expect = 1.6e-06, Identities = 30/87 (34%), Positives = 56/87 (64%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + RPL  R+++KR + E  TK GI++P+S   +KP  G + ++ +       ++   ++  G  + F +Y   +IK+D +E+L++  DDILGV+
  S:     3 KIRPLQDRIIVKRVQEEEKTKGGIIIPDSAK-EKPIEGKVIAVGNGKVQEDGKVRPLDVKAGDRILFSKYAGTEIKIDGEEHLIMREDDILGVI 95
>gi|16262518|ref|NP_435311.1| co-chaperonin GroES [Sinorhizobium meliloti 1021] >gi|20143871|sp|Q930X9|CH103_RHIME 10 kDa chaperonin 3 (Protein Cpn10 3) (groES protein 3) >gi|14523125|gb|AAK64723.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021] (105 aa)
Score = 131, Expect = 1.6e-06, Identities = 27/88 (30%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R+E  T +K GI++P++   +KP  G + ++       S ++   ++ +G T+ F ++   ++K+D ++ L+++  DI+G++
  S:     1 MTFRPLLDRVVIRRAEGNTQSKGGIIIPDTAK-EKPQEGEVIAVGPGSRDESGKLIPLDVKIGDTILFGKWSGTEVKIDGEDLLIMKESDIMGIV 94
>gi|194100043|ref|YP_002003183.1| co-chaperonin GroES [Neisseria gonorrhoeae NCCP11945] >gi|193935333|gb|ACF31157.1| co-chaperonin GroES [Neisseria gonorrhoeae NCCP11945] (115 aa)
Score = 131, Expect = 1.6e-06, Identities = 34/90 (37%), Positives = 52/90 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++  G  + F +Y    +K D +E LV+  +DI G++ K
  S:    20 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGARRPLDVKAGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK 115
>gi|167357834|ref|ZP_02292497.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075323|gb|EDR79136.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] (104 aa)
Score = 131, Expect = 1.6e-06, Identities = 27/88 (30%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + +  TK GI++P++   +KP  G + +I S       +I   ++ VG  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVRRVDSQEKTKGGIIIPDTAK-EKPQEGEVIAIGSGARNEAGQIQALDVKVGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|118590678|ref|ZP_01548079.1| co-chaperonin GroES [Stappia aggregata IAM 12614] >gi|118436654|gb|EAV43294.1| co-chaperonin GroES [Stappia aggregata IAM 12614] (95 aa)
Score = 131, Expect = 1.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R + E  T  GI++P++   +KP  G I +I +       EI   ++  G  V F ++   ++K+D ++ L+++  DI+GV+
  S:     1 MAFRPLHDRVVVRRVDSEAKTAGGIIIPDTAK-EKPQEGEIIAIGTGARKDNGEIVPLDVKAGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGVI 94
>gi|86356878|ref|YP_468770.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] >gi|86280980|gb|ABC90043.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (104 aa)
Score = 131, Expect = 1.7e-06, Identities = 27/88 (30%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++       + +I   ++ VG  + F ++   +IK++ ++ L+++  D++GV+
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNDAGQIQPLDVKVGDRILFGKWSGTEIKINGEDLLIMKESDVMGVI 94
>gi|148658219|ref|YP_001278424.1| chaperonin Cpn10 [Roseiflexus sp. RS-1] >gi|148570329|gb|ABQ92474.1| chaperonin Cpn10 [Roseiflexus sp. RS-1] (101 aa)
Score = 131, Expect = 1.7e-06, Identities = 32/85 (37%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-EINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV++K  E E  TK GI LP++   ++P  G + ++    I+++      N+  G  V F +Y   + KVD+ EYL++   DILG++
  S:     8 RPLADRVVVKPVEREEKTKGGIYLPDTASKERPMEGTVLAVGEGRIDDNGKRIPMNVKPGDRVIFAKYSGTEFKVDDVEYLILSEKDILGII 99
>gi|160872034|ref|ZP_02062166.1| chaperonin GroS [Rickettsiella grylli] >gi|159120833|gb|EDP46171.1| chaperonin GroS [Rickettsiella grylli] (106 aa)
Score = 130, Expect = 1.8e-06, Identities = 29/84 (34%), Positives = 54/84 (64%)
  Q:     5 PLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           P+  R+L+KR + E  +  GIV+P++   +KP  G++ ++       S +I    + VG  +YF +Y   +IK+D +EYL++  DD+L ++
  S:    15 PMNDRILVKRDDEEEKSVGGIVIPDTAK-EKPVRGLVVAVGNGKRLKSGQIQALTIKVGDKIYFGKYSGTEIKLDGKEYLIMREDDVLALI 104
>gi|59802395|ref|YP_209107.1| co-chaperonin GroES [Neisseria gonorrhoeae FA 1090] >gi|75507270|sp|Q5F542|CH10_NEIG1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|2493655|sp|P77913|CH10_NEIGO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|1513097|gb|AAC45326.1| GroES [Neisseria gonorrhoeae] >gi|59719290|gb|AAW90695.1| putative chaperonin 10 kDa subunit [Neisseria gonorrhoeae FA 1090] (96 aa)
Score = 130, Expect = 1.9e-06, Identities = 34/90 (37%), Positives = 52/90 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  RV++KR E E  T +GIVLP +  A+KP  G +I   + +I         ++  G  + F +Y    +K D +E LV+  +DI G++ K
  S:     1 MTIRPLHDRVVVKRLEAEEKTASGIVLPGAA-AEKPDMGEVIAVGAGKIGKDGARRPLDVKAGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK 96
>gi|83596012|gb|ABC25371.1| chaperonin, 10 kDa [uncultured marine bacterium Ant29B7] (92 aa)
Score = 130, Expect = 1.9e-06, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLT--VGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  RPL  RV+++ +  ETTT +GI++P++   +KP  GI+ +  +   +  +T  VG TV + +Y   + K + ++YL++   DIL ++
  S:     4 LNIRPLADRVIIEPAAAETTTASGIIIPDTAQ-EKPQKGIVVAAGNGKVDEPMTVAVGDTVLYGKYAGTEFKFEGEDYLILRESDILAII 92
>gi|148254474|ref|YP_001239059.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1] >gi|146406647|gb|ABQ35153.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Bradyrhizobium sp. BTAi1] (104 aa)
Score = 130, Expect = 2.0e-06, Identities = 29/88 (32%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R + E  TK GI++P++   +KP  G I +      N        ++  G  V F ++   ++K+D ++ L+++  D+LG++
  S:     1 MHFRPLHDRVLVRRIDAEEKTKGGIIIPDTAK-EKPQEGEIVAAGPGARNEQGQLVPLDVKPGDRVLFGKWSGTEVKIDGKDLLIMKESDLLGII 94
>gi|190890942|ref|YP_001977484.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] >gi|190696221|gb|ACE90306.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] (104 aa)
Score = 130, Expect = 2.0e-06, Identities = 25/88 (28%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++       + ++   ++ VG  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARDDAGQVQALDVKVGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|103487559|ref|YP_617120.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256] >gi|98977636|gb|ABF53787.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256] (104 aa)
Score = 130, Expect = 2.0e-06, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R E E  +  GI++P++   +KP  G + ++          +   ++ VG  V F ++   ++++D ++ L+++  DILGV+
  S:     1 MHFRPLHDRVVVRRIEAEEKSSGGIIIPDTAK-EKPQEGEVVAVGPGARAEDGTVTAPDVRVGDRVLFGKWSGTEVRIDGEDLLIMKESDILGVI 94
>gi|163700516|ref|ZP_02119370.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] >gi|162433254|gb|EDQ43844.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060] (95 aa)
Score = 130, Expect = 2.1e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RV+++R E E  TK GI++P++   +KP  G I ++     +        ++  G  V F ++   ++++D Q+ L+++  DI+GVL
  S:     1 MTFQPLHDRVVVRRIEAEEKTKGGIIIPDTAK-EKPQEGEIVAVGPGARDETGKLVPLDVKTGDRVLFGKWSGTEVRIDGQDLLIMKESDIMGVL 94
>gi|196017870|ref|XP_002118666.1| hypothetical protein TRIADDRAFT_34560 [Trichoplax adhaerens] >gi|190578506|gb|EDV18846.1| hypothetical protein TRIADDRAFT_34560 [Trichoplax adhaerens] (94 aa)
Score = 130, Expect = 2.2e-06, Identities = 32/88 (36%), Positives = 58/88 (65%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII----KSISSEINNS---NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T++GI++P++   +KP  G +    K I  E  N    ++ VG  + F ++   ++K++ +EYL+++  DILG++
  S:     1 MNFQPLHDRVLVERLEQENKTESGIIIPDTAK-EKPMQGKVIAAGKGIKDEKGNVSPLDVKVGDKILFAKWGGTEVKLEGKEYLIMKESDILGIV 94
>gi|163758404|ref|ZP_02165492.1| co-chaperonin GroES [Hoeflea phototrophica DFL-43] >gi|162284693|gb|EDQ34976.1| co-chaperonin GroES [Hoeflea phototrophica DFL-43] (98 aa)
Score = 130, Expect = 2.2e-06, Identities = 28/87 (32%), Positives = 56/87 (64%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R E E  TK GI++P++   +KP  G + ++ + + +        ++  G  V F ++   ++K+D ++ L+++  DI+GVL
  S:     5 KFRPLHDRVVVRRVESEEKTKGGIIIPDTAK-EKPQEGEVIAVGTGVRDDAGKLVALDVKAGDRVLFGKWSGTEVKLDGEDLLIMKESDIMGVL 97
>gi|110680678|ref|YP_683685.1| co-chaperonin GroES [Roseobacter denitrificans OCh 114] >gi|109456794|gb|ABG32999.1| chaperonin, 10 kDa [Roseobacter denitrificans OCh 114] (103 aa)
Score = 130, Expect = 2.3e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P S   +KP+ GI+       +  S E+    ++ G  + F ++   ++ +D +E L+++  DILG++
  S:     1 MTFKPLHDRVLVRRVESEEKTSGGLIIPESAK-EKPAEGIVVACGEGARKDSGELIEMAVSEGDKILFGKWSGTEVTLDGEELLIMKESDILGII 94
>gi|167748020|ref|ZP_02420147.1| hypothetical protein ANACAC_02758 [Anaerostipes caccae DSM 14662] >gi|167652538|gb|EDR96667.1| hypothetical protein ANACAC_02758 [Anaerostipes caccae DSM 14662] (90 aa)
Score = 130, Expect = 2.3e-06, Identities = 32/88 (36%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV+LK+ E ETTTK+GIVL  ++  +KP    + ++    +   + V  G  V + +Y   ++K  + EY++V+ +DIL V+
  S:     1 MNLKPLGDRVVLKQLEAETTTKSGIVLTTASQ-EKPQEAEVVAVGPGTDEVKMEVEKGQKVIYSKYAGTEVKCGDDEYIIVKQNDILAVV 89
>gi|15888026|ref|NP_353707.1| co-chaperonin GroES [Agrobacterium tumefaciens str. C58] >gi|20141228|sp|P30780|CH10_AGRT5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|15155642|gb|AAK86492.1| co-chaperonin GroES [Agrobacterium tumefaciens str. C58] (98 aa)
Score = 130, Expect = 2.3e-06, Identities = 29/86 (33%), Positives = 55/86 (63%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++ VG  V F ++   ++K+D ++ L+++  DI+G++
  S:     6 FRPLHDRVVVRRVESEAKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDEAGKVVALDVKVGDRVLFGKWSGTEVKLDGEDLLIMKEADIMGII 97
>gi|163858247|ref|YP_001632545.1| co-chaperonin GroES [Bordetella petrii DSM 12804] >gi|163261975|emb|CAP44277.1| 10 kDa chaperonin [Bordetella petrii] (95 aa)
Score = 130, Expect = 2.3e-06, Identities = 34/88 (38%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR + E  T +GIV+P+S  A+KP  G +       K+   ++   +L  G  V F +Y    +KVD +E LV+  ++IL V+
  S:     1 MALRPLHDRVIVKRLDNERKTASGIVIPDSA-AEKPDQGEVVAVGPGKKTEDGKVLPVDLKAGDKVLFGKYAGQSVKVDGEELLVIREEEILAVI 94
>gi|146329116|ref|YP_001210206.1| co-chaperonin GroES [Dichelobacter nodosus VCS1703A] >gi|166234001|sp|A5EX18|CH10_DICNV 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|146232586|gb|ABQ13564.1| co-chaperonin GroES [Dichelobacter nodosus VCS1703A] (95 aa)
Score = 129, Expect = 2.4e-06, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E E  +  GIVLP S  A+KPS G + ++       + E     +  G  + F +Y  +++KVD  +Y+++  D+I  V+
  S:     1 MNLRPLHDRVIVKRQEEEKVSAGGIVLPGSA-AEKPSQGEVIAVGEGKLLENGERRKMAVKAGDKILFGKYTGSEVKVDGVDYIIMREDEIFAVI 94
>gi|42526446|ref|NP_971544.1| co-chaperonin GroES [Treponema denticola ATCC 35405] >gi|60389692|sp|Q73P65|CH10_TREDE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|41816639|gb|AAS11425.1| chaperonin, 10 kDa [Treponema denticola ATCC 35405] (88 aa)
Score = 129, Expect = 2.4e-06, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ +PLG RVL+K   VET T  GI++P++   +K   G++ ++  +     ++VG  V   +Y   QI++D  ++L+++ +D++ V+
  S:     1 MKVKPLGDRVLVKPDAVETKTAGGIIIPDTAQ-EKTQRGVVVAVGDDKEKIKVSVGQKVIHDKYAGTQIQIDGVDHLILKSNDLVAVV 87
>gi|158321469|ref|YP_001513976.1| co-chaperonin GroES [Alkaliphilus oremlandii OhILAs] >gi|167008677|sp|A8MJJ8|CH10_ALKOO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|158141668|gb|ABW19980.1| chaperonin Cpn10 [Alkaliphilus oremlandii OhILAs] (94 aa)
Score = 129, Expect = 2.4e-06, Identities = 35/88 (39%), Positives = 49/88 (55%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKP-----SYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E TTK+GIVLP S   Q       + G    I  +     + VG  V F +Y   ++K D  EY +++  DIL V+
  S:     1 MNIKPLGDRVVIKRVEAEETTKSGIVLPGSAKEQPQLAEVMAVGPGGVIEGKEVVMEVKVGDKVIFSKYAGTEVKFDGVEYTILKQSDILAVV 93
>gi|85859565|ref|YP_461767.1| co-chaperonin [Syntrophus aciditrophicus SB] >gi|85722656|gb|ABC77599.1| co-chaperonin [Syntrophus aciditrophicus SB] (98 aa)
Score = 129, Expect = 2.4e-06, Identities = 29/88 (32%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS--SEINNSNL-----TVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+F+PL  R+++ R + E  T  GI++P++   +KP  G I ++      N+ N+       G  V F ++   + K+D QE+++++ DDILG++
  S:     3 MKFKPLHDRIVVSRVDAEEKTAGGIIIPDTAK-EKPQEGKIIAVGPGKRDNDGNIIPLDVKAGDRVLFSKWAGTEFKLDGQEHMIMKEDDILGII 96
>gi|146339699|ref|YP_001204747.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278] >gi|146192505|emb|CAL76510.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Bradyrhizobium sp. ORS278] (104 aa)
Score = 129, Expect = 2.5e-06, Identities = 29/88 (32%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R + E  TK GI++P++   +KP  G I +      N        ++  G  V F ++   ++K+D ++ L+++  D+LG++
