>gi|26554431|ref|NP_758365.1| hypothetical protein MYPE9830 [Mycoplasma penetrans HF-2] >gi|26454441|dbj|BAC44769.1| hypothetical protein [Mycoplasma penetrans HF-2] (510 aa)
Score = 2387, Expect = 0.0e+00, Identities = 510/510 (100%), Positives = 510/510 (100%)
  Q:     1 MKEKFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFDVLEYQGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELKLNILDYIKIAKLSKSERISDDFISDESSDEIQKSVQNVLDSVLLTKQNDDKDFQKDNKEIEEFEKMQEDYNNSAEETFSKPRFYNIPINGLKESQISVIWKNSPDRDLFTYDSKKEEIYINLNHPFFKPFSTSQDFKVLLDGFVISYIYAEKFSIYPEKEYLINKYDFLQNLNSFLYKFGRGKK 510
           MKEKFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFDVLEYQGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELKLNILDYIKIAKLSKSERISDDFISDESSDEIQKSVQNVLDSVLLTKQNDDKDFQKDNKEIEEFEKMQEDYNNSAEETFSKPRFYNIPINGLKESQISVIWKNSPDRDLFTYDSKKEEIYINLNHPFFKPFSTSQDFKVLLDGFVISYIYAEKFSIYPEKEYLINKYDFLQNLNSFLYKFGRGKK
  S:     1 MKEKFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFDVLEYQGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELKLNILDYIKIAKLSKSERISDDFISDESSDEIQKSVQNVLDSVLLTKQNDDKDFQKDNKEIEEFEKMQEDYNNSAEETFSKPRFYNIPINGLKESQISVIWKNSPDRDLFTYDSKKEEIYINLNHPFFKPFSTSQDFKVLLDGFVISYIYAEKFSIYPEKEYLINKYDFLQNLNSFLYKFGRGKK 510
>gi|167920592|ref|ZP_02507683.1| hypothetical protein BpseBC_18739 [Burkholderia pseudomallei BCC215] (510 aa)
Score = 500, Expect = 2.2e-48, Identities = 116/314 (36%), Positives = 184/314 (58%)
  Q:    13 ILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAIL-LDQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGT-TKGKVKEILSSMYRRDIKNGKINIYY--DGEKLEFHDFDVLEYQGK--------EWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELK 326
           +LSV SRLNYK W+A+AEFVDNS  S++ N + +     +   L V +  +     + I D+A G+   DF +A    +  P + G +EFGMG+KTAA WF NTW+V +  LG   E     +I  +   +L+++ ++  + + + H T + + +L KK   T T+ K+++ L+S+YR  I+ G++ +Y+  D  +L + + + L             +W+KEINF  +  G +  V GF  +  +  T      +AGFALFR  R+I+G  D  Y+P E+F  + S    +LFGEL++E F V+  KDGF WD+  EEEFL+ L+
  S:     1 MLSVLSRLNYKAWFAVAEFVDNSVQSYFANRRQLQRLHGDSFVLKVVIRLDAASRLIEITDNAAGIQGRDFPRAFRPAEVPPDRSGLSEFGMGMKTAACWFTNTWSVRTKALGEPVERTVRFDIHDILEANLDDLNVQETRANPSSHYTVVRLENLGKKFPQTKTQKKLRDHLASIYRVYIRTGEVELYFGDDNSRLTYEEPESLVAPPHNAPNSLPVQWRKEINF--DLPGGR-RVWGFAALRREAST-----SHAGFALFRRNRLIVGSDDETYRPHEVFGNTNSYRYQRLFGELHVEGFEVSHTKDGFSWDE-YEEEFLESLR 317
>gi|167837975|ref|ZP_02464834.1| hypothetical protein Bpse38_15787 [Burkholderia thailandensis MSMB43] (510 aa)
Score = 498, Expect = 3.7e-48, Identities = 116/314 (36%), Positives = 184/314 (58%)
