>gi|26553552|ref|NP_757486.1| chaperonin GroEL [Mycoplasma penetrans HF-2] >gi|29839307|sp|Q8CXQ7|CH60_MYCPE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|26453558|dbj|BAC43890.1| chaperonin GroEL [Mycoplasma penetrans HF-2] (545 aa)
Score = 2384, Expect = 0.0e+00, Identities = 538/538 (100%), Positives = 538/538 (100%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN
  S:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
>gi|15644643|ref|NP_206812.1| chaperonin GroEL [Helicobacter pylori 26695] >gi|2506272|sp|P42383|CH60_HELPY 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat shock protein 60) >gi|2313084|gb|AAD07080.1| chaperone and heat shock protein (groEL) [Helicobacter pylori 26695] (546 aa)
Score = 1762, Expect = 0.0e+00, Identities = 378/538 (70%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIAILTGG  ++++LG+S +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAILTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--AAPAMPD 532
>gi|15611079|ref|NP_222730.1| chaperonin GroEL [Helicobacter pylori J99] >gi|11386721|sp|Q9ZN50|CH60_HELPJ 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat shock protein 60) >gi|4154502|gb|AAD05583.1| 60kDa chaperone [Helicobacter pylori J99] (546 aa)
Score = 1762, Expect = 0.0e+00, Identities = 378/538 (70%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIAILTGG  ++++LG+S +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAILTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSDDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVQKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--AAPAMPD 532
>gi|397869|emb|CAA52062.1| heat shock protein 60 [Helicobacter pylori] (546 aa)
Score = 1761, Expect = 0.0e+00, Identities = 378/538 (70%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIAILTGG  ++++LG+S +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAILTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSDDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--ATPAMPD 532
>gi|108562435|ref|YP_626751.1| chaperonin GroEL [Helicobacter pylori HPAG1] >gi|118597114|sp|Q1CVE5|CH60_HELPH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|19338968|gb|AAL86900.1|AF479030_1 heat shock protein B subunit [Helicobacter pylori] >gi|107836208|gb|ABF84077.1| chaperone and heat shock protein [Helicobacter pylori HPAG1] (546 aa)
Score = 1761, Expect = 0.0e+00, Identities = 378/538 (70%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIAILTGG  ++++LG+S +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAILTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSDDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--AAPAMPD 532
>gi|188592935|emb|CAQ53100.1| chaperone and heat shock protein (groEL) [Helicobacter pylori] (546 aa)
Score = 1760, Expect = 0.0e+00, Identities = 377/538 (70%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIA+LTGG  ++++LG+S +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAVLTGGQVISEELGLSLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSDDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--AAPAMPD 532
>gi|188526820|ref|YP_001909507.1| chaperonin GroEL [Helicobacter pylori Shi470] >gi|110377354|gb|ABG73413.1| heat shock protein 60 [Helicobacter pylori] >gi|188143060|gb|ACD47477.1| chaperonin GroEL [Helicobacter pylori Shi470] (546 aa)
Score = 1759, Expect = 0.0e+00, Identities = 376/538 (69%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIA+LTGG  ++++LG++ +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAVLTGGQVISEELGLTLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVQKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--ATPAMPD 532
>gi|712831|gb|AAC41441.1| heat shock protein (545 aa)