  S:     1 MHFRPLHDRVLVRRIDAEEKTKGGIIIPDTAK-EKPQEGEIVAAGPGARNEQGQLVPLDVKPGDRVLFGKWSGTEVKIDGKDLLIMKESDLLGIV 94
>gi|134300707|ref|YP_001114203.1| chaperonin Cpn10 [Desulfotomaculum reducens MI-1] >gi|134053407|gb|ABO51378.1| chaperonin Cpn10 [Desulfotomaculum reducens MI-1] (94 aa)
Score = 129, Expect = 2.5e-06, Identities = 32/85 (37%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RV++K    E  TK+GIVLP++   +KP  G + ++       + +    +L  G  V+F +Y  N++K+D +EYL++   DIL V+
  S:     3 KPLGDRVVVKALPQEEKTKSGIVLPDTAK-EKPQQGEVVAVGPGRLLENGQRAALDLKAGDKVFFSKYAGNEVKLDEEEYLILREMDILAVI 93
>gi|126697766|ref|YP_001086663.1| 10 kDa chaperonin [Clostridium difficile 630] >gi|145956116|ref|ZP_01805113.1| hypothetical protein CdifQ_04000216 [Clostridium difficile QCD-32g58] >gi|168696064|ref|ZP_02728341.1| 10 kDa chaperonin [Clostridium difficile QCD-37x79] >gi|168714606|ref|ZP_02746883.1| 10 kDa chaperonin [Clostridium difficile QCD-63q42] >gi|168722947|ref|ZP_02755224.1| 10 kDa chaperonin [Clostridium difficile QCD-76w55] >gi|168732594|ref|ZP_02764871.1| 10 kDa chaperonin [Clostridium difficile QCD-97b34] >gi|196124358|ref|ZP_03116107.1| 10 kDa chaperonin [Clostridium difficile ATCC 43255] >gi|196161761|ref|ZP_03122322.1| 10 kDa chaperonin [Clostridium difficile CIP 107932] >gi|196162999|ref|ZP_03123530.1| 10 kDa chaperonin [Clostridium difficile QCD-23m63] >gi|123067181|sp|Q18CT6|CH10_CLOD6 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|115249203|emb|CAJ67015.1| 10 kDa chaperonin [Clostridium difficile 630] (94 aa)
Score = 129, Expect = 2.5e-06, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS-----ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++K+ E E  T +GIVLP +   Q     +++      +  +     LTVG  V F++Y   ++K++ QEY ++   D+L V+
  S:     1 MKIRPLADRVVIKKVEAEEKTASGIVLPGAAKEQPQIAEVVEVGPGGIVEGKEIKMELTVGDKVIFQKYSGTEVKIEGQEYTILRQSDVLAVI 93
>gi|189485681|ref|YP_001956622.1| chaperonin Cpn10 [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287640|dbj|BAG14161.1| chaperonin Cpn10 [uncultured Termite group 1 bacterium phylotype Rs-D17] (94 aa)
Score = 129, Expect = 2.7e-06, Identities = 31/85 (36%), Positives = 56/85 (65%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG++VL+K +E +   K GI++P++   +KP  G I ++ +       +I   ++ VG  + F +Y   + K+D+ EYL++  DDILG++
  S:     3 RPLGEKVLVKPAEPKEVKKGGIIIPDTAK-EKPQEGEIIAVGTGKRTEDGKIIALDVKVGDKILFGKYSGTEAKIDDVEYLIMSQDDILGII 93
>gi|86361059|ref|YP_472946.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] >gi|86285161|gb|ABC94219.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (104 aa)
Score = 129, Expect = 2.7e-06, Identities = 26/88 (29%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++       + +I   ++ VG  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNDAGQIQPLDVKVGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|399238|sp|P31295|CH10_CHRVI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|145008|gb|AAA23318.1| GroES [Allochromatium vinosum] (96 aa)
Score = 129, Expect = 2.7e-06, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV+++R E E  +  GIV+P+S   +KP  G I ++       +  +   ++ VG +V F +Y   ++K+D +E+LV+  +DI+ V+
  S:     1 MNIRPLHDRVVVRRMEEERLSAGGIVIPDSA-TEKPIQGEIIAVGHGKILDNGSVRALDVKVGDSVLFGKYSGTEVKLDGKEFLVMREEDIMAVV 94
>gi|118581210|ref|YP_902460.1| co-chaperonin GroES [Pelobacter propionicus DSM 2379] >gi|166198391|sp|A1AST2|CH10_PELPD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|118503920|gb|ABL00403.1| chaperonin Cpn10 [Pelobacter propionicus DSM 2379] (95 aa)
Score = 129, Expect = 2.7e-06, Identities = 32/88 (36%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R+L+KR E ET T  G+ +P +   +KP  G +       K+   ++   ++ VG  V F +Y   ++KVD +++L++  DDIL V+
  S:     1 MKLRPLHDRILVKRVEEETKTAGGLFIPETAK-EKPQRGEVVAAGNGKKTEDGKVLPLDVKVGDKVLFGKYSGTEVKVDGEDFLMMREDDILAVV 94
>gi|36959079|gb|AAQ87504.1| 10 kDa chaperonin GroES [Rhizobium sp. NGR234] (104 aa)
Score = 129, Expect = 2.7e-06, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R E E  T  GI++P++   +KP  G +       +  S ++   ++ V   + F ++   +IK+D ++ L+++  D++GV+
  S:     1 MTFRPLHDRILVRRIEAEEKTAGGIIIPDTAK-EKPQEGEVVATGPGARDDSGQLRPPDVKVADRILFGKWSGTEIKLDGEDLLIMKESDVMGVI 94
>gi|164687037|ref|ZP_02211065.1| hypothetical protein CLOBAR_00663 [Clostridium bartlettii DSM 16795] >gi|164603922|gb|EDQ97387.1| hypothetical protein CLOBAR_00663 [Clostridium bartlettii DSM 16795] (95 aa)
Score = 129, Expect = 2.8e-06, Identities = 31/88 (35%), Positives = 50/88 (56%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-----LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++K+ E E  T +GIVLP +   Q     +I+     + + N     + VG  V F +Y  N+IK D + Y+++   DIL ++
  S:     1 MKIRPLADRVVIKKFEAEEKTASGIVLPTAAKEQPQMAEVIEVGPGGMVDGNEVKMEVKVGDKVIFSKYAGNEIKADGENYIILRQSDILAIV 93
>gi|75676300|ref|YP_318721.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255] >gi|74421170|gb|ABA05369.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255] (104 aa)
Score = 129, Expect = 2.9e-06, Identities = 30/90 (33%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M FRPL  RV+++R + E  T  GI++P++   +KP  G I       ++   E+   ++  G  + F ++   ++K+D +E L+++  DILGV+ K
  S:     1 MHFRPLHDRVVVRRIDAEEKTTGGIIIPDTAK-EKPQEGEIVAAGPGARNEKGELVPLDVKAGDHILFGKWSGTEVKIDGEELLIMKESDILGVVEK 96
>gi|126642699|ref|YP_001085683.1| co-chaperonin GroES [Acinetobacter baumannii ATCC 17978] >gi|169632652|ref|YP_001706388.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii SDF] >gi|169794985|ref|YP_001712778.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii AYE] >gi|166233974|sp|A3M837|CH10_ACIBT 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|126388583|gb|ABO13081.1| chaperone Hsp10 [Acinetobacter baumannii ATCC 17978] >gi|169147912|emb|CAM85775.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii] >gi|169151444|emb|CAP00184.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii] (96 aa)
Score = 128, Expect = 3.1e-06, Identities = 36/85 (42%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV+++R E ET T  GI+LP S  A+KPS G +I   + +I ++     ++ VG  V F  Y    +KV+ +E L+++  DIL VL
  S:     5 RPLHDRVVIRRVEEETKTAGGILLPGSA-AEKPSQGEVIAVGNGQITDNGVRALDVKVGDKVLFGTYAGTTVKVNGEELLIMKESDILAVL 94
>gi|29839359|sp|Q8KM31|CH10_OLEAN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|22266160|emb|CAD43723.1| cochaperonin 10 [Oleispira antarctica] >gi|50871370|emb|CAE54382.1| chaperonin 10 [Oleispira antarctica] >gi|55468850|emb|CAE54385.1| chaperonin 10 [Oleispira antarctica] >gi|55468854|emb|CAE54388.1| chaperonin 10 [Oleispira antarctica] (97 aa)
Score = 128, Expect = 3.1e-06, Identities = 34/88 (38%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSE--INNSNLTV-----GATVYFKEYKA-NQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R++++R E ET T  GI+LP +  A+KP+ G++ S+ +   ++N ++       G  V F +Y   N I +D +E L++   DI GVL
  S:     1 MKIRPLHDRIVVRRKEEETATAGGIILPGAA-AEKPNQGVVISVGTGRILDNGSVQALAVNEGDVVVFGKYSGQNTIDIDGEELLILNESDIYGVL 95
>gi|15639997|ref|NP_219450.1| co-chaperonin GroES [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026236|ref|YP_001934008.1| chaperonin GroES [Treponema pallidum subsp. pallidum SS14] >gi|4033375|sp|O83977|CH10_TREPA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|3323341|gb|AAC65964.1| chaperonin (groES) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018811|gb|ACD71429.1| chaperonin GroES [Treponema pallidum subsp. pallidum SS14] (88 aa)
Score = 128, Expect = 3.2e-06, Identities = 29/88 (32%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PL  RVL+K  + ET T +GI++P++   +K   G + ++ S+     ++VG  V   +Y  N +K+D +E+L+++  DIL V+
  S:     1 MKIIPLADRVLVKTDKSETKTASGIIIPDTAQ-EKMQSGTVIAVGSDSEKIKVSVGQRVMHDKYAGNPVKIDGEEHLLLKGADILAVI 87
>gi|184159229|ref|YP_001847568.1| Co-chaperonin GroES (HSP10) [Acinetobacter baumannii ACICU] >gi|183210823|gb|ACC58221.1| Co-chaperonin GroES (HSP10) [Acinetobacter baumannii ACICU] (100 aa)
Score = 128, Expect = 3.3e-06, Identities = 36/85 (42%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYG-IIKSISSEINNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV+++R E ET T  GI+LP S  A+KPS G +I   + +I ++     ++ VG  V F  Y    +KV+ +E L+++  DIL VL
  S:     9 RPLHDRVVIRRVEEETKTAGGILLPGSA-AEKPSQGEVIAVGNGQITDNGVRALDVKVGDKVLFGTYAGTTVKVNGEELLIMKESDILAVL 98
>gi|126733620|ref|ZP_01749367.1| Chaperonin Cpn10 (GroES) [Roseobacter sp. CCS2] >gi|126716486|gb|EBA13350.1| Chaperonin Cpn10 (GroES) [Roseobacter sp. CCS2] (94 aa)
Score = 128, Expect = 3.3e-06, Identities = 30/88 (34%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F PL  RVL++R E +  T  G+++P  N  +KP+ G I S+       S E+   ++  G  V F ++   ++K+D ++ L+++  DILG++
  S:     1 MAFTPLHDRVLVRRIEGDEKTAGGLIIP-ENAKEKPAEGEIVSVGEGARKDSGELIAMSVKAGDKVLFGKWSGTEVKIDGEDLLIMKESDILGIM 94
>gi|56695788|ref|YP_166139.1| co-chaperonin GroES [Silicibacter pomeroyi DSS-3] >gi|81676373|sp|Q5LV16|CH10_SILPO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|56677525|gb|AAV94191.1| chaperonin, 10 kDa [Silicibacter pomeroyi DSS-3] (95 aa)
Score = 128, Expect = 3.3e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++R+E E  T  G+++P+S   +KPS G++       +  S E+    +  G  V F ++   ++ VD +E L+++  DI+G++
  S:     1 MALKPLHDRVLVRRTESEEKTAGGLIIPDSAK-EKPSEGVVVACGEGARKDSGELIAMAVKSGDRVLFGKWSGTEVTVDGEELLMMKESDIMGII 94
>gi|163848431|ref|YP_001636475.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl] >gi|187601419|ref|ZP_02987648.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl] >gi|163669720|gb|ABY36086.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl] >gi|187486646|gb|EDU24618.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl] (98 aa)
Score = 128, Expect = 3.4e-06, Identities = 28/88 (31%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RV++K    E  TK GI LP++   ++P  G + ++         ++   ++ VG  V + +Y   + K+D++EYL+++  DILG++
  S:     1 MHVKPLNDRVVVKPKPREEKTKGGIFLPDTASKERPMEGEVIAVGPGRRADDGKLIPMSVKVGQHVLYAKYAGTEFKIDDEEYLILQEKDILGII 95
>gi|149913712|ref|ZP_01902245.1| putative manganese-dependent inorganic pyrophosphatase [Roseobacter sp. AzwK-3b] >gi|149812832|gb|EDM72661.1| putative manganese-dependent inorganic pyrophosphatase [Roseobacter sp. AzwK-3b] (95 aa)
Score = 128, Expect = 3.4e-06, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E E  T  G+++P S   +KP  G + +I       S E+    +  G  V F ++   +I +D +E L+++  DILGV+
  S:     1 MAFKPLHDRVLVRRVESEEKTAGGLIIPESAK-EKPQEGEVVAIGEGARKDSGELIEMAVKAGDKVLFGKWSGTEITLDGEELLIMKESDILGVI 94
>gi|167757719|ref|ZP_02429846.1| hypothetical protein CLOSCI_00049 [Clostridium scindens ATCC 35704] >gi|167664601|gb|EDS08731.1| hypothetical protein CLOSCI_00049 [Clostridium scindens ATCC 35704] (94 aa)
Score = 128, Expect = 3.6e-06, Identities = 29/88 (32%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIK-----SISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG RV+LK+   E TTK+GIV+P  +  +     +I      ++  +    N+  G  V + +Y    +++D++EY++V+ DDIL ++
  S:     1 MKLVPLGDRVVLKQLVAEETTKSGIVIPGQSKEKPQQAEVIAVGPGGTVDGKEVKMNVATGQKVIYSKYAGTTVEIDDEEYIIVKQDDILAIV 93
>gi|148556277|ref|YP_001263859.1| chaperonin Cpn10 [Sphingomonas wittichii RW1] >gi|189044122|sp|A5VBQ5|CH10_SPHWW 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|148501467|gb|ABQ69721.1| chaperonin Cpn10 [Sphingomonas wittichii RW1] (95 aa)
Score = 128, Expect = 3.8e-06, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P+S   +KP  G +       K+   ++   ++  G  + F ++   ++K++ ++ L+++  DILG++
  S:     1 MSFRPLHDRVLVRRVEAEEKTAGGIIIPDSAK-EKPQEGEVVAVGGGSKAEDGKVTPLDVKAGDKILFGKWSGTEVKINGEDLLIMKESDILGIV 94
>gi|99080437|ref|YP_612591.1| co-chaperonin GroES [Silicibacter sp. TM1040] >gi|123252533|sp|Q1GJ37|CH10_SILST 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|99036717|gb|ABF63329.1| chaperonin Cpn10 [Silicibacter sp. TM1040] (95 aa)
Score = 128, Expect = 3.8e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++R+E E  T  G+++P+S   +KPS G++       +  S E+    +  G  + F ++   ++ VD +E L+++  DI+GV+
  S:     1 MALKPLHDRVLVRRTESEEKTAGGLIIPDSAK-EKPSEGVVVACGEGARKDSGELIAMAVKEGDNILFGKWSGTEVTVDGEELLMMKESDIMGVI 94
>gi|167627323|ref|YP_001677823.1| co-chaperonin GroES [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189044104|sp|B0TX64|CH10_FRAP2 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|167597324|gb|ABZ87322.1| co-chaperonin GroES (HSP10) [Francisella philomiragia subsp. philomiragia ATCC 25017] (95 aa)
Score = 128, Expect = 3.9e-06, Identities = 32/88 (36%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS--EINNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RVL++R+E ET +  GI+L  S   +KPS G + ++ +  +++N      ++ VG  V F +Y  +++KV+++  L++  DDI+G++