  Q:    13 ILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAIL-LDQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGT-TKGKVKEILSSMYRRDIKNGKINIYY--DGEKLEFHDFDVLEYQGK--------EWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELK 326
           +LSV SRLNYK W+A+AEFVDNS  S++ N + +     +   L V +  +     + I D+A G+   DF +A    +  P + G +EFGMG+KTAA WF NTW+V +  LG   E     +I  +   +L+++ ++  + + + H T + + +L KK   T T+ K+++ L+S+YR  I+ G++ +Y+  D  +L + + + L             +W+KEINF  +  G +  V GF  +  +  T      +AGFALFR  R+I+G  D  Y+P E+F  + S    +LFGEL++E F V+  KDGF WD+  EEEFL+ L+
  S:     1 MLSVLSRLNYKAWFAVAEFVDNSIQSYFANRRQLQRLHGDSFVLKVVIRLDAASRLIEITDNAAGIQGRDFPRAFRPAEVPPDRSGLSEFGMGMKTAACWFTNTWSVRTKALGEPVERTVRFDIHDILEANLDDLNVQETRANPSSHYTVVRLENLGKKFPQTKTQKKLRDHLASIYRVYIRTGEVELYFGDDNSRLMYEEPESLVAPPHNAPNSLPVQWRKEINF--DLPGGR-RVWGFAALRREAST-----SHAGFALFRRNRLIVGSDDETYRPHEVFGNTNSYRYQRLFGELHVEGFEVSHTKDGFSWDE-YEEEFLESLR 317
>gi|116748760|ref|YP_845447.1| hypothetical protein Sfum_1321 [Syntrophobacter fumaroxidans MPOB] >gi|116697824|gb|ABK17012.1| hypothetical protein Sfum_1321 [Syntrophobacter fumaroxidans MPOB] (528 aa)
Score = 476, Expect = 1.3e-45, Identities = 156/475 (32%), Positives = 242/475 (50%)
  Q:     7 IQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENY---KTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQI-GRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKM---KTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFDVLEY--------QGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELK-------LNILDYIKIAKLSKSERISDDFISDESSDEIQKSVQNVLDSVLLTKQNDDKDFQKDNKEIEEFEKMQEDYNNSAEETFSKPRFYNIPINGLKESQIS-----VIWKNSPDRDLFTYDSKKEEIYINLNHPFFKPF-STSQD----FKVLLDGFVISYIYAEKFSI 481
           I+PE  + + F+RLNYK WYA+AEFVDNS  S   N    + +S  PY + ++ + +  + IE    ++D+A G+   ++ +A L    P    G +EFG+GLK AASWF   W+V ++ LG   E     +I K+    ++HL  +E   + V  N H TT+++ DL  ++ G T GK+K+ L S+YR  +++G + +  +GE L +     L+         +   W+KEI  +    G+ + V G+  IL+     + S  NAGFA+FR  R+I G     Y+P+ IF +    I  +L GE  +E F V+  KDG  W+D  EE+ L  LK       L +LD  + A       I  D + + + D  Q   Q+ L  ++  + N   +     + ++E E   E   +   E        +  IN    S IS      I +N  D      DS +  I +NL HPF   F S   D    F  L  G  I+ I A +  +
  S:     4 IRPEVRMYAAFARLNYKPWYALAEFVDNSLQSALSNMDRLRVVSQGPYRL-QVDIDIGTDSIE----VRDNAAGIHEHEYARAFLPASPPADTSGLSEFGLGLKAAASWFARQWSVRTSSLGEPIERTITFDIPKIVETNSEHLEPVE---RTVCANDHFTTVSLRDLQVRLRGRTIGKIKDHLQSIYRVFLRDGLLELRLNGETLAYDPPTFLQAPFYATPTNEPVTWRKEIELDL---GDGHRVRGWAAILA-----RASVANAGFAMFRRRRLIQGSHGDGYRPEVIFGKPNKFIYQRLIGEFEIEGFSVSHTKDGIQWED-WEEDILNWLKEKLDDEPLPLLD--QAANYRARASIIQDMVQEATWDTRQAIAQH-LPPIIDEQINAAPNEAPLPRALDELE--SELARSEQVELHLDHAHRHWVINVELMSDISREAWFEIAENVTDS-----DSTRIHIRVNLAHPFMVRFISPDADELVPFTRLAAGLAIAEITAREVGV 483