Score = 1743, Expect = 0.0e+00, Identities = 376/538 (69%), Positives = 461/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGPRGRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+ ASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL K+SKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIA+LTGG  ++++LG+S +   ++ LG+A+ +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   LNL  DEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ GKYVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEDASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAPEAIINELKKASKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAVLTGGQVISEELGLSLENAEVEFLGKAK-IVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LNLHDDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVEKHEG-HFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--AAPAMPD 531
>gi|109948171|ref|YP_665399.1| chaperonin GroEL [Helicobacter acinonychis str. Sheeba] >gi|123066081|sp|Q17VC6|CH60_HELAH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|109715392|emb|CAK00400.1| heat-shock chaperonin GroEL [Helicobacter acinonychis str. Sheeba] (546 aa)
Score = 1731, Expect = 0.0e+00, Identities = 375/538 (69%), Positives = 462/538 (85%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFSDSARN LF GV+QL DAVKVTMGP+GRNVLIQKSYGAP ITKDGVSVAKE++L+ P+ NMGAQLVK+VASKTAD AGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AI+NEL KSSKK+  K+EI QVATISANSD  IG+LIA+AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYFVT+  KM A+L+N YIL+TDKK+SS+KDILP+LE+ MK G+PLLIIA+D++GEALTTLVVNK+RGV N+ AVKAP FGD+RK++L+DIA+LTGG  ++++LG++ +   ++ LG+A  +VIDKDN+TIV GKG    +K+R+++IKT I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  +++++   L+L GDEK+GY+I+M AI +P++QI  NAG+D GVV+NE+ K    H GFNA+ G+YVDMF+ GIIDP+KV RIALQNAVSVSS+LLTTEA ++++K++K  + PAMP+
  S:     1 MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPKGRNVLIQKSYGAPSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEGLRNITAGANPIEVKRGMDKAAEAIINELKKSSKKVGGKEEITQVATISANSDHNIGKLIADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAYILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVKAPGFGDRRKEMLKDIAVLTGGQVISEELGLTLENAEVEFLGKAGRIVIDKDNTTIVDGKGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAQKVH---LHLNGDEKVGYEIIMRAIKAPLAQIAINAGYDGGVVVNEVQKHEG-HFGFNASNGEYVDMFKEGIIDPLKVERIALQNAVSVSSLLLTTEATVHEIKEEK--ATPAMPD 532
>gi|34556744|ref|NP_906559.1| chaperonin GroEL [Wolinella succinogenes DSM 1740] >gi|41016833|sp|Q7MAE3|CH60_WOLSU 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|34482458|emb|CAE09459.1| HEAT SHOCK PROTEIN [Wolinella succinogenes] (546 aa)
Score = 1722, Expect = 0.0e+00, Identities = 379/538 (70%), Positives = 454/538 (84%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           +KEI FSDSARNKL+ GV+QL DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKE++L + I NMGAQLVK+VASKTAD AGDGTTTATVLA+G+FKEGLRN+ +GANPIE+KRGMDK   AI++EL K SKK+  K EI QVATISANSD+ IG LIA AMEKVG DGVITVEEAKGINDEL VVEGMQFDRGY+SPYFVT+++KM A LENPYIL+TDKK++S+KDILP+LE  MK+GRPLLI+A+D++GEALTTLVVNK+RGV NV AVKAP FGD+RK++L+DIA LTGGS +++++G + +  T+ DLGQA  VVIDKDNSTIV GKG + ++  R+++I+T IE T SDYD++ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+  + ++    L L GDEKIGY+I+  AI +P+ QI  NAGFD GVV N + +  N + GFNAA G+YVDMF  GIIDP+KV RIALQNAVSVSS+LLTTEA I ++K+DK    PAMP+M
  S:     3 SKEINFSDSARNKLYEGVRQLADAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEIELADAISNMGAQLVKEVASKTADAAGDGTTTATVLAHGIFKEGLRNITAGANPIEVKRGMDKATAAIIDELKKLSKKVNDKKEIAQVATISANSDENIGSLIAEAMEKVGKDGVITVEEAKGINDELNVVEGMQFDRGYLSPYFVTNSDKMEAVLENPYILLTDKKITSMKDILPLLEGTMKSGRPLLIVAEDIEGEALTTLVVNKLRGVLNVAAVKAPGFGDRRKEMLKDIATLTGGSVISEEIGKTLESATIADLGQAARVVIDKDNSTIVDGKGSKDEVNARVAQIRTQIEATTSDYDREKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIRAAAKVK---LELSGDEKIGYEIIKRAISAPLKQIAQNAGFDAGVVANNVEQNGNENFGFNAANGEYVDMFAEGIIDPLKVARIALQNAVSVSSLLLTTEATISEIKEDK----PAMPDM 533