  S:     1 MNIRPLQDRVLVRRAEEETKSAGGIILTGSAQ-EKPSQGEVVAVGNGKKLDNGSTQPMDVKVGDKVLFGKYSGSEVKVNDETLLMMREDDIMGII 94
>gi|159491518|ref|XP_001703710.1| chaperonin 20 [Chlamydomonas reinhardtii] >gi|158270507|gb|EDO96350.1| chaperonin 20 [Chlamydomonas reinhardtii] (216 aa)
Score = 128, Expect = 4.0e-06, Identities = 29/87 (33%), Positives = 52/87 (59%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI--------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PL  R+L+K ++ E  T  G++L  +  A+KP++G + ++        +  +   N+TVGATV + +Y   + + D   Y+VV   DIL  L
  S:   122 QLKPLSDRILIKGAKAEDKTSGGVLLA-TESAEKPTFGTVVAVGEGREDEETKALVKPNVTVGATVMYSKYSGTEFEEDGDNYIVVRESDILAQL 215
>gi|2493657|sp|P95677|CH10_RHOCA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|1699435|gb|AAB37531.1| Cpn10 [Rhodobacter capsulatus] (95 aa)
Score = 127, Expect = 4.1e-06, Identities = 28/88 (31%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL+KR + E  TK G+++P++   +KP+ G + ++       S E+    + VG  + F ++   ++ +D  E L+++  DI+G++
  S:     1 MAFKPLHDRVLVKRVQSEEKTKGGLIIPDTAK-EKPAEGEVVAVGAGARKDSGELIAPAVAVGDRILFGKWSGTEVTLDGVEMLIMKESDIMGII 94
>gi|77462861|ref|YP_352365.1| co-chaperonin GroES [Rhodobacter sphaeroides 2.4.1] >gi|126461753|ref|YP_001042867.1| co-chaperonin GroES [Rhodobacter sphaeroides ATCC 17029] >gi|123592426|sp|Q3J420|CH10_RHOS4 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166198401|sp|A3PIC9|CH10_RHOS1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|20141217|sp|P25969|CH101_RHOSH 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) >gi|1208542|gb|AAB41335.1| chaperonin 10 >gi|77387279|gb|ABA78464.1| Chaperonin Cpn10 (GroES) [Rhodobacter sphaeroides 2.4.1] >gi|126103417|gb|ABN76095.1| chaperonin Cpn10 [Rhodobacter sphaeroides ATCC 17029] (95 aa)
Score = 127, Expect = 4.4e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R + +  TK G+++P++   +KP+ G + S        S E+   ++  G  V F ++   ++ +D  E L+++  DILG+L
  S:     1 MAFKPLHDRVLVRRVQSDEKTKGGLIIPDTAK-EKPAEGEVVSCGEGARKDSGELIAMSVKAGDRVLFGKWSGTEVTIDGAELLIMKESDILGIL 94
>gi|94987066|ref|YP_594999.1| GroES/HSP10-like protein [Lawsonia intracellularis PHE/MN1-00] >gi|123262153|sp|Q1MQP9|CH10_LAWIP 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|48474759|sp|O87887|CH10_LAWIN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|3599923|gb|AAC36499.1| GroES/HSP10 homolog [Lawsonia intracellularis] >gi|94731315|emb|CAJ54678.1| GroES/HSP10 homolog [Lawsonia intracellularis PHE/MN1-00] (101 aa)
Score = 127, Expect = 4.6e-06, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL+KR E E  T  G+ +P++   +KPS G + ++    +  +       +  G TV F +Y   ++K+D  E+LV+  DDIL V+
  S:     1 MNLKPLNDRVLVKRLESEEKTAGGLYIPDTAK-EKPSRGEVVAVGPGKHTDDGKLIPMAVKAGDTVLFNKYAGTEVKLDGVEHLVMREDDILAVI 94
>gi|160947328|ref|ZP_02094495.1| hypothetical protein PEPMIC_01262 [Peptostreptococcus micros ATCC 33270] >gi|158446462|gb|EDP23457.1| hypothetical protein PEPMIC_01262 [Peptostreptococcus micros ATCC 33270] (94 aa)
Score = 127, Expect = 4.6e-06, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEI-----NNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ +P+G +++++  EVE  T +GIVLP S   + PS   + +I  EI         + VG  + F +Y   ++K+D +EY+VV++ D+L V+
  S:     1 MKLKPIGDKLVIEMVEVEEKTSSGIVLPTSAK-EAPSVAKVLAIGDEILKDEDKKDLIKVGDKIIFSKYAGTEVKLDKKEYIVVKIADVLAVV 92
>gi|160895131|ref|ZP_02075904.1| hypothetical protein CLOL250_02691 [Clostridium sp. L2-50] >gi|156863165|gb|EDO56596.1| hypothetical protein CLOL250_02691 [Clostridium sp. L2-50] (118 aa)
Score = 127, Expect = 4.7e-06, Identities = 33/88 (37%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG RV+LK+S  E TTK+GIVLP     +KP Y  +  +        + V      G  V + +Y   ++K+ + EY++V+  DIL V+
  S:    24 MKLVPLGDRVVLKQSVAEETTKSGIVLPGQAK-EKPQYADVVEVGPGAVVDGVKVPMEVKAGDRVIYSKYAGTEVKLGDDEYIIVKQSDILAVV 116
>gi|51244043|ref|YP_063927.1| chaperonin GroES [Desulfotalea psychrophila LSv54] >gi|81692985|sp|Q6ARV5|CH10_DESPS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|50875080|emb|CAG34920.1| probable chaperonin GroES [Desulfotalea psychrophila LSv54] (95 aa)
Score = 127, Expect = 4.7e-06, Identities = 31/88 (35%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS-SEINNSNLTV------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  R+L+KR   E  T  GI++P+S   +KP+ G + ++   ++++S   V      G  V F +Y    +K+D +++L++  DDILG++
  S:     1 MKIRPLNDRLLVKRLAEEEKTAGGIIIPDSAK-EKPAEGQVVAVGPGKVSDSGERVALQVKEGDLVLFSKYGGTDVKLDGEDFLIMREDDILGIM 94
>gi|23813822|sp|Q9KKF1|CH10_CLODI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|8215673|gb|AAF73983.1|AF080547_1 GroES protein [Clostridium difficile] (94 aa)
Score = 127, Expect = 4.8e-06, Identities = 29/88 (32%), Positives = 50/88 (56%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS-----ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +P G RV++K+ E E  T +GIVLP +   Q     +++      +  +     LTVG  V F++Y   ++K++ QEY ++   D+L V+
  S:     1 MNIKPFGDRVVIKKVEAEEKTASGIVLPGAAKEQPQIAEVVEVGPGGIVEGKEIKMELTVGDKVIFQKYSGTEVKIEGQEYTILRQSDVLAVI 93
>gi|83945761|ref|ZP_00958105.1| co-chaperonin GroES [Oceanicaulis alexandrii HTCC2633] >gi|83850851|gb|EAP88712.1| co-chaperonin GroES [Oceanicaulis alexandrii HTCC2633] (95 aa)
Score = 127, Expect = 4.8e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV++KR E E+ T  GI++P++   +KP  G + ++         E+   ++ VG  + F ++   +I ++ Q+ L+++  DILGV+
  S:     1 MNFRPLQDRVVVKRVEEESKTAGGIIIPDTAK-EKPQEGEVVAVGPGARDDKGELIAMDVKVGDRILFGKWSGTEITLEGQDLLIMKESDILGVV 94
>gi|188589840|ref|YP_001919806.1| chaperonin GroS [Clostridium botulinum E3 str. Alaska E43] >gi|188500121|gb|ACD53257.1| chaperonin GroS [Clostridium botulinum E3 str. Alaska E43] (94 aa)
Score = 127, Expect = 4.9e-06, Identities = 31/88 (35%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E  TK+GIVL  S      +A+  + G    +        + VG  V + +Y   ++K+D +EY++++ DDIL ++
  S:     1 MRIKPLGNRVVIKRLEAEEKTKSGIVLTGSAKEVPQEAEVVAVGPGSIVDGTKIEMEVKVGDKVLYSKYSGTEVKLDGEEYMILKQDDILAIV 93
>gi|191164482|ref|ZP_03026346.1| chaperonin Cpn10 [Geobacter sp. M21] >gi|190994373|gb|EDV69837.1| chaperonin Cpn10 [Geobacter sp. M21] (96 aa)
Score = 127, Expect = 5.0e-06, Identities = 30/90 (33%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  R+++KR E  T T  G+ +P +   +KP  G + ++ +       ++   +L VG  V F +Y  +++K++ +++L++  DDILGV+ K
  S:     1 MNLRPLQDRIIVKRVEEATMTAGGLYIPETAK-EKPQQGEVVAVGNGKRGDDGKVYPIDLKVGDKVLFGKYAGSEVKLEGEDFLIMREDDILGVVEK 96
>gi|116250658|ref|YP_766496.1| putative 10 kDa chaperonin (protein cpn10) [Rhizobium leguminosarum bv. viciae 3841] >gi|167358525|ref|ZP_02293179.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169200710|ref|ZP_02859990.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|1946290|emb|CAA73086.1| cpn10-1 [Rhizobium leguminosarum] >gi|115255306|emb|CAK06381.1| putative 10 kda chaperonin (protein cpn10) [Rhizobium leguminosarum bv. viciae 3841] >gi|167074592|gb|EDR78414.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169085020|gb|EDS65741.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM2304] (98 aa)
Score = 127, Expect = 5.1e-06, Identities = 27/86 (31%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++  G  + F ++   ++K+D ++ L+++  DI+G++
  S:     6 FRPLHDRVVVRRVESEAKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDESGKVVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGII 97
>gi|50085882|ref|YP_047392.1| co-chaperonin GroES [Acinetobacter sp. ADP1] >gi|60389580|sp|Q6F8P5|CH10_ACIAD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|49531858|emb|CAG69570.1| chaperone Hsp10, affects cell division [Acinetobacter sp. ADP1] (96 aa)
Score = 126, Expect = 5.4e-06, Identities = 32/85 (37%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  RV+++R E ET T  GI+LP S  A+KP+ G + ++       + +   ++  G  V F  Y    +KV+ +E+L+++  DIL VL
  S:     5 RPLHDRVVIRRVEEETKTAGGILLPGSA-AEKPAQGEVIAVGNGQITENGVRALDVKAGDKVLFGTYAGTTVKVNGEEFLIMKESDILAVL 94
>gi|7578865|gb|AAF64159.1|AF239163_1 GroES [Rhizobium leguminosarum] (104 aa)
Score = 126, Expect = 5.5e-06, Identities = 25/88 (28%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++       + +I   ++  G  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNDAGQIQALDVKAGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|146278226|ref|YP_001168385.1| co-chaperonin GroES [Rhodobacter sphaeroides ATCC 17025] >gi|166198402|sp|A4WUL6|CH10_RHOS5 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|23813796|sp|Q93MH2|CH10_RHOPA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|15290744|gb|AAK94942.1| GroES [Rhodopseudomonas palustris] >gi|145556467|gb|ABP71080.1| chaperonin Cpn10 [Rhodobacter sphaeroides ATCC 17025] (95 aa)
Score = 126, Expect = 5.6e-06, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R + +  TK G+++P++   +KP+ G +       +  S E+   ++  G  V F ++   ++ +D  E L+++  DILG+L
  S:     1 MAFKPLHDRVLVRRVQSDEKTKGGLIIPDTAK-EKPAEGEVVACGEGARKDSGELIAMSVKAGDRVLFGKWSGTEVTIDGAELLIMKESDILGIL 94
>gi|150378065|ref|YP_001314660.1| co-chaperonin GroES [Sinorhizobium medicae WSM419] >gi|150395634|ref|YP_001326101.1| co-chaperonin GroES [Sinorhizobium medicae WSM419] >gi|150027149|gb|ABR59266.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419] >gi|150032612|gb|ABR64727.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419] (98 aa)
Score = 126, Expect = 5.7e-06, Identities = 28/86 (32%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++  G  + F ++   ++K+D ++ L+++  DI+GV+
  S:     6 FRPLHDRVVVRRVESEEKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGVI 97
>gi|159045460|ref|YP_001534254.1| chaperonin Cpn10 [Dinoroseobacter shibae DFL 12] >gi|189044102|sp|A8LJQ0|CH10_DINSH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|157913220|gb|ABV94653.1| chaperonin Cpn10 [Dinoroseobacter shibae DFL 12] (103 aa)
Score = 126, Expect = 5.9e-06, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F PL  RVL++R E E  T  G+++P+S   +KP+ G++ ++ +   +        ++  G  + F ++   ++ VD +E L+++  DILG++
  S:     1 MAFTPLHDRVLVRRVESEEKTAGGLIIPDSAK-EKPAEGLVIAVGAGAKDDDGDRIPMDVKEGDKILFGKWSGTEVTVDGEELLIMKESDILGII 94
>gi|150396500|ref|YP_001326967.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419] >gi|150028015|gb|ABR60132.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419] (104 aa)
Score = 126, Expect = 5.9e-06, Identities = 26/88 (29%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R E E  TK GI++P++   +KP  G + ++     N        ++  G  + F ++   +IK+  ++ L+++  D++G++
  S:     1 MAFRPLHDRILVRRVESEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNEQGQVQPLDVKAGDRILFGKWSGTEIKIHGEDLLIMKESDVMGII 94
>gi|170743559|ref|YP_001772214.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] >gi|168197833|gb|ACA19780.1| chaperonin Cpn10 [Methylobacterium sp. 4-46] (104 aa)
Score = 126, Expect = 6.0e-06, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RV+++R + E  TK GI++P++   +KP  G + ++     +        ++  G  V F ++   ++++D Q+ L+++  DILG+L
  S:     1 MTFQPLHDRVVVRRIDAEEKTKGGIIIPDTAK-EKPQEGEVVAVGPGARDEAGKLVPLDVKAGDRVLFGKWSGTEVRIDGQDLLIMKESDILGIL 94
>gi|86356910|ref|YP_468802.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] >gi|86281012|gb|ABC90075.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (105 aa)
Score = 126, Expect = 6.2e-06, Identities = 27/90 (30%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+FR L  RV+++R+E + T+K GI++P++    KP  G + ++       S ++   ++ VG  + F ++   ++ +D Q  L+++  DI+G++ K
  S:     1 MKFRSLHDRVVIRRAEGDVTSKGGIIIPDAAK-DKPQEGEVVAVGPGLRDQSGKLAPLDVKVGDLILFGKWSGTEVTIDGQTLLIIKEADIMGIVEK 96
>gi|197086008|gb|ACH37279.1| chaperonin Cpn10 [Geobacter bemidjiensis Bem] (96 aa)
Score = 126, Expect = 6.2e-06, Identities = 30/90 (33%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M  RPL  R+++KR E  T T  G+ +P +   +KP  G + ++ +       ++   +L VG  V F +Y  +++K++ +++L++  DDILGV+ K
  S:     1 MNLRPLQDRIIVKRVEEATMTAGGLYIPETAK-EKPQQGEVVAVGNGKRGEDGKVYPIDLKVGDKVLFGKYAGSEVKLEGEDFLIMREDDILGVVEK 96
>gi|108759998|ref|YP_633051.1| chaperonin GroS [Myxococcus xanthus DK 1622] >gi|122980867|sp|Q1D2S2|CH10_MYXXD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|108463878|gb|ABF89063.1| chaperonin GroS [Myxococcus xanthus DK 1622] (96 aa)
Score = 126, Expect = 6.2e-06, Identities = 29/90 (32%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  R+++KR   E  TK G+ +P++   +KP  G + ++ +       ++   ++  G T+ F +Y   +IK+D +E+L++  +D+LGV+ K
  S:     1 MKIRPLQDRLIVKRVAEENKTKGGLFIPDTAK-EKPLEGKVIAVGNGKVQEDGKVRPLDIKAGDTILFSKYAGTEIKLDGEEHLILREEDVLGVIEK 96