>gi|86142909|ref|ZP_01061331.1| hypothetical protein MED217_09702 [Flavobacterium sp. MED217] >gi|85830354|gb|EAQ48813.1| hypothetical protein MED217_09702 [Leeuwenhoekiella blandensis MED217] (508 aa)
Score = 471, Expect = 5.5e-45, Identities = 146/451 (32%), Positives = 250/451 (55%)
  Q:     3 EKFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTM----SSEPYNITKLSVHVTY---NDI-ENTLTIQDDAFGMDLADFKKAILLDQKPQ-QIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFD----VLEYQGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQI----SIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELKLNILDYIKIAKLSKSERISDDFISDESSDEIQKSVQNVLDSVLLTKQNDDKDFQKDNKEIEEFEKMQEDYNNSAEETFSKPRFYNIPINGLKESQISVIWKNSPDRDLFTYDSKKEE----IYINLNHPFF 453
           EK NI     I++ + RL Y++W+A+AE+VDNST ++  N + +    + E  N   LSV++ Y   N+I E+   I D++ GM L++ KKA  +   P    GR+ +G+G+KTA+ W G+ WT+ +T+LG  +EY   ++I  +    L  ++I++K + KNKH T I + +L ++  G T GK+K  LSS+YR D+ +  ++++++ +KL+++ +     V   +G  ++++  F FE  G K  VTG+ G+LS      GS    GFAL +  R+I   P+  YKP+ I+ + +  I    + +L GEL +E F V+  KD  +W+    ++    L   I D+ KIA   +   + +   SDE  D    ++    +S  L      K    DN  IE  +++++    S E T        I ++GL   ++ +  K SP+      DS  ++    + +N NHPF+
  S:     2 EKININFTPDIINSYKRLAYRIWFALAEYVDNSTQAYLNNQEILDIVYAEEQRN---LSVYINYFKGNEINEDYFEIIDNSMGMSLSELKKAFQIGLPPDDNSGRSRYGLGMKTASFWLGDEWTIITTKLGDSKEYSVTLDIEAISKGDL-ALDIQSKDIEKNKHYTIIKVKNLRRRFKGMTIGKIKSYLSSIYRFDVSSNMLDLFWNDQKLDWNGYSDEDFVKNSEGVPYRRD--FEFEIDGKK--VTGWAGVLS-----SGSRSKGGFALVQGNRVIQSPPN-GYKPETIYGEQEGGINNLVNQRLVGELFLEGFEVSHTKDNILWEGTQMDDLDDALLEQIGDFRKIANEYRKNAVDERAPSDEDFDFALDTLLTEFNSGELNDIVLTKSVPPDNLIIESNKQIEKAIVESTEPTL-------IKLDGLT-IKLYIDDKMSPNDPYVINDSISDKNTIIVIVNKNHPFW 451
>gi|126646659|ref|ZP_01719169.1| hypothetical protein ALPR1_18003 [Algoriphagus sp. PR1] >gi|126576707|gb|EAZ80955.1| hypothetical protein ALPR1_18003 [Algoriphagus sp. PR1] (513 aa)
Score = 438, Expect = 3.5e-41, Identities = 124/355 (34%), Positives = 210/355 (59%)
  Q:     3 EKFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTY------NDIENTLTIQDDAFGMDLADFKKAILLDQKPQ-QIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKINIYYDGEKLEFHDFDVL---EYQGKEWKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQS----QSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKELKLNILDYIKIAKLSKSERISDDFISDESSDEI 357
