>gi|26554432|ref|NP_758366.1| hypothetical protein MYPE9840 [Mycoplasma penetrans HF-2] >gi|26454442|dbj|BAC44770.1| hypothetical protein [Mycoplasma penetrans HF-2] (82 aa)
Score = 173, Expect = 2.0e-11, Identities = 44/54 (81%), Positives = 45/54 (83%)
  Q:     1 LEQNMSEKITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKELLL 54
           +EQNMSEKITLALVYKELKEMRTDISE       LKTDVA IKACPTIQKEL L
  S:     1 MEQNMSEKITLALVYKELKEMRTDISE-------LKTDVAVIKACPTIQKELKL 47
>gi|26554433|ref|NP_758367.1| hypothetical protein MYPE9850 [Mycoplasma penetrans HF-2] >gi|26454443|dbj|BAC44771.1| hypothetical protein [Mycoplasma penetrans HF-2] (56 aa)
Score = 172, Expect = 3.1e-11, Identities = 55/56 (98%), Positives = 56/56 (100%)
  Q:     1 LEQNMSEKITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKELLLAK 56
           +EQNMSEKITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKELLLAK
  S:     1 MEQNMSEKITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKELLLAK 56
>gi|26554434|ref|NP_758368.1| hypothetical protein MYPE9860 [Mycoplasma penetrans HF-2] >gi|26454444|dbj|BAC44772.1| hypothetical protein [Mycoplasma penetrans HF-2] (113 aa)
Score = 165, Expect = 1.8e-10, Identities = 54/56 (96%), Positives = 55/56 (98%)
  Q:     1 LEQNMSEKITLALVYKELKEMRTDISELKTDVS--------------QLKTDVAAIKACPTIQKELLLAK 56
           LEQNMSEKITLALVYKELKEMRTDISELKTDVS              +LKTDVAAIKACPTIQKELLL K
  S:    44 LEQNMSEKITLALVYKELKEMRTDISELKTDVSHLKTDMVEVKADIAELKTDVAAIKACPTIQKELLLTK 113
>gi|26554281|ref|NP_758215.1| hypothetical protein MYPE8270 [Mycoplasma penetrans HF-2] >gi|26454290|dbj|BAC44619.1| hypothetical protein [Mycoplasma penetrans HF-2] (135 aa)
Score = 149, Expect = 1.2e-08, Identities = 49/56 (87%), Positives = 54/56 (96%)
  Q:     1 LEQNMSEKITLALVYKELKEMRT------------------DISELKTDVSQLKTDVAAIKACPTIQKELLLAK 56
           LEQ+MSEKITLALVYKELKEMRT                  D++ELKTDV+QLK DVAAIKACPTIQKEL LA+
  S:    62 LEQDMSEKITLALVYKELKEMRTEFRTDISELKTDVAQLKVDVAELKTDVAQLKVDVAAIKACPTIQKELKLAQ 135
>gi|26554284|ref|NP_758218.1| hypothetical protein MYPE8300 [Mycoplasma penetrans HF-2] >gi|26454293|dbj|BAC44622.1| hypothetical protein [Mycoplasma penetrans HF-2] (115 aa)
Score = 144, Expect = 4.7e-08, Identities = 50/56 (89%), Positives = 53/56 (94%)
  Q:     1 LEQNMSEKITLALVYKELKEMRT----DISELKTDVSQLKTDV--------------AAIKACPTIQKELLLAK 56
           LEQ+MSEKITLALVYKELKEMRT    DISELK DV+QLK DV              AAIKACPTIQKEL LA+
  S:    42 LEQDMSEKITLALVYKELKEMRTEFRTDISELKADVAQLKVDVTQLKTDMVEVKADIAAIKACPTIQKELKLAQ 115
>gi|26554283|ref|NP_758217.1| hypothetical protein MYPE8290 [Mycoplasma penetrans HF-2] >gi|26454292|dbj|BAC44621.1| hypothetical protein [Mycoplasma penetrans HF-2] (115 aa)
Score = 140, Expect = 1.4e-07, Identities = 48/56 (85%), Positives = 54/56 (96%)
  Q:     1 LEQNMSEKITLALVYKELKEMRT------------------DISELKTDVSQLKTDVAAIKACPTIQKELLLAK 56
           LEQ+MSEKITLALVYKELKEMRT                  D++ELKTDV+QLK DVAAIKACPTIQKEL +A+
  S:    42 LEQDMSEKITLALVYKELKEMRTEFRTDISELKTDVAQLKVDVAELKTDVAQLKVDVAAIKACPTIQKELKIAQ 115
>gi|26554282|ref|NP_758216.1| hypothetical protein MYPE8280 [Mycoplasma penetrans HF-2] >gi|26454291|dbj|BAC44620.1| hypothetical protein [Mycoplasma penetrans HF-2] (129 aa)