>gi|126728132|ref|ZP_01743948.1| chaperonin, 10 kDa [Sagittula stellata E-37] >gi|126711097|gb|EBA10147.1| chaperonin, 10 kDa [Sagittula stellata E-37] (103 aa)
Score = 126, Expect = 6.5e-06, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F+PL  RVL++R E +  T  G+++P+S   +KP+ G++       +  S E+ +  +  G  V F ++   ++ V  +E L+++  DILG++
  S:     1 MAFKPLHDRVLVRRVESDEKTAGGLIIPDSAK-EKPAEGVVVACGEGARKDSGELIDMAVKEGDKVLFGKWSGTEVNVGGEELLIMKESDILGII 94
>gi|149927966|ref|ZP_01916216.1| co-chaperonin GroES [Limnobacter sp. MED105] >gi|149823405|gb|EDM82638.1| co-chaperonin GroES [Limnobacter sp. MED105] (90 aa)
Score = 125, Expect = 6.9e-06, Identities = 32/80 (40%), Positives = 52/80 (65%)
  Q:     9 RVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RV++KR + E TT +GIV+P +  A+KP  G + ++       S ++   ++ VG  V F +Y    IKVD +E LV+  +DI+GV+
  S:     3 RVIVKRLDSERTTASGIVIPEAA-AEKPDQGEVIAVGPGKRDDSGKLIAMDVKVGQRVLFGKYAGQAIKVDGKEVLVMREEDIMGVI 88
>gi|195540548|emb|CAQ30435.1| heat shock protein [Helicobacter pylori] (99 aa)
Score = 125, Expect = 7.0e-06, Identities = 25/68 (36%), Positives = 47/68 (69%)
  Q:    21 TKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +GI++P+ +  +KP  G++K++S +I+     V  G  + F +YK  +I +D  EY+V+EL+DILG++
  S:     2 SSSGIIIPD-DAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIV 70
>gi|169335827|ref|ZP_02863020.1| hypothetical protein ANASTE_02253 [Anaerofustis stercorihominis DSM 17244] >gi|169258565|gb|EDS72531.1| hypothetical protein ANASTE_02253 [Anaerofustis stercorihominis DSM 17244] (94 aa)
Score = 125, Expect = 7.0e-06, Identities = 33/88 (37%), Positives = 59/88 (67%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-SSEINNS-----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ +PLG +V++K  E E TT TGI+LP++   +KP  G I ++ S EI +      ++  G TV + +Y  +++K++ +EYL++   DIL ++
  S:     1 MKLQPLGDKVVIKVKEEEKTTATGIILPDTAK-EKPVMGEIVAVGSGEIVDGKKVALDVKEGDTVIYSKYAGSEVKLEGEEYLILRQSDILAIV 93
>gi|125975372|ref|YP_001039282.1| co-chaperonin GroES [Clostridium thermocellum ATCC 27405] >gi|196252980|ref|ZP_03151625.1| chaperonin Cpn10 [Clostridium thermocellum DSM 4150] >gi|1345745|sp|P48223|CH10_CLOTH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|1103643|emb|CAA92241.1| groES [Clostridium thermocellum] >gi|125715597|gb|ABN54089.1| chaperonin Cpn10 [Clostridium thermocellum ATCC 27405] >gi|196197616|gb|EDX92468.1| chaperonin Cpn10 [Clostridium thermocellum DSM 4150] (94 aa)
Score = 125, Expect = 7.2e-06, Identities = 34/88 (38%), Positives = 49/88 (55%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSND-----AQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPLG RV++K  E E TTK+GIVLP S       A+  + G    +  +     + VG  V   +Y   ++K D QEY ++  +DIL V+
  S:     1 MNIRPLGDRVVVKMVETEETTKSGIVLPGSAKEKPQVAEVVAVGPGTVVDGKEVKMEVKVGDKVIISKYAGTEVKFDGQEYTILRQNDILAVV 93
>gi|161484939|ref|NP_615593.2| co-chaperonin GroES [Methanosarcina acetivorans C2A] (92 aa)
Score = 125, Expect = 7.7e-06, Identities = 31/88 (35%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RP+G+RVLLK  + E  TK GI +P S   +K   GI+ ++ +  +   L +  G  V +  Y+A++I++D+++Y+ V+  DIL  +
  S:     1 MIIRPIGERVLLKHQKKEEVTKGGIYIPESARQEKKE-GIVIAVGTFEDGKELPLKKGDHVIYGGYQADEIEIDDEKYIFVDFKDILATV 89
>gi|86136483|ref|ZP_01055062.1| chaperonin, 10 kDa [Roseobacter sp. MED193] >gi|85827357|gb|EAQ47553.1| chaperonin, 10 kDa [Roseobacter sp. MED193] (95 aa)
Score = 125, Expect = 7.7e-06, Identities = 28/88 (31%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++R+E E  T  G+++P S   +KPS G + +        N       ++ G T+ F ++   ++ VD +E L+++  DI+G++
  S:     1 MALKPLHDRVLVRRTESEEKTAGGLIIPESAK-EKPSEGQVVATGEGARKDNGELIAMAVSAGDTILFGKWSGTEVTVDGEELLMMKESDIMGII 94
>gi|114328845|ref|YP_746002.1| co-chaperonin GroES [Granulibacter bethesdensis CGDNIH1] >gi|114317019|gb|ABI63079.1| 10 kDa chaperonin GROES [Granulibacter bethesdensis CGDNIH1] (101 aa)
Score = 125, Expect = 7.9e-06, Identities = 27/86 (31%), Positives = 52/86 (60%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R   E  T  GI++P++   +KP  G I ++ +   N        ++  G  V F ++   ++K+D +E L+++  DI+G++
  S:     9 FRPLHDRVVVRRLNAEEKTSGGIIIPDTAK-EKPMEGEIVAVGAGARNEQGQIQPLDVKAGDRVLFGKWSGTEVKIDGEELLIMKESDIMGII 100
>gi|62484815|emb|CAI78832.1| co-chaperonin [uncultured bacterium] (98 aa)
Score = 125, Expect = 7.9e-06, Identities = 34/85 (40%), Positives = 49/85 (57%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG++VL+KR E +  T  GIVLP+S   +KP  G +          S E     +  G  V F  Y   +IKV+ +E L+++  D+L VL
  S:     7 RPLGEKVLIKRLEADEQTSGGIVLPDSAK-EKPKQGTVLKAGDGKLLDSGERQALQVKKGDKVLFTSYAGTEIKVEGEEMLIMDESDVLAVL 97
>gi|148254000|ref|YP_001238585.1| chaperone Hsp10, part of GroE chaperone system [Bradyrhizobium sp. BTAi1] >gi|146406173|gb|ABQ34679.1| chaperone Hsp10, part of GroE chaperone system [Bradyrhizobium sp. BTAi1] (95 aa)
Score = 125, Expect = 8.3e-06, Identities = 29/88 (32%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RV+++R E    TK GI++P++   +KP  G + ++ S   +        ++  G  V F ++   ++K++ ++ L+V+  DILGV+
  S:     1 MSFRPLHDRVVIRRIEESAKTKGGIIIPDTAK-EKPQEGEVIAVGSGARDEAGRLVPLDVKKGDRVLFGKWSGTEVKINGEDLLIVKEADILGVI 94
>gi|171324904|ref|ZP_02913415.1| chaperonin Cpn10 [Geobacillus sp. WCH70] >gi|171089179|gb|EDT35513.1| chaperonin Cpn10 [Geobacillus sp. WCH70] (94 aa)
Score = 125, Expect = 8.3e-06, Identities = 31/86 (36%), Positives = 51/86 (59%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RV+++  E E  T +GIVLP++   +KP  G + ++       S E     + VG  + F +Y   ++K D +EYL++   DIL V+
  S:     2 LKPLGDRVVIEVIETEEKTASGIVLPDTAK-EKPQEGRVVAVGKGRVLDSGECVAPEVEVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVI 93
>gi|188585088|ref|YP_001916633.1| chaperonin Cpn10 [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349775|gb|ACB84045.1| chaperonin Cpn10 [Natranaerobius thermophilus JW/NM-WN-LF] (95 aa)
Score = 125, Expect = 8.5e-06, Identities = 31/88 (35%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEIN-------NSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG R+++K  E E  T++GIVLP     +KP  G + ++ S             +  G  V + ++  N+++VD +EYL++  DDIL V+
  S:     1 MNLKPLGDRIVIKILEAEEKTESGIVLPEKAK-EKPQEGEVVAVGSGKTLDDGSKVEPEVKAGDKVVYSKFAGNEVEVDGEEYLIMRQDDILAVI 94
>gi|153810950|ref|ZP_01963618.1| hypothetical protein RUMOBE_01340 [Ruminococcus obeum ATCC 29174] >gi|149832838|gb|EDM87921.1| hypothetical protein RUMOBE_01340 [Ruminococcus obeum ATCC 29174] (94 aa)
Score = 125, Expect = 8.9e-06, Identities = 30/88 (34%), Positives = 50/88 (56%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIK-----SISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG RV+LK+ E E TTK+GIVLP     +     +I       +  +     +  G  V + +Y   ++K+D +EY++V+  DIL ++
  S:     1 MKLVPLGDRVVLKQLEAEETTKSGIVLPGQAQEKPQQAEVIAVGPGGVVDGKEVKMEVATGNKVIYSKYAGTEVKLDGEEYIIVKQSDILAIV 93
>gi|163737789|ref|ZP_02145206.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis BS107] >gi|163742905|ref|ZP_02150289.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis 2.10] >gi|161383869|gb|EDQ08254.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis 2.10] >gi|161389315|gb|EDQ13667.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis BS107] (95 aa)
Score = 124, Expect = 9.9e-06, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII-------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++R+E E  T  G+++P+S   +KPS G +       +  S E+    ++ G  + F ++   ++ VD +E L+++  DI+G++
  S:     1 MALKPLHDRVLVRRTESEEKTAGGLIIPDSAK-EKPSEGQVVATGEGARKDSGELIAMAVSAGDKILFGKWSGTEVTVDGEELLMMKESDIMGII 94
>gi|162454187|ref|YP_001616554.1| GroES-like protein [Sorangium cellulosum 'So ce 56'] >gi|161164769|emb|CAN96074.1| GroES-like protein [Sorangium cellulosum 'So ce 56'] (96 aa)
Score = 124, Expect = 1.0e-05, Identities = 30/90 (33%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  RV+++R + E  TK G+ +P++   +KP  G + ++ +        +   ++  G  V F +Y   ++K+D +E+L++  DDILGV+ K
  S:     1 MKIRPLQDRVIVQRVKEEEKTKGGLYIPDTAK-EKPIEGTVVAVGNGKVAEDGTVRKLDVKEGDRVLFGKYSGTEVKIDGEEHLILREDDILGVIEK 96
>gi|118488687|gb|ABK96154.1| unknown [Populus trichocarpa] (256 aa)
Score = 124, Expect = 1.1e-05, Identities = 31/85 (36%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RVL+K   VE  ++ GI+LP+S    KP  G +      KSI     + ++  GA V + +Y   +++ D   +L+++ DDI+G+L
  S:    66 KPLGDRVLVKIKTVEEKSEGGILLPSSAQT-KPQAGEVVAVGEGKSIGKTKLDISVKTGARVVYSKYAGTEVEFDGSSHLILKEDDIIGIL 155
>gi|154491509|ref|ZP_02031135.1| hypothetical protein PARMER_01120 [Parabacteroides merdae ATCC 43184] >gi|154088310|gb|EDN87355.1| hypothetical protein PARMER_01120 [Parabacteroides merdae ATCC 43184] (89 aa)
Score = 124, Expect = 1.1e-05, Identities = 29/88 (32%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RVL+K +  E  T  GI++P+S   +KP  G + ++ +   +  + V  G TV + +Y   +I++D ++YL++   DIL ++
  S:     1 MNIRPLADRVLIKPAAAEEKTLGGIIIPDSAK-EKPLKGEVVAVGNGTKDEEMVVKNGDTVLYGKYAGTEIELDGEKYLIMRQSDILAII 89
>gi|29839340|sp|Q8GBD3|CH10_ACEAC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|23096061|dbj|BAC16231.1| groES [Acetobacter aceti] (97 aa)
Score = 124, Expect = 1.1e-05, Identities = 28/87 (32%), Positives = 53/87 (60%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R E E  T  GI++P++   +KP  G + ++     N        ++  G  V F ++   ++K+D +E L+++  DI+GV+
  S:     3 KFRPLHDRVVVRRLEGEQKTAGGIIIPDTAQ-EKPMEGEVVAVGPGARNEQGQIVALDVKAGDRVLFGKWSGTEVKIDGEELLIMKESDIMGVV 95
>gi|148261487|ref|YP_001235614.1| chaperonin Cpn10 [Acidiphilium cryptum JF-5] >gi|189081994|sp|A5G1G3|CH10_ACICJ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|146403168|gb|ABQ31695.1| chaperonin Cpn10 [Acidiphilium cryptum JF-5] (104 aa)
Score = 124, Expect = 1.1e-05, Identities = 26/88 (29%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++R   E  T  GI++P++   +KP  G + ++     N        ++  G  + F ++   ++K+D +E L+++  DI+G++
  S:     1 MKFRPLHDRVVVRRLNAEEKTAGGIIIPDTAK-EKPMEGEVIAVGPGARNEAGAVVALDVKAGDRILFGKWSGTEVKIDGEELLIMKESDIMGII 94
>gi|85373659|ref|YP_457721.1| co-chaperonin GroES [Erythrobacter litoralis HTCC2594] >gi|84786742|gb|ABC62924.1| heat shock protein groES [Erythrobacter litoralis HTCC2594] (104 aa)
Score = 124, Expect = 1.1e-05, Identities = 26/88 (29%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R E E  T  GI++P++   +KP  G + ++       + ++    +  G  + F ++   ++++D ++ L+++  DILG++
  S:     1 MHFRPLHDRVLVRRIEAEEKTTGGIIIPDTAK-EKPMEGEVVAVGPGARDDAGKLVELAVKAGDRILFGKWSGTEVRIDGEDLLIMKESDILGII 94
>gi|13472183|ref|NP_103750.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099] >gi|23813802|sp|Q98II0|CH102_RHILO 10 kDa chaperonin 2 (Protein Cpn10 2) (groES protein 2) >gi|14022928|dbj|BAB49536.1| heat shock protein GroES [Mesorhizobium loti MAFF303099] (104 aa)
Score = 124, Expect = 1.1e-05, Identities = 27/88 (30%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R E E  T  GI++P++   +KP  G + +I       S ++   ++  G  + F ++   +IK++ ++ L+++  D++GV+
  S:     1 MTFRPLHDRILVRRIEAEEKTAGGIIIPDTAK-EKPQEGEVIAIGPGARDESGKLTPLDVKAGDRILFGKWSGTEIKLNGEDLLIMKESDVMGVI 94
>gi|88804972|ref|ZP_01120492.1| co-chaperonin GroES [Robiginitalea biformata HTCC2501] >gi|88785851|gb|EAR17020.1| co-chaperonin GroES [Robiginitalea biformata HTCC2501] (92 aa)
Score = 123, Expect = 1.2e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RVL+   E ET T +GI++P++   +KP  G + ++     +  +TV  G TV + +Y   ++K D  +YL++   DIL ++
  S:     4 VNIKPLADRVLVAPMEAETKTASGIIIPDTAK-EKPQKGKVVAVGPGTKDEKMTVSVGDTVLYGKYSGTELKFDGADYLMMRESDILAII 92
>gi|163795485|ref|ZP_02189451.1| chaperonin Cpn10 [alpha proteobacterium BAL199] >gi|159179084|gb|EDP63617.1| chaperonin Cpn10 [alpha proteobacterium BAL199] (95 aa)
Score = 123, Expect = 1.2e-05, Identities = 26/88 (29%), Positives = 57/88 (64%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+FRPL  RV+++  E ET T  GI++P+ N  +KPS G + ++       + +++  ++  G TV + ++   ++K+D +  +++   D++G++
  S:     1 MKFRPLHDRVVIEPIESETKTAGGIIIPD-NAKEKPSQGKVLAVGPGARDEAGKVHKLDVKKGDTVLYGKWSGTEVKLDGKTVMIMRESDLMGIV 94
>gi|88860975|ref|ZP_01135610.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Pseudoalteromonas tunicata D2] >gi|88816903|gb|EAR26723.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Pseudoalteromonas tunicata D2] (95 aa)
Score = 123, Expect = 1.2e-05, Identities = 34/88 (38%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E ET +  GIVL  S  A+K + G + ++ +       E+    +  G TV F  Y     K++ QEYL++  D+ILG++
  S:     1 MNIRPLHDRVIVKRLEEETRSAGGIVLTGSA-AEKSTRGTVLAVGNGRVLDNGELRALEVKAGDTVLFGSYIEKVEKIEGQEYLIMREDNILGIV 94