           E FN+   A I   + RL+YK+WYA+AE++DNST +++EN K +  E   I   ++HV        N  ++   I+D++ GMD A  K+A    QKP+   GR+++G+GLKT++ W G+ W+V+++RLGS +E+   V+I K++  +++ +E+    V ++ H T I ++ L ++  G T  KV   LSS+YR D+ + K+ I +  + L + + D L    ++G+  KKE    FEF  +   V G+ G+L+     +G    AGFAL +  R+I    + NY+P EIF +        ++ +L GE+ ++ F V+  KD  +W    EE+   +LK  + + ++IA L++  R S D ISD  + E+
  S:     2 ENFNLTFTANIAESYKRLSYKLWYALAEYIDNSTQAYHEN-KDVLDEQLKIDGETLHVLIEYYRGENLSDDYFEIKDNSIGMDEAVLKRAFNTGQKPEINTGRSKYGLGLKTSSFWLGDKWSVTTSRLGSKKEFSILVDIEKIEEGNIS-LELNETDVPEDSHYTIIRVWGLHRRFVGRTLSKVSSYLSSIYRYDLISEKLEIKWMDKYLSWKNLDELLVENFEGERTKKE----FEFVVDDKPVKGWAGVLN-----RGDRGQAGFALVQSERVI----NTNYRPSEIFGEQDGGRNDLVNQRLIGEIFIDGFDVSHTKDQILWSGEQEEQLENKLKEEVKELVRIA-LTRRVRESVD-ISDVKTIEV 353
>gi|115376462|ref|ZP_01463697.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] >gi|115366530|gb|EAU65530.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] (880 aa)
Score = 438, Expect = 3.7e-41, Identities = 117/364 (32%), Positives = 193/364 (53%)
  Q:     4 KFNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQ-IGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDLTKKISGTTKGKVKEILSSMYRRDIKNGKIN-----------IYYDGEKLEFHDFDVLEYQGKE-----WKKEINFNFEFSGNKYNVTGFVGILSDKKTGKGSYKNAGFALFRYGRIILGGPDLNYKPKEIFQQSQSQISIKLFGELNMEDFPVNQAKDGFIWDDGLEEEFLKEL--KLNILDY--IKIAKLSKSERISDDFISDESSDEIQKSVQNVLDS 367
           + NI+P+ G+ + F+RLNYK W+A+AEF+DNS  SF  N + ++   +    L + V  +D  N + I D A G+   DF +A      P    G +EFG+G+K AA WF   WTV ++ LG   +     NI  +       + IET    ++ H T +T+ DL  +  G T  K+K+ L S+YR  +  G +            + YD  KL     D   Y+ +      W++  + +F   G++  VTG+ GIL      KGS+ +AGF++FR  R+I G     YKP  +F    S  S ++ GE+ +E F V+  KDG  W  G E+E L ++  ++N  D+  +  A   ++ + ++    D  ++ +  + + + D+
  S:   371 QLNIRPQVGMYAAFARLNYKPWFALAEFIDNSIQSFLSNQQRLADAGH-AGPLVIDVNIDD--NEIAITDRAGGIAWVDFPRAFSPATPPTDATGLSEFGLGMKAAACWFAKKWTVRTSALGEPVQRTVIFNIPAIMRSGAEVLPIETTTARESDHFTVVTLTDLRVRPKGRTLAKIKDHLQSIYRVLMNEGIVKLRVTTAGSVEELSYDSPKL----LDAPYYKTRNASSRLWRQTFDVDF---GDR-RVTGWAGILE-----KGSHVHAGFSVFRRRRLIEGSVGEAYKPSALFGTPNSFASQRVIGEMFVEGFDVSHTKDGIQW-GGYEDELLDKIWRQINSPDFPLLDQANGYRARKTANQLPKDFGANALADASEAIADA 738
>gi|85703008|ref|ZP_01034112.1| hypothetical protein ROS217_19742 [Roseovarius sp. 217] >gi|85671936|gb|EAQ26793.1| hypothetical protein ROS217_19742 [Roseovarius sp. 217] (797 aa)
Score = 154, Expect = 2.9e-08, Identities = 49/163 (30%), Positives = 76/163 (46%)