Score = 108, Expect = 6.7e-04, Identities = 46/56 (82%), Positives = 54/56 (96%)
  Q:     1 LEQNMSEKITLALVYKELKEMRT-------------------------DISELKTDVSQLKT-------DVAAIKACPTIQKELLLAK 56
           LEQ+MSEKITLALVYKELKEMRT                         D+++LK DV++LKT       DVAAIKACPTIQKEL +A+
  S:    42 LEQDMSEKITLALVYKELKEMRTEFRTDISELKTDVAQLKVDVAELKTDVAQLKVDVTELKTDVAQLKVDVAAIKACPTIQKELKIAQ 129
>gi|26553796|ref|NP_757730.1| hypothetical protein MYPE3410 [Mycoplasma penetrans HF-2] >gi|26453803|dbj|BAC44134.1| hypothetical protein [Mycoplasma penetrans HF-2] (180 aa)
Score = 88, Expect = 1.4e-01, Identities = 24/45 (53%), Positives = 32/45 (71%)
  Q:     8 KITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKEL 52
           K  +A +  ++ E++ DI ELKTDVSQLK DV+ I  CPTI +EL
  S:   132 KTDVAQLKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVREL 176
>gi|26554302|ref|NP_758236.1| hypothetical protein MYPE8480 [Mycoplasma penetrans HF-2] >gi|26454311|dbj|BAC44640.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (181 aa)
Score = 88, Expect = 1.6e-01, Identities = 24/45 (53%), Positives = 32/45 (71%)
  Q:     8 KITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKEL 52
           K  +A +  ++ E++ DI ELKTDVSQLK DV+ I  CPTI +EL
  S:   133 KTDVAQLKTDMVEVKADIVELKTDVSQLKKDVSRIMKCPTIVREL 177
>gi|26554301|ref|NP_758235.1| hypothetical protein MYPE8470 [Mycoplasma penetrans HF-2] >gi|26454310|dbj|BAC44639.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (148 aa)
Score = 86, Expect = 2.8e-01, Identities = 23/45 (51%), Positives = 32/45 (71%)
  Q:     8 KITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKEL 52
           K  +A +  ++ E++ DI ELKTDVSQL+ DV+ I  CPTI +EL
  S:   100 KADVAQLKTDMVEVKADIVELKTDVSQLEKDVSRIMKCPTIIREL 144
>gi|26553797|ref|NP_757731.1| hypothetical protein MYPE3420 [Mycoplasma penetrans HF-2] >gi|26453804|dbj|BAC44135.1| hypothetical protein [Mycoplasma penetrans HF-2] (146 aa)
Score = 83, Expect = 5.9e-01, Identities = 26/52 (50%), Positives = 36/52 (69%)
  Q:     1 LEQNMSEKITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKA--------------CPTIQKEL 52
           + +N      L  + K+LK + +D+SELKTDV+QLKTD+  +KA              CPTI  EL
  S:    77 IRENNPSPDILEEILKQLKTISSDVSELKTDVAQLKTDMVEVKADVTQLKKDVSRIMKCPTIVSEL 142
>gi|26553798|ref|NP_757732.1| hypothetical protein MYPE3430 [Mycoplasma penetrans HF-2] >gi|26453805|dbj|BAC44136.1| hypothetical protein [Mycoplasma penetrans HF-2] (90 aa)
Score = 83, Expect = 6.1e-01, Identities = 23/45 (51%), Positives = 32/45 (71%)
  Q:     8 KITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKEL 52
           K  +A +  ++ E++ DI ELKTDVSQLK DV+ I  CPT+ +EL
  S:    42 KTDVAQLKTDMVEVKADILELKTDVSQLKKDVSRIMKCPTVVREL 86
>gi|26554204|ref|NP_758138.1| hypothetical protein MYPE7480 [Mycoplasma penetrans HF-2] >gi|26454213|dbj|BAC44542.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (169 aa)
Score = 81, Expect = 9.7e-01, Identities = 18/45 (40%), Positives = 31/45 (68%)
  Q:     8 KITLALVYKELKEMRTDISELKTDVSQLKTDVAAIKACPTIQKEL 52
           K  ++++  ++  ++ D+ E+K+D+  LK DV+ IK CPTI KEL
  S:   122 KDDVSILKNDVSVLKDDMVEVKSDIKILKDDVSKIKQCPTIAKEL 166