>gi|146299604|ref|YP_001194195.1| co-chaperonin GroES [Flavobacterium johnsoniae UW101] >gi|146154022|gb|ABQ04876.1| chaperonin Cpn10 [Flavobacterium johnsoniae UW101] (91 aa)
Score = 123, Expect = 1.2e-05, Identities = 27/88 (30%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RVL++    ET T +GI +P++   +KP  G + ++ +   +  +TV  G TV + +Y   ++K++  +YL++  DDIL ++
  S:     3 LNIKPLSDRVLIEPVAAETKTASGIFIPDTAK-EKPQKGTVVAVGNGSKDHTMTVKVGDTVLYGKYAGTELKLEGTDYLIMREDDILAII 91
>gi|39094|emb|CAA48330.1| groES [Agrobacterium tumefaciens] (98 aa)
Score = 123, Expect = 1.3e-05, Identities = 28/86 (32%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++ VG  V F ++   ++K+D ++  +++  DI+G++
  S:     6 FRPLHDRVVVRRVESEAKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDEAGKVVALDVKVGDRVLFGQWSGTEVKLDGEDSSIMKEADIMGII 97
>gi|154504591|ref|ZP_02041329.1| hypothetical protein RUMGNA_02096 [Ruminococcus gnavus ATCC 29149] >gi|153795073|gb|EDN77493.1| hypothetical protein RUMGNA_02096 [Ruminococcus gnavus ATCC 29149] (94 aa)
Score = 123, Expect = 1.3e-05, Identities = 30/88 (34%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG +++LK+ E E TTK+GIVLP        +A+  + G    +  +     + VG  V + +Y    +++D +EY++V+ +DIL V+
  S:     1 MKLVPLGDKIVLKQLEAEETTKSGIVLPGQAKEKPQEAEVIAVGPGGMVDGKEVTMQVAVGDKVIYSKYAGTDVELDGEEYIIVKQNDILAVV 93
>gi|88801437|ref|ZP_01116965.1| co-chaperonin GroES [Polaribacter irgensii 23-P] >gi|88782095|gb|EAR13272.1| co-chaperonin GroES [Polaribacter irgensii 23-P] (91 aa)
Score = 123, Expect = 1.3e-05, Identities = 28/88 (31%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RVL++ +  ET T +G+++P+ N  +KP  G + +I +   +  LTV  G TV + +Y    +K++ ++YL++   DIL ++
  S:     3 LNIKPLADRVLIEPAAAETKTASGLIIPD-NAKEKPQQGTVVAIGNGKIDEPLTVKIGDTVLYSKYGGTDLKLEGKDYLMMRESDILAII 91
>gi|21715983|dbj|BAC02898.1| co-chaperonin [Thermus sp. TB1] (101 aa)
Score = 123, Expect = 1.4e-05, Identities = 33/85 (38%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSE--INNSN-----LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RV++KR E E  TK GIVLP++   +KP  G + ++ S   ++N       +  G  V F +Y   +I++D +EY+++   D+L VL
  S:    10 KPLGDRVVVKRIEEEPKTKGGIVLPDTAK-EKPQKGKVIAVGSGRILDNGQKVPLEVKEGGIVVFAKYGGTEIEIDGEEYVILSERDLLAVL 100
>gi|187933436|ref|YP_001884620.1| chaperonin GroS [Clostridium botulinum B str. Eklund 17B] >gi|187721589|gb|ACD22810.1| chaperonin GroS [Clostridium botulinum B str. Eklund 17B] (94 aa)
Score = 123, Expect = 1.4e-05, Identities = 30/88 (34%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K+ E E  TK+GIVL  S      +A+  + G    +        + VG  V + +Y   ++K+D +EY++++ DDIL ++
  S:     1 MRIKPLGNRVVIKKLEAEEKTKSGIVLTGSAKEVPQEAEVVAVGPGSIVDGTKIEMEVKVGDKVLYSKYSGTEVKLDGEEYMILKQDDILAIV 93
>gi|89896707|ref|YP_520194.1| hypothetical protein DSY3961 [Desulfitobacterium hafniense Y51] >gi|109647334|ref|ZP_01371238.1| chaperonin Cpn10 [Desulfitobacterium hafniense DCB-2] >gi|123091651|sp|Q24QE2|CH10_DESHY 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|89336155|dbj|BAE85750.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109642580|gb|EAT52134.1| chaperonin Cpn10 [Desulfitobacterium hafniense DCB-2] (94 aa)
Score = 123, Expect = 1.4e-05, Identities = 31/88 (35%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K   +E  TK+GI++P++   +KP  G + ++        E    ++ VG  V + +Y   ++K D QEYL+++  DIL V+
  S:     1 MNIKPLGDRVVIKALPMEEKTKSGIIMPDTAK-EKPQEGEVVAVGPGKMEKGERIVLDVKVGDRVIYSKYAGTEVKYDGQEYLILKETDILAVI 93
>gi|188535102|ref|YP_001908899.1| 10 kDa chaperonin (Protein Cpn10) [Erwinia tasmaniensis] >gi|188030144|emb|CAO98030.1| 10 kDa chaperonin (Protein Cpn10) [Erwinia tasmaniensis] (97 aa)
Score = 122, Expect = 1.6e-05, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR EVE+ +  GIVL  S  A K + G + ++       S ++   ++ VG  V F E Y A   K+DNQE L++   DIL ++
  S:     1 MKIRPLHDRVIVKRKEVESKSAGGIVLTGSA-AGKSTRGEVLAVGNGRILESGDVKPLDVKVGDVVIFSEGYGAKTEKIDNQEVLIISESDILAIV 95
>gi|121601908|ref|YP_989431.1| co-chaperonin GroES [Bartonella bacilliformis KC583] >gi|166233983|sp|A1UTX8|CH10_BARBK 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|50404497|gb|AAT76911.1| chaperonin GroES [Bartonella bacilliformis] >gi|120614085|gb|ABM44686.1| chaperonin GroS [Bartonella bacilliformis KC583] (98 aa)
Score = 122, Expect = 1.6e-05, Identities = 27/87 (31%), Positives = 55/87 (63%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R E E  T  GI++P++   +KP  G + ++ + + N N       +  G  + F ++   ++K++ +E L+++  DI+G+L
  S:     5 KFRPLHDRVVVRRVESENKTAGGIIIPDTAQ-EKPQEGEVIAVGNGVLNDNGQRVSLEVKEGDRILFGKWSGTEVKINGEELLIMKESDIMGIL 97
>gi|110635425|ref|YP_675633.1| chaperonin Cpn10 [Mesorhizobium sp. BNC1] >gi|110286409|gb|ABG64468.1| chaperonin Cpn10 [Mesorhizobium sp. BNC1] (104 aa)
Score = 122, Expect = 1.7e-05, Identities = 26/90 (28%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+FRPL  R+L++R E E  T  G+++P++   +KP  G + ++   + +         + VG  + F ++   +I++  ++ L+++  D+LG+L K
  S:     1 MKFRPLHDRLLVRRIEAEEKTAGGVIIPDTAK-EKPQEGEVLAVGPGVRDEKGELIALEVKVGDRILFGKWSGTEIRLQGEDLLIMKESDVLGILDK 96
>gi|51090747|dbj|BAD35227.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group] (235 aa)
Score = 122, Expect = 1.8e-05, Identities = 29/86 (33%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RVL+K    E  T  GI+LP++  + KP  G +      ++I  +    +L +GA V + +Y   +++ ++ ++L+++ DDI+GVL
  S:    61 LKPLGDRVLVKLGAAEEKTVGGILLPSTAQS-KPQGGEVVAVGEGRTIGDKKVEVSLQIGAEVVYSKYAGTEVQFNDTKHLILKEDDIIGVL 151
>gi|29840400|ref|NP_829506.1| co-chaperonin GroES [Chlamydophila caviae GPIC] >gi|116191|sp|P15598|CH10_CHLCV 10 kDa chaperonin (Protein Cpn10) (groES protein) (11.2 kDa stress response protein) >gi|40578|emb|CAA35765.1| hypA protein [Chlamydophila caviae] >gi|29834749|gb|AAP05384.1| 10 kDa chaperonin [Chlamydophila caviae GPIC] (102 aa)
Score = 122, Expect = 1.8e-05, Identities = 26/88 (29%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PLG R+L+KR E ++T + GI+LP++   ++    ++      +     +    +TVG TV   +Y   ++ VD +EY++V+  +++ VL
  S:     8 LRIKPLGDRILVKREEEDSTARGGIILPDTAKKKQDRAEVLVLGTGKRDKDGNVLPFEVTVGDTVLIDKYAGQELTVDGEEYVIVQESEVMAVL 101
>gi|126326775|ref|XP_001379358.1| PREDICTED: similar to cpn10 protein [Monodelphis domestica] (246 aa)
Score = 122, Expect = 1.8e-05, Identities = 30/85 (35%), Positives = 48/85 (56%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILG 86
           +F PL  RVL++RS  ET TK GI+LP  +  +     ++      K  S EI   ++ VG  V   EY   ++ +++++Y +    DILG
  S:   152 KFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKSGEIQPVSVKVGDKVLLPEYGGTKVVLEDKDYFLFRDGDILG 242
>gi|189346040|ref|YP_001942569.1| chaperonin Cpn10 [Chlorobium limicola DSM 245] >gi|189340187|gb|ACD89590.1| chaperonin Cpn10 [Chlorobium limicola DSM 245] (95 aa)
Score = 122, Expect = 1.9e-05, Identities = 26/88 (29%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RV++K +  E  TK G+ +P++   +KP YG + ++       + ++ +  +TVG  V + +Y   ++ V+ ++YL++   DI  +L
  S:     1 MNLKPLADRVIVKPAPAEEKTKGGLFIPDTGK-EKPQYGEVVAVGPGKVADNGQLLDMQVTVGKKVLYGKYSGTEVNVEGEDYLIMRESDIFAIL 94
>gi|119357733|ref|YP_912377.1| co-chaperonin GroES [Chlorobium phaeobacteroides DSM 266] >gi|166233993|sp|A1BHS6|CH10_CHLPD 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|119355082|gb|ABL65953.1| chaperonin Cpn10 [Chlorobium phaeobacteroides DSM 266] (95 aa)
Score = 122, Expect = 1.9e-05, Identities = 26/88 (29%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RV++K +  E  TK G+++P++   +KP YG + ++       S ++    + VG  V + +Y   ++ V+ ++YL++   DI  +L
  S:     1 MNLKPLADRVIVKPAPAEEKTKGGLIIPDTGK-EKPQYGEVVAVGTGKVADSGQLLEMQIKVGQKVLYGKYSGTEVSVEGEDYLIMRESDIFAIL 94
>gi|16262849|ref|NP_435642.1| co-chaperonin GroES [Sinorhizobium meliloti 1021] >gi|20137877|sp|Q92ZQ3|CH104_RHIME 10 kDa chaperonin 4 (Protein Cpn10 4) (groES protein 4) >gi|14523486|gb|AAK65054.1| groES2 chaperonin [Sinorhizobium meliloti 1021] (98 aa)
Score = 122, Expect = 1.9e-05, Identities = 26/87 (29%), Positives = 55/87 (63%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R E E  TK G+++P++   +KP  G I ++ S   +        ++  G  + F ++   ++K++ ++ L+++  DI+GV+
  S:     5 DFRPLHDRVVVRRVESEEKTKGGVIIPDTAK-EKPQEGEIVAVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVI 97
>gi|167362530|ref|ZP_02297053.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167070618|gb|EDR74571.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] (104 aa)
Score = 122, Expect = 2.0e-05, Identities = 25/88 (28%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L+ R + E  TK GI++P++   +KP  G + ++       + +I   ++  G  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVHRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNDAGQIQALDVKPGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|149369940|ref|ZP_01889791.1| co-chaperonin GroES [unidentified eubacterium SCB49] >gi|149356431|gb|EDM44987.1| co-chaperonin GroES [unidentified eubacterium SCB49] (98 aa)
Score = 122, Expect = 2.0e-05, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           ++ +PL  RV+++    ET T +GI +P+S   +KP  G + ++    ++  +TV  G TV + +Y   ++K++  +YL++  DDIL ++
  S:    10 LKIQPLSDRVVVEPQPAETKTASGIYIPDSAK-EKPQQGKVAAVGKGKDDQKMTVKVGDTVLYGKYAGTELKLEGNDYLIMREDDILAII 98
>gi|77359227|ref|YP_338802.1| chaperonin [Pseudoalteromonas haloplanktis TAC125] >gi|23813808|sp|Q9AKT2|CH10_PSEHT 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|12697198|emb|CAC28359.1| groES protein [Pseudoalteromonas haloplanktis TAC125] >gi|76874138|emb|CAI85359.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Pseudoalteromonas haloplanktis TAC125] (95 aa)
Score = 122, Expect = 2.0e-05, Identities = 34/88 (38%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E ET +  GIVL  S  A+K + G + ++       S ++    +  G TV F  Y     K++ QEYL++  D+ILG++
  S:     1 MNIRPLHDRVIVKRLEEETKSAGGIVLTGSA-AEKSTRGEVVAVGNGRILESGDVRALEVKAGDTVLFGSYVEKVEKIEGQEYLIMREDNILGIV 94
>gi|15616647|ref|NP_239859.1| co-chaperonin GroES [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|116187|sp|P25749|CH10_BUCAI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|285431|pir||A42281 symbionin symS - pea aphid >gi|25300331|pir||A84932 10 kD chaperonin [imported] - Buchnera sp. (strain APS) >gi|5659|emb|CAA43459.1| symbionin [Buchnera aphidicola (Acyrthosiphon pisum)] >gi|10038710|dbj|BAB12745.1| 10 kD chaperonin [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (96 aa)
Score = 121, Expect = 2.1e-05, Identities = 36/88 (40%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RVL+KR EVE+ +  GIVL  S  A K + G + ++       + +I   ++ VG  V F E Y A   K+DN+E L++   DIL ++
  S:     1 MKIRPLHDRVLVKRQEVESKSAGGIVLTGSA-AGKSTRGTVTAVGKGRVLDNGDIKPLDVKVGDVVIFNEGYGAKTEKIDNEELLILTESDILAIV 95
>gi|584917|sp|Q07200|CH10_BACST 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|6526960|dbj|BAA88109.1| Cpn10 [Bacillus sp. MS] >gi|7019626|gb|AAA22751.2| GroES [Geobacillus stearothermophilus] (94 aa)
Score = 121, Expect = 2.1e-05, Identities = 31/86 (36%), Positives = 51/86 (59%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RV+++  E E  T +GIVLP++   +KP  G + ++       S E     + VG  + F +Y   ++K D +EYL++   DIL V+
  S:     2 LKPLGDRVVIEVIETEEKTASGIVLPDTAK-EKPQEGRVVAVGKGRVLDSGERVAPEVEVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVI 93
>gi|86160011|ref|YP_466796.1| chaperonin Cpn10, GroES [Anaeromyxobacter dehalogenans 2CP-C] >gi|163766489|ref|ZP_02173514.1| chaperonin Cpn10 [Anaeromyxobacter sp. K] >gi|167456850|ref|ZP_02323066.1| chaperonin Cpn10 [Anaeromyxobacter dehalogenans 2CP-1] >gi|85776522|gb|ABC83359.1| Chaperonin Cpn10, GroES [Anaeromyxobacter dehalogenans 2CP-C] >gi|167416673|gb|EDR83384.1| chaperonin Cpn10 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196173899|gb|ACG74872.1| chaperonin Cpn10 [Anaeromyxobacter sp. K] (97 aa)
Score = 121, Expect = 2.1e-05, Identities = 29/87 (33%), Positives = 55/87 (63%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + RPL  R+++KR + E  TK GI++P+S   +KP  G + +  +       ++   ++  G  V F +Y   ++K+D +E+L++  +DILGV+
  S:     3 KIRPLQDRLIVKRVQEEEKTKGGIIIPDSAK-EKPIEGKVIAAGNGKVLEDGKVRPLDVKAGDRVLFSKYAGTEVKIDGEEHLIMREEDILGVI 95
>gi|110803873|ref|YP_699551.1| co-chaperonin GroES [Clostridium perfringens SM101] >gi|123145912|sp|Q0SQQ6|CH10_CLOPS 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|110684374|gb|ABG87744.1| chaperonin, 10 kDa [Clostridium perfringens SM101] (94 aa)
Score = 121, Expect = 2.1e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E TTK+GI++  +      +A+  + G    I  +     + +G  V + +Y   ++K + +EY ++  DDIL ++