  Q:     5 FNIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDI-ENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRNE------FGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQ-HLNEIEIETKKVHKNKHGTTITIYDL 167
           FN++P+  +L +   +N   W  +AE VDN+   F +  +  SS      K+ VH+   D    TL I D+  GM     ++A+    +    G N       FGMG   A +  G+   V +TR G  E +   ++  K++ Q H     +   K    +HGT ITI  L
  S:    15 FNLEPDPRVLPMLGEINIDQWRCVAELVDNAVDGFLKESRAGSS--IAGAKVDVHLPQADAPAATLRIIDNGPGMTPDMLERAV----RAGWSGNNPIDSLGLFGMGFNIATARLGSVTEVWTTRKGEREWHGLLIDFDKLRLQRHFRTPRLSRAKADPEQHGTEITIKQL 179
>gi|145218896|ref|YP_001129605.1| hypothetical protein Cvib_0076 [Prosthecochloris vibrioformis DSM 265] >gi|145205060|gb|ABP36103.1| hypothetical protein Cvib_0076 [Prosthecochloris vibrioformis DSM 265] (772 aa)
Score = 142, Expect = 8.2e-07, Identities = 56/200 (28%), Positives = 99/200 (49%)
  Q:     6 NIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYK--TMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRNEF-GMGLKTAASWFGNTWTVSSTRLGSDEEYFTE-----------VNISKMKTQHLNEIEIETKK-----VHKNKHGTTITIYDL-TKKISGTTKG----KVKEILSSMYRRDIKNGKINIYYDGEKL 205
           +I P   +L +  +++++ W  +AE VDNS  +F E       +  P    +L         E  +TI+D+A GM   D K A+    +    G +    MGL      FG  + +S+ R+G   E +T            ++   ++ Q   +  +ET+K     + +  HGT I I  L   ++   T+G    K ++ L  +Y R +    I+I YDG+++
  S:     5 DITPSPRVLRMLGQIDFQPWQCLAELVDNSIDAFIEQVSEGIPAINPRIDVQLPTESQLQSGEGVITIKDNASGMMPDDLKNAV----RAGYSGNDPVEKMGL------FGMGFNISTARMGRRTEVWTTMAEDPVWTGIIIDFDCLERQKTFQAPMETRKKSASEIAEGLHGTEIRITHLEADRVRPLTRGIGKRKTRDKLGKIYGRVMDRLGIDINYDGDRI 218
>gi|85706635|ref|ZP_01037727.1| hypothetical protein ROS217_07789 [Roseovarius sp. 217] >gi|85668693|gb|EAQ23562.1| hypothetical protein ROS217_07789 [Roseovarius sp. 217] (500 aa)
Score = 101, Expect = 4.2e-02, Identities = 36/119 (30%), Positives = 56/119 (47%)
  Q:     6 NIQPEAG-ILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGR-----NEFGMGLKTAASWFGNTWTVSSTRLG 124
           N  P AG +L     L Y +  A+A+ VDNS  +             N T +++H+ +   E+ + I DD  GMD    +  + L  +  +  R       FG+GLKTA+       TV+S + G
  S:     5 NAPPYAGSMLESLRGLGYALPTALADLVDNSITA-------------NSTAIAIHLEWAGPESWVKIVDDGEGMDDEALEAGMRLGARDPRAERAANDLGRFGLGLKTASFSQARRLTVASRKEG 116
>gi|119716508|ref|YP_923473.1| hypothetical protein Noca_2281 [Nocardioides sp. JS614] >gi|119537169|gb|ABL81786.1| hypothetical protein Noca_2281 [Nocardioides sp. JS614] (780 aa)
Score = 100, Expect = 5.3e-02, Identities = 39/162 (24%), Positives = 71/162 (43%)