>gi|32266700|ref|NP_860732.1| chaperonin GroEL [Helicobacter hepaticus ATCC 51449] >gi|41016846|sp|Q7U317|CH60_HELHP 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|32262751|gb|AAP77798.1| chaperone protein HspB (GroEL/HSP60 family) [Helicobacter hepaticus ATCC 51449] (545 aa)
Score = 1673, Expect = 0.0e+00, Identities = 374/537 (69%), Positives = 455/537 (84%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           +KEI FSDSARNKL+ G++QL DAVKVTMGP+GRNVLIQKSYGAP ITKDGVSVAKE++L +PI NMGAQLVK+VASKTAD AGDGTTTATVLAY ++KEGLRN+ +GANPIE+KRGMDK   AI+ EL KSSKKI  K +I QVATISANSD+ IG LIA AMEKVG DGVITVEEAKGINDEL+VVEGMQFDRGY+S YFVT+T+KM A+LEN Y+L+TDKK+S++K+ILP+LE  M++G+PLLIIA+D++GEALTTLVVNK+RGV NV AVKAP FGD+RK +L+DIAILTGG  ++++LG + +  TL DLG A  +VIDKDN+TIV GKG    +K+RI++IKT IE T SDYD++ L+ RLAKL+ GVAVIKVGA SEVE+KEKKDRVDDALSATKAA++EGIVIGGG+AL+  S+++    L L GDE IGY I+  AI +P++QI +NAG+D GVV+NE+ K +    GFNA TG+YVDMF+ GIIDP+KVTR+ALQNAVSVSS+LLTTEA I ++K+DK    PAMP+
  S:     3 SKEINFSDSARNKLYEGIKQLSDAVKVTMGPKGRNVLIQKSYGAPTITKDGVSVAKEIELADPIANMGAQLVKEVASKTADAAGDGTTTATVLAYSIYKEGLRNITAGANPIEVKRGMDKASAAIIEELKKSSKKIGGKSDIAQVATISANSDENIGALIAEAMEKVGKDGVITVEEAKGINDELSVVEGMQFDRGYLSAYFVTNTDKMTAQLENAYVLLTDKKISNMKEILPLLEATMQSGKPLLIIAEDIEGEALTTLVVNKLRGVLNVSAVKAPGFGDRRKAMLQDIAILTGGQVISEELGKTLEAATLADLGSAARIVIDKDNTTIVDGKGKTKDVKDRIAQIKTEIENTTSDYDREKLQERLAKLSGGVAVIKVGAASEVEMKEKKDRVDDALSATKAAVDEGIVIGGGSALIRASQKVK---LKLEGDEAIGYDIIKRAIKAPLAQIATNAGYDAGVVVNEVEKNSKDGFGFNATTGEYVDMFKEGIIDPLKVTRVALQNAVSVSSLLLTTEATINEIKEDK--PAPAMPD 534
>gi|57240444|ref|ZP_00368393.1| TCP-1/cpn60 chaperonin family superfamily [Campylobacter lari RM2100] >gi|57018785|gb|EAL55558.1| TCP-1/cpn60 chaperonin family superfamily [Campylobacter lari RM2100] (545 aa)
Score = 1668, Expect = 0.0e+00, Identities = 365/539 (67%), Positives = 448/539 (83%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+T KM A+L+NP+IL+ DKK++++KD+LPILE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  ++QDLGQA SV+IDKDN+TIV G G ++ I  RI++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I   +LNL GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  +   + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIFFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPTITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNTEKMTAELQNPFILLFDKKIANLKDLLPILEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESASIQDLGQASSVIIDKDNTTIVNGAGEKANINARINQIKAQIAETSSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKSKI---SLNLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNTVENSKEENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|57242681|ref|ZP_00370618.1| chaperonin, 60 kDa [Campylobacter upsaliensis RM3195] >gi|57016610|gb|EAL53394.1| chaperonin, 60 kDa [Campylobacter upsaliensis RM3195] (545 aa)
Score = 1662, Expect = 0.0e+00, Identities = 366/539 (67%), Positives = 446/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L   +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV+EL K S+++  K EI QVATISANSD+KIG LIA+AME+VG DGVITVEEAK INDEL+VVEGMQFDRGY+SPYF+T+ +KMI +L NPYIL+ DKK++S+KD+LPILE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  + ++LG + +  TL+DLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVA+IKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  ++  + GF+AA G+YVDMF+ GIIDPVKV RIAL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKENLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVDELKKLSREVKDKKEIAQVATISANSDEKIGALIADAMERVGKDGVITVEEAKSINDELSVVEGMQFDRGYLSPYFITNADKMIVELSNPYILLFDKKITSLKDLLPILEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVIAEELGRTLESATLEDLGQASSVIIDKDNTTIVNGAGDKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVALIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKSKIK---LKLEGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENSSEENAGFDAAKGEYVDMFKAGIIDPVKVERIALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|157736693|ref|YP_001489376.1| chaperonin GroEL [Arcobacter butzleri RM4018] >gi|167008689|sp|A8ERY3|CH60_ARCB4 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|157698547|gb|ABV66707.1| 60 kDa chaperonin [Arcobacter butzleri RM4018] (544 aa)