  S:     1 MSIKPLGDRVVIKRLEAEETTKSGIIVTGTAKERPQEAEVVAVGPGAIIDGKRTEMEVKIGDKVLYSKYAGTEVKFEGEEYTILRQDDILAIV 93
>gi|116249308|ref|YP_765149.1| putative 10 kDa chaperonin [Rhizobium leguminosarum bv. viciae 3841] >gi|115253958|emb|CAK12353.1| putative 10 kDa chaperonin [Rhizobium leguminosarum bv. viciae 3841] (104 aa)
Score = 121, Expect = 2.2e-05, Identities = 25/88 (28%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  R+L++R + E  TK GI++P++   +KP  G + ++     N        ++  G  + F ++   +IK++ ++ L+++  D++G++
  S:     1 MSFRPLHDRILVRRVDSEEKTKGGIIIPDTAK-EKPQEGEVIAVGPGARNEAGQILALDVKPGDRILFGKWSGTEIKINGEDLLIMKESDVMGII 94
>gi|114769407|ref|ZP_01447033.1| Chaperonin Cpn10 (GroES) [alpha proteobacterium HTCC2255] >gi|114550324|gb|EAU53205.1| Chaperonin Cpn10 (GroES) [alpha proteobacterium HTCC2255] (94 aa)
Score = 121, Expect = 2.2e-05, Identities = 31/88 (35%), Positives = 49/88 (55%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M F PL  RVL++R E E  T  G+++P S   +KP+ G I S        N       +  G  V F ++   ++ +D +E L+++  DILG+L
  S:     1 MAFTPLHDRVLVRRIEGEEKTAGGLIIPESAK-EKPAEGEIISAGEGARKDNGELIPMAVKAGDKVLFGKWSGTEVTIDGEELLIMKESDILGLL 94
>gi|38233184|ref|NP_938951.1| co-chaperonin GroES [Corynebacterium diphtheriae NCTC 13129] >gi|60389662|sp|Q6NJ38|CH10_CORDI 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|38199443|emb|CAE49088.1| 10 kDa chaperonin [Corynebacterium diphtheriae] >gi|113013900|gb|ABI29892.1| 10 kDa chaperonin GroES [Corynebacterium pseudotuberculosis] (98 aa)
Score = 121, Expect = 2.3e-05, Identities = 31/90 (34%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV------GATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           +  +PL  RVL++ SE ETTT +G+V+P+S   +KP  G++ +      + +  V      G TV F +Y   ++K + +EYL++   D+L ++ K
  S:     4 VNIKPLEDRVLVQISEAETTTASGLVIPDSAK-EKPQEGVVVAAGPGRFDGDDRVPMDIKEGDTVVFSKYGGTELKYNGEEYLLLNARDVLAIIEK 98
>gi|20807075|ref|NP_622246.1| Co-chaperonin GroES (HSP10) [Thermoanaerobacter tengcongensis MB4] >gi|23813778|sp|Q8R5T8|CH10_THETN 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|20515565|gb|AAM23850.1| Co-chaperonin GroES (HSP10) [Thermoanaerobacter tengcongensis MB4] (94 aa)
Score = 121, Expect = 2.3e-05, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K  + E  TK G++LP +   +KP  G +      + I  +     + VG  V F +Y   ++K+D +EYL++   DIL ++
  S:     1 MRLKPLGDRVVVKVIQSEEVTKGGVILPGTAK-EKPQQGEVVAVGPGQYIDGKRVEPEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAII 93
>gi|124004892|ref|ZP_01689735.1| chaperonin GroS [Microscilla marina ATCC 23134] >gi|123989570|gb|EAY29116.1| chaperonin GroS [Microscilla marina ATCC 23134] (89 aa)
Score = 121, Expect = 2.3e-05, Identities = 29/88 (32%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++ +E E  T +GI++P++   +KP  G I ++ +   +  LTV  G  V + +Y   +I V+ +EYL++   DI  ++
  S:     1 MNIKPLADRVLVEPAEAEEKTASGIIIPDTAK-EKPQRGKIVAVGNGKKDEPLTVQAGDQVLYGKYAGTEITVEGKEYLIMREADIFAIV 89
>gi|56552824|ref|YP_163663.1| co-chaperonin GroES [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802830|sp|P48229|CH10_ZYMMO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|56544398|gb|AAV90552.1| 10 kDa chaperonin, GroES [Zymomonas mobilis subsp. mobilis ZM4] (95 aa)
Score = 121, Expect = 2.3e-05, Identities = 27/88 (30%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R   E  T  GI++P++   +KP  G + +  +  ++        ++  G  V F ++   +++VD ++ L+++  DILG++
  S:     1 MNFRPLHDRVLVRRVAAEEKTAGGIIIPDTAK-EKPQEGEVIAAGNGTHSEDGKVVPLDVKAGDRVLFGKWSGTEVRVDGEDLLIMKESDILGII 94
>gi|115376731|ref|ZP_01463958.1| chaperonin GroS [Stigmatella aurantiaca DW4/3-1] >gi|115366280|gb|EAU65288.1| chaperonin GroS [Stigmatella aurantiaca DW4/3-1] (96 aa)
Score = 121, Expect = 2.4e-05, Identities = 28/90 (31%), Positives = 56/90 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+ RPL  R+++KR   E  TK G+ +P++   +KP  G + ++ +       ++   ++    T+ F +Y   +IK+D +E+L++  +D+LGV+ K
  S:     1 MKIRPLQDRLIVKRVAEENKTKGGLFIPDTAK-EKPLEGKVVAVGNGKILEDGKVRPLDIKANDTILFSKYAGTEIKIDGEEHLILREEDVLGVIEK 96
>gi|29839374|sp|Q8TGX8|CH10_METAC 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|19914428|gb|AAM04073.1| groES protein (Cpn10) [Methanosarcina acetivorans C2A] (109 aa)
Score = 121, Expect = 2.4e-05, Identities = 30/85 (35%), Positives = 53/85 (62%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RP+G+RVLLK  + E  TK GI +P S   +K   GI+ ++ +  +   L +  G  V +  Y+A++I++D+++Y+ V+  DIL  +
  S:    21 RPIGERVLLKHQKKEEVTKGGIYIPESARQEKKE-GIVIAVGTFEDGKELPLKKGDHVIYGGYQADEIEIDDEKYIFVDFKDILATV 106
>gi|155595|gb|AAA62398.1| groES (95 aa)
Score = 121, Expect = 2.4e-05, Identities = 27/88 (30%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M FRPL  RVL++R   E  T  GI++P++   +KP  G + +  +  ++        ++  G  V F ++   +++VD ++ L+++  DILG++
  S:     1 MNFRPLHDRVLVRRVAAEEKTAGGIIIPDTAK-RKPQEGEVIAAGNGTHSEDGKVVPLDVKAGDRVLFGKWSGTEVRVDGEDLLIMKESDILGII 94
>gi|87309069|ref|ZP_01091206.1| GroES/HSP10-like protein [Blastopirellula marina DSM 3645] >gi|87288060|gb|EAQ79957.1| GroES/HSP10-like protein [Blastopirellula marina DSM 3645] (109 aa)
Score = 121, Expect = 2.5e-05, Identities = 36/86 (41%), Positives = 53/86 (61%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-----EINNSNLTV--GATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
            +PLG RV++KR E E TT  GIVLP +    KPS G++ S+ +     + N S L V  G  V F  Y  ++  K+ ++E +++  DDI  VL
  S:    15 LQPLGDRVVVKRDESEETTAGGIVLPGAAQ-DKPSRGVVVSVGNGRLLDDGNRSPLQVAPGDRVIFGRYAGSDTFKLGDEEVILIREDDIQAVL 107
>gi|149176967|ref|ZP_01855576.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Planctomyces maris DSM 8797] >gi|148844222|gb|EDL58576.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Planctomyces maris DSM 8797] (105 aa)
Score = 121, Expect = 2.5e-05, Identities = 35/82 (42%), Positives = 49/82 (59%)
  Q:     5 PLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS-----ISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILG 86
           PLG +V+LKR   E+TT  GIVLP+S    KP  G + +     + S+     LTV  G  V F  Y  ++IK+  +EYL++   DIL 
  S:    16 PLGDKVVLKREVAESTTAGGIVLPDSAQ-DKPQRGEVVAVGDGHVKSDGTKLPLTVKEGDRVIFSPYGGDEIKIGGEEYLLLRESDILA 103
>gi|86356475|ref|YP_468367.1| co-chaperonin GroES [Rhizobium etli CFN 42] >gi|190890536|ref|YP_001977078.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] >gi|86280577|gb|ABC89640.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] >gi|190695815|gb|ACE89900.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] (98 aa)
Score = 120, Expect = 2.6e-05, Identities = 27/86 (31%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++  G  V F ++   ++K++ ++ L+++  DI+G++
  S:     6 FRPLHDRVVVRRVESEEKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDESGKVVALDVKAGDRVLFGKWSGTEVKINGEDLLIMKEADIMGII 97
>gi|15964546|ref|NP_384899.1| co-chaperonin GroES [Sinorhizobium meliloti 1021] >gi|543987|sp|P35473|CH101_RHIME 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) >gi|152234|gb|AAA26284.1| groES >gi|643067|gb|AAA61954.1| GroES >gi|1946293|emb|CAA73088.1| cpn10-2 [Rhizobium leguminosarum] >gi|15073724|emb|CAC45365.1| 10 KD chaperonin A [Sinorhizobium meliloti 1021] (98 aa)
Score = 120, Expect = 2.6e-05, Identities = 27/86 (31%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RV+++R E E  TK GI++P++   +KP  G I ++ S   +        ++  G  + F ++   ++K++ ++ L+++  DI+GV+
  S:     6 FRPLHDRVVVRRVESEEKTKGGIIIPDTAK-EKPQEGEIVAVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVI 97
>gi|58040331|ref|YP_192295.1| co-chaperonin GroES [Gluconobacter oxydans 621H] >gi|58002745|gb|AAW61639.1| Chaperonin GroES [Gluconobacter oxydans 621H] (100 aa)
Score = 120, Expect = 2.7e-05, Identities = 28/87 (32%), Positives = 52/87 (59%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R   E  T  GI++P++    KP+ G + S+     N        ++  G  V F ++   ++K+D +E L+++  DI+GV+
  S:     7 KFRPLHDRVVVRRLTGEEKTAGGIIIPDTAK-DKPTEGEVVSVGPGARNEQGQVVALDVKAGDKVLFGKWSGTEVKIDGEELLIMKESDIMGVI 99
>gi|77539352|dbj|BAE46548.1| GroES [Gluconobacter oxydans] (96 aa)
Score = 120, Expect = 2.7e-05, Identities = 28/87 (32%), Positives = 52/87 (59%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +FRPL  RV+++R   E  T  GI++P++    KP+ G + S+     N        ++  G  V F ++   ++K+D +E L+++  DI+GV+
  S:     3 KFRPLHDRVVVRRLTGEEKTAGGIIIPDTAK-DKPTEGEVVSVGPGARNEQGQVVALDVKAGDKVLFGKWSGTEVKIDGEELLIMKESDIMGVI 95
>gi|167038117|ref|YP_001665695.1| chaperonin Cpn10 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039171|ref|YP_001662156.1| chaperonin Cpn10 [Thermoanaerobacter sp. X514] >gi|166853411|gb|ABY91820.1| chaperonin Cpn10 [Thermoanaerobacter sp. X514] >gi|166856951|gb|ABY95359.1| chaperonin Cpn10 [Thermoanaerobacter pseudethanolicus ATCC 33223] (94 aa)
Score = 120, Expect = 2.8e-05, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K  + E  TK G++LP +   +KP  G +      + I  +     + VG  V F +Y   ++K+D +EYL++   DIL ++
  S:     1 MRLKPLGDRVVVKVIQAEEVTKGGVILPGTAK-EKPQQGEVVAVGTGQYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAII 93
>gi|149624638|ref|XP_001516202.1| PREDICTED: similar to cpn10 protein [Ornithorhynchus anatinus] (210 aa)
Score = 120, Expect = 2.9e-05, Identities = 28/85 (32%), Positives = 48/85 (56%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILG 86
           +F PL  R+L++RS  ET TK GI+LP  +  +     ++      K  S E+   ++ VG  V   EY   ++ +++++Y +    DILG
  S:   116 KFLPLFDRILVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKSGELQPVSVEVGDKVLLPEYGGTKVVLEDKDYFLFRDGDILG 206
>gi|119590560|gb|EAW70154.1| heat shock 10kDa protein 1 (chaperonin 10), isoform CRA_a [Homo sapiens] (84 aa)
Score = 120, Expect = 2.9e-05, Identities = 31/85 (36%), Positives = 44/85 (51%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILG 86
           +F PL  RVL++RS  ET TK GI+LP             KS   EI   ++ VG  V   EY   ++ +D+++Y +    DILG
  S:     8 KFLPLFDRVLVERSAAETVTKGGIMLPE------------KSQGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILG 80
>gi|161833792|ref|YP_001597988.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri GWSS] >gi|152206282|gb|ABS30592.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri GWSS] (92 aa)
Score = 120, Expect = 2.9e-05, Identities = 27/88 (30%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           ++ +PL  RV+++ S  ET T +GI++P++   +KP  GI+ ++     N  LTV  G  V + +Y   +++++ ++YL++   DIL ++
  S:     4 LKIKPLSDRVVIEPSPAETKTSSGIIIPDTAK-EKPQEGIVVAVGLGKKNEPLTVKTGNKVLYGKYSGTELRLNGKDYLIMRESDILAII 92
>gi|115466912|ref|NP_001057055.1| Os06g0196900 [Oryza sativa (japonica cultivar-group)] >gi|113595095|dbj|BAF18969.1| Os06g0196900 [Oryza sativa (japonica cultivar-group)] (221 aa)
Score = 120, Expect = 3.0e-05, Identities = 29/86 (33%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RVL+K    E  T  GI+LP++  + KP  G +      ++I  +    +L +GA V + +Y   +++ ++ ++L+++ DDI+GVL
  S:    61 LKPLGDRVLVKLGAAEEKTVGGILLPSTAQS-KPQGGEVVAVGEGRTIGDKKVEVSLQIGAEVVYSKYAGTEVQFNDTKHLILKEDDIIGVL 151
>gi|50955520|ref|YP_062808.1| co-chaperonin GroES [Leifsonia xyli subsp. xyli str. CTCB07] >gi|60389554|sp|Q6AD41|CH10_LEIXX 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|50952002|gb|AAT89703.1| 10kDa chaperonin [Leifsonia xyli subsp. xyli str. CTCB07] (98 aa)
Score = 120, Expect = 3.0e-05, Identities = 27/90 (30%), Positives = 55/90 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           +  +PL  R+++K+ E E TT +G+V+P++   +KP  G+++++     + N       + VG  V + +Y   ++K   Q+YLV+   D+L V+ +
  S:     3 VSIKPLEDRIVIKQVEAEQTTASGLVIPDTAK-EKPQEGVVEAVGPGRIDDNGNRVPLDVAVGDKVIYSKYGGTEVKFGGQDYLVLSARDVLAVVVR 98
>gi|71410857|ref|XP_807703.1| 10 kDa heat shock protein, putative [Trypanosoma cruzi strain CL Brener] >gi|70871761|gb|EAN85852.1| 10 kDa heat shock protein, putative [Trypanosoma cruzi] (180 aa)
Score = 120, Expect = 3.0e-05, Identities = 28/87 (32%), Positives = 51/87 (58%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTVGA--TVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PLG+RVL+KR+     TK G+++P    A K + G + ++++   +   TV    TV   E+  + +KV+ +E+ +   D +LGVL
  S:    91 KLQPLGQRVLVKRTLAAKQTKAGVLIPEQV-AGKVNEGTVVAVAAATKDWTPTVKVDDTVLLPEFGGSSVKVEGEEFFLYNEDSLLGVL 178
>gi|118586623|ref|ZP_01544063.1| heat-shock protein 10 kDa chaperonin, class I [Oenococcus oeni ATCC BAA-1163] >gi|118432938|gb|EAV39664.1| heat-shock protein 10 kDa chaperonin, class I [Oenococcus oeni ATCC BAA-1163] (117 aa)
Score = 120, Expect = 3.0e-05, Identities = 32/85 (37%), Positives = 53/85 (62%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS-SEINNS----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG R++L   + E     GI++ N N  +KP  G + +IS + + +S    ++ VG  V F +Y  +Q+ +D ++YL+V   DILGVL