  Q:     6 NIQPEAGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEP--YNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILL----DQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLGSDEEYFTEVNISKMKTQHLNEIEIETKKVHKNKHGTTITIYDL 167
           +I P   IL +   + +  W  IAE VDN+   F +  +   S P  Y ++        +     + ++D   GM     ++A+      + +  ++G   FGMG   + +  G    V +TR G  E    E+++ K+        +I   K   ++HGT I + +L
  S:     2 DITPSPRILRMLGEIEFDEWQCIAELVDNAFDDFTDIIEGGHSWPGGYKVSVTLPGPGASLAGAEVVVKDTGRGMTRTTLEQAVKAGWSSNDRFDKLGL--FGMGFNVSTARLGRRTRVLTTREGDPEWIGVEIDLDKLGPD-FEAPDITEPKDDPSEHGTKIIVSNL 166
>gi|193222341|emb|CAL62000.2| Conserved hypothetical protein [Herminiimonas arsenicoxydans] (499 aa)
Score = 96, Expect = 1.5e-01, Identities = 32/109 (29%), Positives = 54/109 (49%)
  Q:     1 MKEKFNIQPEA-GILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILLDQKPQQIGRN-----EFGMGLKTAA 109
           MK + N  P A  ++     L Y +  A+A+ +DNS A+               +++ V   +N  ++ + + D+  GMD A+   A+ L +K     RN      FG+GLKTA+
  S:     1 MKSR-NAPPRADAMIEALRGLGYSLPSALADIIDNSIAA-------------EASEIDVTFVWNGAKSFIRVHDNGTGMDEAEIDLAMRLGEKNPLHSRNASDLGRFGLGLKTAS 101
>gi|167045162|gb|ABZ09824.1| putative histidine kinase-, DNA gyrase B-, and HSP90-like ATPase [uncultured marine microorganism HF4000_APKG8K5] (487 aa)
Score = 92, Expect = 5.0e-01, Identities = 34/104 (32%), Positives = 54/104 (51%)
  Q:    21 NYKVWYAIAEFVDNS---TASFYENYKTMSSEPYNITKLSVHVTYNDIENTLTIQDDAFGMDLADFKKAILL-------DQKPQQIGRNEFGMGLKTAASWFGNTWTVSSTRLG 124
           NY +  A+A+ VDNS   TAS  E                +   +ND +  ++++DD +GM  A+   A+ L       ++  + +GR  FG+GLKTA+       +V S R G
  S:    23 NYDLGSALADLVDNSIKATASIVE----------------ITCFWNDGQPVISVKDDGYGMSKAELHSAMRLASIDPRDERAAEDLGR--FGLGLKTASFSQCRRLSVFSKRKG 118
>gi|147919343|ref|YP_686921.1| hypothetical protein RCIX2531 [uncultured methanogenic archaeon RC-I] >gi|110622317|emb|CAJ37595.1| conserved hypothetical protein [uncultured methanogenic archaeon RC-I] (519 aa)
Score = 90, Expect = 8.4e-01, Identities = 35/118 (29%), Positives = 62/118 (52%)
  Q:     3 EKFNIQPE--AGILSVFSRLNYKVWYAIAEFVDNSTASFYENYKTMSSEPYNITKLSVHVTYN--DIENTLTIQDDAFGMDLADFKKAILLD-------QKPQQIGRNEFGMGLKTAASWFGNTWTVSS 120
           ++++I P   A  +       Y +  AIA+ +DNS ++   N               V++ +N     +T++I+DD  GM  ++  KA+ L        + P+ +GR  FG+GLKTA+      +TV+S
  S:    22 DEYDIVPPDPASFIESLRAFGYDLQTAIADIIDNSISAGARN---------------VYIVFNWDGANSTISIKDDGCGMTESELIKAMRLGSISPSDCRNPKDLGR--FGLGLKTASFSQCRKFTVAS 133