  S:    29 KPLGDRIVLSIDQPEEEKVGGILIAN-NAKEKPVMGSVVAISETSVGDSKAPKSVKVGDKVMFDKYAGSQVTIDGEDYLIVHEKDILGVL 117
>gi|116623877|ref|YP_826033.1| chaperonin Cpn10 [Solibacter usitatus Ellin6076] >gi|116227039|gb|ABJ85748.1| chaperonin Cpn10 [Solibacter usitatus Ellin6076] (107 aa)
Score = 120, Expect = 3.0e-05, Identities = 28/88 (31%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR +     + GI++P++   +KP    +K++ +       E    ++  G  + F +Y   +IK+D +EYL++  D+IL +L
  S:    13 MDLRPLHDRVMVKRLDEGEQVRGGIIIPDTAK-EKPQQAEVKAVGNGKLLENGERVALDVKAGDRILFGKYGGAEIKIDGEEYLILREDEILAIL 106
>gi|156742738|ref|YP_001432867.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941] >gi|156234066|gb|ABU58849.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941] (98 aa)
Score = 120, Expect = 3.1e-05, Identities = 28/88 (31%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K    E  TK G++LP++   ++P  G + ++         ++   ++ VG  V F +Y   + K+D++EYL+++  D+LG++
  S:     1 MHVQPLGDRVVVKPKPKEEKTKGGVILPDTATKERPMQGEVIAVGPGRRTDDGKLIPVSVEVGQQVLFAKYSGTEFKIDDEEYLILQERDLLGII 95
>gi|192811353|ref|ZP_03040024.1| chaperonin Cpn10 [Geobacillus sp. Y412MC10] >gi|192799916|gb|EDV76425.1| chaperonin Cpn10 [Geobacillus sp. Y412MC10] (93 aa)
Score = 120, Expect = 3.1e-05, Identities = 34/85 (40%), Positives = 50/85 (58%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG+RVL++  E E TT  GIVLP+S   +KP  G + ++ S        V      G  V F +Y   +IK + +EYL+++  DI  +L
  S:     3 RPLGERVLVEPIEQEETTAFGIVLPDSAK-EKPQEGKVIAVGSGSLKDGARVPLEVKEGDRVIFSKYAGTEIKYEGKEYLIMKESDIHAIL 92
>gi|18311272|ref|NP_563206.1| co-chaperonin GroES [Clostridium perfringens str. 13] >gi|110800041|ref|YP_696964.1| co-chaperonin GroES [Clostridium perfringens ATCC 13124] >gi|168205120|ref|ZP_02631125.1| chaperonin, 10 kDa [Clostridium perfringens E str. JGS1987] >gi|168211639|ref|ZP_02637264.1| chaperonin, 10 kDa [Clostridium perfringens B str. ATCC 3626] >gi|168213201|ref|ZP_02638826.1| chaperonin, 10 kDa [Clostridium perfringens CPE str. F4969] >gi|168216745|ref|ZP_02642370.1| chaperonin, 10 kDa [Clostridium perfringens NCTC 8239] >gi|169347059|ref|ZP_02866001.1| chaperonin, 10 kDa [Clostridium perfringens C str. JGS1495] >gi|182625541|ref|ZP_02953312.1| chaperonin, 10 kDa [Clostridium perfringens D str. JGS1721] >gi|123049619|sp|Q0TN26|CH10_CLOP1 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|116193|sp|P26822|CH10_CLOPE 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|40571|emb|CAA44696.1| HSP10 chaperonin [Clostridium perfringens] >gi|18145955|dbj|BAB81996.1| GroES protein [Clostridium perfringens str. 13] >gi|110674688|gb|ABG83675.1| chaperonin, 10 kDa [Clostridium perfringens ATCC 13124] >gi|169296742|gb|EDS78871.1| chaperonin, 10 kDa [Clostridium perfringens C str. JGS1495] >gi|170663235|gb|EDT15918.1| chaperonin, 10 kDa [Clostridium perfringens E str. JGS1987] >gi|170710384|gb|EDT22566.1| chaperonin, 10 kDa [Clostridium perfringens B str. ATCC 3626] >gi|170715213|gb|EDT27395.1| chaperonin, 10 kDa [Clostridium perfringens CPE str. F4969] >gi|177909229|gb|EDT71694.1| chaperonin, 10 kDa [Clostridium perfringens D str. JGS1721] >gi|182381190|gb|EDT78669.1| chaperonin, 10 kDa [Clostridium perfringens NCTC 8239] (94 aa)
Score = 120, Expect = 3.2e-05, Identities = 27/88 (30%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++KR E E TTK+GI++  +      +A+  + G    +  +     + +G  V + +Y   ++K + +EY ++  DDIL ++
  S:     1 MSIKPLGDRVVIKRLEAEETTKSGIIVTGTAKERPQEAEVVAVGPGAIVDGKRTEMEVKIGDKVLYSKYAGTEVKFEGEEYTILRQDDILAIV 93
>gi|37779198|gb|AAP03435.1| GroES [Ruminococcus flavefaciens] (90 aa)
Score = 120, Expect = 3.2e-05, Identities = 28/88 (31%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RV++K +E E TT++GI+L  S   +KP +  +  +    ++  + V  G  V   +Y    +K+D +EY++V ++DIL ++
  S:     1 MTIKPLQDRVVVKMAEAEETTQSGIILTGSAK-EKPEFAEVIEVGPGTSDVKMEVKKGDKVLISKYSGTNVKLDGEEYIIVRMEDILAIV 89
>gi|2493659|sp|Q60023|CH10_THEBR 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|1326190|gb|AAB00558.1| chaperonin 10 (94 aa)
Score = 120, Expect = 3.2e-05, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG RV++K  + E  TK G++LP +   +KP  G +      + I  +     + VG  V F +Y   ++K+D +EYL++   DIL ++
  S:     1 MRLKPLGDRVVVKVIQAEEVTKGGVILPGTAK-EKPQQGEVVAVGTGEYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAII 93
>gi|23813782|sp|Q8RU01|CH10_BRECH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|18700290|dbj|BAB85115.1| GroES [Brevibacillus choshinensis] (94 aa)
Score = 120, Expect = 3.3e-05, Identities = 32/86 (37%), Positives = 51/86 (59%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RV+++    +  T +GIVLP+S   +KP  G + ++ S     N       +  G  V F +Y   ++KVDN+EYLV+   DIL ++
  S:     2 LKPLGDRVVIEAISKDEMTASGIVLPDSAK-EKPQEGRVIAVGSGRVADNGERIALEVKDGDKVIFSKYAGTEVKVDNKEYLVLRESDILAII 93
>gi|21780187|gb|AAM77651.1|AF522274_1 cp10-like protein [Gossypium hirsutum] (256 aa)
Score = 120, Expect = 3.4e-05, Identities = 30/85 (35%), Positives = 54/85 (63%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RVL+K  E E  T+ GI+LP +  + KP  G +      K+I +  + S++  GA V + +Y   +++ +   +L+++ DDI+G+L
  S:    66 KPLGDRVLVKIKETEEKTEGGILLPTTAQS-KPQGGEVVAVGEGKTIGNTKSESSVKTGAQVIYSKYAGTEVEFNGANHLLLKEDDIVGLL 155
>gi|46580386|ref|YP_011194.1| chaperonin, 10 kDa [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602242|ref|YP_966642.1| chaperonin Cpn10 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|81699064|sp|Q72AL5|CH10_DESVH 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|166234000|sp|A1VCP9|CH10_DESVV 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|46449803|gb|AAS96453.1| chaperonin, 10 kDa [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562471|gb|ABM28215.1| chaperonin Cpn10 [Desulfovibrio vulgaris subsp. vulgaris DP4] (95 aa)
Score = 120, Expect = 3.4e-05, Identities = 31/88 (35%), Positives = 50/88 (56%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL+KR E E  T  G+ +P++   +KPS G + +          ++    +  G  V F +Y   +IK+D  E+LV+  DDIL ++
  S:     1 MNLKPLNDRVLVKRLESEEKTAGGLYIPDTAK-EKPSRGEVVAAGPGKTADDGKLVAMTVKAGDMVLFNKYAGTEIKIDGVEHLVMREDDILAII 94
>gi|169244314|gb|ACA50470.1| GroES [Xenorhabdus nematophila] (97 aa)
Score = 120, Expect = 3.4e-05, Identities = 36/88 (40%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV++KR+EVE+ +  GIVL  S  A K + G I ++       + E+   ++ VG TV F E Y     K+DN+E L++   DIL ++
  S:     1 MKIRPLHDRVIVKRTEVESKSAGGIVLTGSA-AGKSTRGEILAVGNGRILENGEVKALDVKVGDTVIFNEGYGVKTEKIDNEEVLIMSESDILAIV 95
>gi|114705803|ref|ZP_01438706.1| co-chaperonin GroES [Fulvimarina pelagi HTCC2506] >gi|114538649|gb|EAU41770.1| co-chaperonin GroES [Fulvimarina pelagi HTCC2506] (98 aa)
Score = 120, Expect = 3.4e-05, Identities = 28/86 (32%), Positives = 53/86 (61%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV-------GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           FRPL  RVL++R E E  T  GI++P++   +KP  G I ++ S   + +  V       G  V F ++   ++K++ ++ L+++  DI+G++
  S:     6 FRPLHDRVLVRRVESEAKTAGGIIIPDTAK-EKPQEGEIVAVGSGARDDSGKVVPLDVKQGDRVLFGKWSGTEVKLNGEDLLIMKESDIMGIV 97
>gi|139438486|ref|ZP_01772002.1| Hypothetical protein COLAER_00992 [Collinsella aerofaciens ATCC 25986] >gi|133776025|gb|EBA39845.1| Hypothetical protein COLAER_00992 [Collinsella aerofaciens ATCC 25986] (108 aa)
Score = 119, Expect = 3.4e-05, Identities = 30/86 (34%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-EINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PL  RVL+K  E E  T +G+ +  SN  +KP  G I ++ + ++N+       ++ VG  V + ++  N++KVD ++YL++  DDI  V+
  S:    15 LKPLADRVLVKPDEAEQKTASGLYIA-SNAQEKPQRGTIVAVGAGKVNDKGERIPMDVQVGDVVIYGKFGGNEVKVDGEKYLLMRADDIYAVV 106
>gi|51090748|dbj|BAD35228.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group] >gi|125554411|gb|EAZ00017.1| hypothetical protein OsI_021249 [Oryza sativa (indica cultivar-group)] >gi|125596360|gb|EAZ36140.1| hypothetical protein OsJ_019623 [Oryza sativa (japonica cultivar-group)] (252 aa)
Score = 119, Expect = 3.4e-05, Identities = 29/86 (33%), Positives = 54/86 (62%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RVL+K    E  T  GI+LP++  + KP  G +      ++I  +    +L +GA V + +Y   +++ ++ ++L+++ DDI+GVL
  S:    61 LKPLGDRVLVKLGAAEEKTVGGILLPSTAQS-KPQGGEVVAVGEGRTIGDKKVEVSLQIGAEVVYSKYAGTEVQFNDTKHLILKEDDIIGVL 151
Score = 102, Expect = 3.7e-03, Identities = 29/87 (33%), Positives = 51/87 (58%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-----SSEINNSNLTV--GATVYFKEYKANQIK-VDNQEYLVVELDDILGVL 88
           + +PL  RVL+K +E E  T  G++L  +   +KPS G + ++       E     L+V  G+TV + +Y  ++ K  D   Y+V+ + D++ VL
  S:   158 DMKPLNDRVLIKVAEAEDKTAGGLILTETTK-EKPSIGTVVAVGPGPLDDEGKRQPLSVSAGSTVMYSKYAGSEFKGADGTNYIVLRVSDVMAVL 251
>gi|94502300|ref|ZP_01308778.1| 10 kDa chaperonin [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|94451139|gb|EAT14086.1| 10 kDa chaperonin [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] (94 aa)
Score = 119, Expect = 3.5e-05, Identities = 27/88 (30%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           ++ +PL  RV+++ S  ET T +GI++P++   +KP  GI+ ++     N  LTV  G  V + +Y   +++++ ++YL++   DIL ++
  S:     6 LKIKPLSDRVVIEPSPAETKTSSGIIIPDTAK-EKPQEGIVVAVGLGKKNEPLTVKTGNKVLYGKYSGTELRLNGKDYLIMRESDILAII 94
>gi|154339207|ref|XP_001562295.1| 10 kDa heat shock protein, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062878|emb|CAM39325.1| 10 kDa heat shock protein, putative [Leishmania braziliensis] (100 aa)
Score = 119, Expect = 3.5e-05, Identities = 28/87 (32%), Positives = 52/87 (59%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINN--SNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PLG+RVL+KR++    TK G+++P    A K + G + ++++   +    + VG  V   EY  + +KV+ +E+ + E   +LGVL
  S:    11 KLQPLGQRVLVKRTQAAKQTKAGVLIPEQV-AGKINEGTVVAVATGSTDWTPTVKVGDMVLLPEYGGSSVKVEGEEFFLYEESALLGVL 98
>gi|126739872|ref|ZP_01755563.1| chaperonin, 10 kDa [Roseobacter sp. SK209-2-6] >gi|126719104|gb|EBA15815.1| chaperonin, 10 kDa [Roseobacter sp. SK209-2-6] (95 aa)
Score = 119, Expect = 3.5e-05, Identities = 27/88 (30%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL++R+E E  T  G+++P S   +KPS G + +        N       ++ G  + F ++   ++ VD +E L+++  DI+G++
  S:     1 MALKPLHDRVLVRRTESEEKTAGGLIIPESAK-EKPSEGQVVATGEGARKDNGELIAMAVSAGDNILFGKWSGTEVTVDGEELLMMKESDIMGII 94
>gi|150388668|ref|YP_001318717.1| co-chaperonin GroES [Alkaliphilus metalliredigens QYMF] >gi|167008676|sp|A6TLJ0|CH10_ALKMQ 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|149948530|gb|ABR47058.1| chaperonin Cpn10 [Alkaliphilus metalliredigens QYMF] (94 aa)
Score = 119, Expect = 3.5e-05, Identities = 31/88 (35%), Positives = 49/88 (55%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-----LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PLG +V++K+ E E  TK+GIVLP S   Q     ++      +         L VG  V F +Y   ++K+D +EY ++  +DIL V+
  S:     1 MNIKPLGDKVVIKKVEAEDKTKSGIVLPGSAKEQPQMAEVVAVGPGGVVEGKEIIMELKVGDKVIFSKYAGTEVKLDGEEYTILRQNDILAVV 93
>gi|163745714|ref|ZP_02153074.1| chaperonin, 10 kDa [Oceanibulbus indolifex HEL-45] >gi|161382532|gb|EDQ06941.1| chaperonin, 10 kDa [Oceanibulbus indolifex HEL-45] (95 aa)
Score = 119, Expect = 3.6e-05, Identities = 27/88 (30%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  +PL  RVL+KR+E E  T  G+++P+S   +KPS G + ++ +     N       +  G  + F ++   ++ V+ +E L+++  DI+G++
  S:     1 MALKPLHDRVLVKRTESEEKTAGGLIIPDSAK-EKPSEGEVVAVGTGARKDNGELIEMAVAPGDKILFGKWSGTEVTVEGEEMLMMKESDIMGII 94
>gi|123467801|ref|XP_001317292.1| hypothetical protein TVAG_191660 [Trichomonas vaginalis G3] >gi|121900022|gb|EAY05069.1| hypothetical protein TVAG_191660 [Trichomonas vaginalis G3] (109 aa)
Score = 119, Expect = 3.7e-05, Identities = 28/86 (32%), Positives = 48/86 (55%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           F+PL  RVL+KR +    T +GI++P++   +     +I      +     I    L VG  V   ++  +++K+D +E++V   DDIL VL
  S:    17 FKPLDDRVLVKRVDRPNKTASGIIIPDALKGKHNEATVIAVGPGHREKDGTITPMTLQVGDRVVLADWSGSEVKLDGKEFIVYREDDILAVL 108
>gi|86135277|ref|ZP_01053858.1| co-chaperonin GroES [Tenacibaculum sp. MED152] >gi|85819450|gb|EAQ40607.1| co-chaperonin GroES [Polaribacter dokdonensis MED152] (91 aa)
Score = 119, Expect = 3.7e-05, Identities = 27/88 (30%), Positives = 54/88 (61%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSNLTV--GATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +  +PL  RVL++ +  ET T +G+++P+ N  +KP  G + ++ +   +  LTV  G TV + +Y    +K++ ++YL++   DIL ++
  S:     3 LNIKPLADRVLVEPAPAETKTASGLIIPD-NAKEKPQKGTVVAVGNGKVDEPLTVKVGDTVLYGKYGGTDLKLEGKDYLMMRESDILAII 91
>gi|154339211|ref|XP_001562297.1| 10 kDa heat shock protein, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062880|emb|CAM39327.1| 10 kDa heat shock protein, putative [Leishmania braziliensis] (100 aa)
Score = 119, Expect = 3.7e-05, Identities = 28/87 (32%), Positives = 52/87 (59%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINN--SNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PLG+RVL+KR++    TK G+++P    A K + G + ++++   +    + VG  V   EY  + +KV+ +E+ + E   +LGVL
  S:    11 KLQPLGQRVLVKRTQAAKQTKAGVLIPEQV-AGKINEGTVVAVATGSKDWTPTVKVGDMVLLPEYGGSSVKVEGEEFFLYEESALLGVL 98
>gi|118727398|ref|ZP_01576000.1| chaperonin Cpn10 [Clostridium cellulolyticum H10] >gi|118663225|gb|EAV69884.1| chaperonin Cpn10 [Clostridium cellulolyticum H10] (94 aa)
Score = 119, Expect = 3.7e-05, Identities = 33/88 (37%), Positives = 51/88 (57%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS------ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ +PLG RV++K  E E TTK+GIVLP S   +KP    I +      +  +     + VG  V   +Y   ++K D QEY +++  DIL ++
  S:     1 MKIKPLGDRVVIKMLESEETTKSGIVLPGSAK-EKPQVAEIVAVGPGTVVDGKEVKMEVKVGDRVLTSKYSGTEVKFDGQEYTILKQGDILAIV 93
>gi|23813794|sp|Q93GT7|CH10_TETHA 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|16416457|dbj|BAB70660.1| chaperonin 10 [Tetragenococcus halophilus] (94 aa)
Score = 119, Expect = 3.7e-05, Identities = 30/86 (34%), Positives = 52/86 (60%)
  Q:     3 FRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
            +PLG RVL++ SE E  T  GIVL  S   +KP  G + ++       + E+    + VG TV F++Y  +++K D Q+Y++    D++ ++
  S:     2 LKPLGDRVLIEVSEEEEKTVGGIVLA-STAQEKPQTGKVVAVGPGRTLDNGELATVPVNVGDTVLFEKYAGSEVKYDGQDYMIFSAKDLVAIV 93
>gi|117927571|ref|YP_872122.1| chaperonin Cpn10 [Acidothermus cellulolyticus 11B] >gi|117648034|gb|ABK52136.1| chaperonin Cpn10 [Acidothermus cellulolyticus 11B] (102 aa)
Score = 119, Expect = 3.8e-05, Identities = 29/85 (34%), Positives = 52/85 (61%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPL  R+L+K  E ETTT +G+V+P++   +KP  G++ ++             ++  G  V + +Y   ++K +N+EYLV+   D+L V+
  S:    12 RPLEDRILVKPVEAETTTASGLVIPDTAK-EKPQEGVVLAVGPGRYEDGKRIPLDVKEGDRVLYSKYGGTEVKYNNEEYLVLSARDVLAVI 101
>gi|116491380|ref|YP_810924.1| Co-chaperonin GroES (HSP10) [Oenococcus oeni PSU-1] >gi|122276438|sp|Q04E63|CH10_OENOB 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|71466869|emb|CAH41010.1| groES protein [Oenococcus oeni] >gi|73476230|emb|CAI65392.1| GroES protein [Oenococcus oeni] >gi|116092105|gb|ABJ57259.1| Co-chaperonin GroES (HSP10) [Oenococcus oeni PSU-1] (91 aa)
Score = 119, Expect = 3.8e-05, Identities = 32/85 (37%), Positives = 53/85 (62%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS-SEINNS----NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG R++L   + E     GI++ N N  +KP  G + +IS + + +S    ++ VG  V F +Y  +Q+ +D ++YL+V   DILGVL
  S:     3 KPLGDRIVLSIDQPEEEKVGGILIAN-NAKEKPVMGSVVAISETSVGDSKAPKSVKVGDKVMFDKYAGSQVTIDGEDYLIVHEKDILGVL 91
>gi|90020530|ref|YP_526357.1| Bvg accessory factor [Saccharophagus degradans 2-40] >gi|89950130|gb|ABD80145.1| chaperonin Cpn10 [Saccharophagus degradans 2-40] (96 aa)
Score = 119, Expect = 4.0e-05, Identities = 33/88 (37%), Positives = 56/88 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYK-ANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RV+++R E E TT +GIVLP S   +KP+ G + +I       S ++   ++ VG  V F +Y  ++ I+VD +E +++   DI  ++
  S:     1 MKIRPLHDRVVVRRKEEEATTASGIVLPGSAK-EKPNQGEVIAIGSGRVLDSGDVRPLDVKVGDVVVFGKYAGSDTIEVDGEELVILSESDIKAIV 95
>gi|49474598|ref|YP_032640.1| co-chaperonin GroES [Bartonella quintana str. Toulouse] >gi|81695996|sp|Q6FYU9|CH10_BARQU 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|49240102|emb|CAF26543.1| Chaperonin protein groES [Bartonella quintana str. Toulouse] (98 aa)
Score = 119, Expect = 4.0e-05, Identities = 26/88 (29%), Positives = 55/88 (62%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           ++FRPL  RV+++R E E  T  GI++P++   +KP  G I ++ +   + N       +  G  + F ++   ++K++ ++ L+++  DI+G+L
  S:     4 IQFRPLHDRVVVRRVESENKTAGGIIIPDTAK-EKPQEGEIIAVGNGALDDNGKRVPLEVKTGDRILFGKWSGTEVKINGEDLLIMKESDIMGIL 97
>gi|194466087|gb|ACF74274.1| GroES-like protein [Arachis hypogaea] (202 aa)
Score = 119, Expect = 4.0e-05, Identities = 31/85 (36%), Positives = 50/85 (58%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           RPLG RVL+K  E E  T  GI+LP S    KP  G +      KS+       ++  GA V + +Y   +++ +  ++L+++ DDI+G+L
  S:    62 RPLGDRVLVKIKEAEEKTDGGILLP-STAQTKPQGGEVVAVGEGKSVGKSKIEISVQTGAQVVYSKYAGTEVEFNGAKHLILKDDDIVGIL 151
>gi|167358215|ref|ZP_02292873.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074887|gb|EDR78705.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325] (105 aa)
Score = 119, Expect = 4.0e-05, Identities = 24/90 (26%), Positives = 57/90 (63%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNS-------NLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVLYK 90
           M+FR L  RV+++R+E +  +K GI++P++   +KP +G + ++   + +        ++ VG  + F ++   ++ +D +  L+++  DI+G++ K
  S:     1 MKFRSLHDRVVIRRAEGDVKSKGGIIIPDTAK-EKPQHGEVVAVGPGLRDKSGNLVPLDVEVGDLILFGKWSGTEVTIDGETLLIMKETDIMGIVEK 96
>gi|146296313|ref|YP_001180084.1| chaperonin Cpn10 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166233986|sp|A4XJ08|CH10_CALS8 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|145409889|gb|ABP66893.1| chaperonin Cpn10 [Caldicellulosiruptor saccharolyticus DSM 8903] (95 aa)
Score = 119, Expect = 4.0e-05, Identities = 29/88 (32%), Positives = 50/88 (56%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKS-----ISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+ RP+G R+L+K  E E  TK+GIVLP++   +     +I+      +  E     +  G  V   +Y   +IK+D +EY ++  DD+L ++
  S:     1 MKIRPIGDRILIKFKEREEVTKSGIVLPDTVKEKPQIAEVIEVGPGGIVDGEKVEMVVKKGDKVIVSKYAGTEIKIDGEEYTIIRQDDVLAII 93
>gi|85711846|ref|ZP_01042901.1| co-chaperonin GroES [Idiomarina baltica OS145] >gi|85694243|gb|EAQ32186.1| co-chaperonin GroES [Idiomarina baltica OS145] (96 aa)
Score = 119, Expect = 4.1e-05, Identities = 35/87 (40%), Positives = 52/87 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGV 87
           M+ RPL  RV++KR EVE  +  GIVL  S  A+K + G + ++       S E+   ++ VG  V F E Y     K+D +EYL++   DIL +
  S:     1 MKLRPLHDRVIIKRIEVEAKSAGGIVLTGSA-AEKSTRGEVVAVGNGRILESGEVRPLDVKVGDKVLFNEGYGVKTEKIDGEEYLIMSESDILAI 94
>gi|188996528|ref|YP_001930779.1| chaperonin Cpn10 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931595|gb|ACD66225.1| chaperonin Cpn10 [Sulfurihydrogenibium sp. YO3AOP1] (98 aa)
Score = 119, Expect = 4.1e-05, Identities = 32/87 (36%), Positives = 55/87 (63%)
  Q:     2 EFRPLGKRVLLKRSEVETT-TKTGIVLPNSNDAQKPSYGIIKSISSE--INNSNLT-----VGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PL  RV++KR E E   T  GI++P++   +KP  G + ++     + N N+      VG  VYF +Y  N++KVD +E +++  DDIL ++
  S:     3 KLKPLYDRVVIKRVEEEVAKTPAGIIIPDTAK-EKPQIGEVVAVGEGRVLENGNVVPLKVKVGDKVYFSKYAGNEVKVDGEELIILREDDILAII 96
>gi|56461381|ref|YP_156662.1| co-chaperonin GroES [Idiomarina loihiensis L2TR] >gi|81362528|sp|Q5QVT3|CH10_IDILO 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|56180391|gb|AAV83113.1| Co-chaperonin GroES (HSP10) [Idiomarina loihiensis L2TR] (96 aa)
Score = 119, Expect = 4.1e-05, Identities = 35/87 (40%), Positives = 52/87 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGV 87
           M+ RPL  RV++KR+EVE  +  GIVL  S  A+K + G I ++       + E+   ++  G  V F E Y     K+D +EYL++   DIL V
  S:     1 MKLRPLHDRVIIKRTEVEAKSAGGIVLTGSA-AEKSTRGEIVAVGKGRILDNGEVRALDVKAGDKVLFNEGYGVKTEKIDGEEYLIMSESDILAV 94
>gi|157871033|ref|XP_001684066.1| 10 kDa heat shock protein, putative [Leishmania major] >gi|68127134|emb|CAJ04815.1| 10 kDa heat shock protein, putative [Leishmania major] (100 aa)
Score = 119, Expect = 4.2e-05, Identities = 31/87 (35%), Positives = 51/87 (58%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSIS--SEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PLG+RVL+KR +    TK GI++P    A K + G + +++  S+     + VG TV   EY  + +KVD +E  + +   +LGVL
  S:    11 KLQPLGQRVLVKRMQAAKQTKAGILIPEQV-AAKVNEGTVVAVAAGSKDWTPTVKVGDTVLLPEYGGSSVKVDGEELFLYDESVLLGVL 98
>gi|115479353|ref|NP_001063270.1| Os09g0438700 [Oryza sativa (japonica cultivar-group)] >gi|51091339|dbj|BAD36074.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group] >gi|113631503|dbj|BAF25184.1| Os09g0438700 [Oryza sativa (japonica cultivar-group)] >gi|125605832|gb|EAZ44868.1| hypothetical protein OsJ_028351 [Oryza sativa (japonica cultivar-group)] (245 aa)
Score = 119, Expect = 4.2e-05, Identities = 30/85 (35%), Positives = 53/85 (62%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RVL+K    +  T  GI+LP S  + KP  G +      +S+ S+    ++ VGA V + +Y   +++ D  ++L+++ DDI+G+L
  S:    56 KPLGDRVLVKIKTSDDKTVGGILLPTSVQS-KPQGGQVVAVGEGRSMGSDSIEISVPVGAQVVYSKYAGTELEFDGSDHLILKEDDIIGIL 145
Score = 111, Expect = 3.0e-04, Identities = 27/87 (31%), Positives = 51/87 (58%)
  Q:     2 EFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           + +PL  RVL+K +E E  T  G++L  +   +KPS G + ++              ++T G TV + +Y  ++ K ++ EY+V+ + D++ VL
  S:   152 DLKPLNDRVLIKVAEAEEKTAGGLLLTQATK-EKPSIGTVTAVGPGPLVEDGSRKPLSITPGNTVMYSKYAGSEFKGEDGEYIVLRVSDVMAVL 244
>gi|124022213|ref|YP_001016520.1| hypothetical protein P9303_05031 [Prochlorococcus marinus str. MIT 9303] >gi|123962499|gb|ABM77255.1| Hypothetical protein P9303_05031 [Prochlorococcus marinus str. MIT 9303] (166 aa)
Score = 119, Expect = 4.3e-05, Identities = 30/85 (35%), Positives = 47/85 (55%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISSEINNSN-------LTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RV +K SE E  T  GI+LP++   +KP  G +  +     N +       + VG  V + +Y    IK+   EY+++   DIL V+
  S:    75 KPLGDRVFVKVSESEEKTAGGILLPDTAK-EKPQVGEVVQVGPGKRNDDGSRQAPEVGVGDKVLYSKYAGTDIKLSTDEYVLLSEKDILAVV 165
>gi|119468165|ref|ZP_01611291.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Alteromonadales bacterium TW-7] >gi|13366172|dbj|BAB39464.1| GroES [Pseudoalteromonas sp. PS1M3] >gi|119448158|gb|EAW29422.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Alteromonadales bacterium TW-7] (95 aa)
Score = 119, Expect = 4.4e-05, Identities = 33/88 (37%), Positives = 52/88 (59%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSISS-------EINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M  RPL  RV++KR E ET +  GIVL  S  A+K + G + ++ +       ++    +  G TV F  Y     K++ QEYL++  D+ILG++
  S:     1 MNIRPLQDRVIVKRLEEETKSAGGIVLTGSA-AEKSTRGEVVAVGNGRILDNGDVRALEVKAGDTVLFGSYVEKTEKIEGQEYLIMREDNILGIV 94
>gi|21672312|ref|NP_660379.1| co-chaperonin GroES [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|2493653|sp|Q59176|CH10_BUCAP 10 kDa chaperonin (Protein Cpn10) (groES protein) >gi|1369899|dbj|BAA12846.1| 10 kd chaperonin [Buchnera aphidicola] >gi|2827008|gb|AAC38100.1| chaperone Hsp10 [Buchnera aphidicola] >gi|21622911|gb|AAM67590.1| 10 kd chaperonin (GroES) [Buchnera aphidicola str. Sg (Schizaphis graminum)] (96 aa)
Score = 118, Expect = 4.5e-05, Identities = 36/88 (40%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGIIKSI-------SSEINNSNLTVGATVYFKE-YKANQIKVDNQEYLVVELDDILGVL 88
           M+ RPL  RVL+KR+E E  +  GIVL  S  A K + G I ++       + +I   ++ VG  V F E Y A   K+DN+E L++   DIL ++
  S:     1 MKIRPLHDRVLVKRNEAELKSAGGIVLTGSA-AAKSTRGTITAVGNGRVLDNGQIKPLDVKVGDVVIFNEGYGAKTEKIDNEELLILNESDILAIV 95
>gi|153815659|ref|ZP_01968327.1| hypothetical protein RUMTOR_01895 [Ruminococcus torques ATCC 27756] >gi|145847090|gb|EDK24008.1| hypothetical protein RUMTOR_01895 [Ruminococcus torques ATCC 27756] (95 aa)
Score = 118, Expect = 4.5e-05, Identities = 30/88 (34%), Positives = 53/88 (60%)
  Q:     1 MEFRPLGKRVLLKRSEVETTTKTGIVLPNS-----NDAQKPSYGIIKSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           M+  PLG +++LK+ E E TTK+GIVLP        +A+  + G   +I  +     + VG  V + +Y    +++D +EY++V+  DIL ++
  S:     1 MKLVPLGDKIVLKQLEAEETTKSGIVLPGQAKEKPQEAEVIAVGPGGNIDGKEVVMQVNVGDKVIYSKYAGTDVELDKEEYIIVKQSDILAIV 93
>gi|118489858|gb|ABK96728.1| unknown [Populus trichocarpa x Populus deltoides] (256 aa)
Score = 118, Expect = 4.5e-05, Identities = 30/85 (35%), Positives = 51/85 (60%)
  Q:     4 RPLGKRVLLKRSEVETTTKTGIVLPNSNDAQKPSYGII------KSISSEINNSNLTVGATVYFKEYKANQIKVDNQEYLVVELDDILGVL 88
           +PLG RVL+K   VE  ++ GI+LP+S    KP  G +      KS      + ++  GA V + +Y   +++ D   +L+++ DDI+G+L
  S:    66 KPLGDRVLVKIKTVEEKSEGGILLPSSAQT-KPQAGEVVAVGEGKSTGKTKLDISVKTGARVVYSKYAGTEVEFDGSSHLILKEDDIIGIL 155