Score = 1659, Expect = 0.0e+00, Identities = 356/538 (66%), Positives = 447/538 (83%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEI FSD+ARN+L++GV++L DAVKVTMGPRGRNVL+QKS+GAP ITKDGVSVA+E++L + +ENMGAQLVK+VASKT DEAGDGTTTATVLA+ +FKEGLRNV +GANPI +KRGMDK   AI+ EL KSSK +A K EI QVATISANSD  IG++IA AM+KVG DGVITVEEAKGI+DEL VVEGMQFDRGY+SPYFVT+  KMIA+  NP+IL+ DKK+SS+K++LPILE + ++GRPL+IIA+DVDGEAL TLVVN++RG  ++ AVKAP FGD+RK +LEDIA+LTGG+ +++++G+  +      LG A  +VIDKDN+TIV G G   ++  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSAT+AA+EEGIVIGGGAAL+  SK++N   L+L GDE+IG  IV+ AI +P+ QI  NAGFD GVV NE+ K++N +LGFNAATG+YVDMF+ GI+DP KV R+A+QNAVSV+S+LLTTEA + D+K+DK    PAMP+
  S:     1 MAKEILFSDNARNRLYSGVEKLADAVKVTMGPRGRNVLLQKSFGAPTITKDGVSVAREIELKDTLENMGAQLVKEVASKTNDEAGDGTTTATVLAHSIFKEGLRNVTAGANPISLKRGMDKACEAILAELKKSSKVVANKTEIEQVATISANSDSAIGKMIAEAMDKVGKDGVITVEEAKGISDELDVVEGMQFDRGYLSPYFVTNPEKMIAEFNNPFILLYDKKISSLKEMLPILESVNQSGRPLVIIAEDVDGEALATLVVNRLRGSLHIAAVKAPGFGDRRKAMLEDIAVLTGGTVISEEMGMKLETAEFSCLGTASKIVIDKDNTTIVDGNGDNERVVARVNQIKAEISNTTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATRAAVEEGIVIGGGAALIKASKKVN---LDLTGDERIGADIVLRAISAPLKQIAINAGFDAGVVANEVEKSSNENLGFNAATGEYVDMFEAGIVDPAKVERVAMQNAVSVASLLLTTEATVSDIKEDK----PAMPS 531
>gi|57168106|ref|ZP_00367245.1| chaperonin, 60 kDa [Campylobacter coli RM2228] >gi|57020480|gb|EAL57149.1| chaperonin, 60 kDa [Campylobacter coli RM2228] (545 aa)
Score = 1654, Expect = 0.0e+00, Identities = 364/539 (67%), Positives = 446/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L NPYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +IN   L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSNPYILLFDKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETSSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIN---LDLKGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|118474493|ref|YP_891876.1| chaperonin GroEL [Campylobacter fetus subsp. fetus 82-40] >gi|166198444|sp|A0RNU3|CH60_CAMFF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|118413719|gb|ABK82139.1| chaperonin GroL [Campylobacter fetus subsp. fetus 82-40] (545 aa)
Score = 1652, Expect = 0.0e+00, Identities = 356/529 (67%), Positives = 441/529 (83%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAKEI F+D ARN+L++GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKE++L + IENMGA LV++VASKT DEAGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK V A+ +EL  ++KK+  K EI QVATISANSD  IG+LIA AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +P+IL+ DKK++++KD+LP+LE+I KTG+PLLI+A+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  +LQDLGQA+ VVIDKDN+TIV G G +  I+ RI++IK  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDAL+ATKAA+EEGIV+GGGAAL+    R+N   L+L GDE IG +IV  A+ +P+ QI  NAGFD GVV N +  A  P+ GFNAA+G+YVDMF+ GIIDPVKV RIALQNAVSV+S+LLTTEA + ++K+DK
  S:     1 MAKEIIFADDARNRLYSGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEIELKDTIENMGAGLVREVASKTNDEAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKFVEAVTSELKSAAKKVDGKKEIAQVATISANSDSSIGDLIAEAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMQVELSSPFILLFDKKITNLKDLLPVLEQIQKTGKPLLIVAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESASLQDLGQADRVVIDKDNTTIVNGAGDKDSIEARINQIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALNATKAAVEEGIVVGGGAALIKAGNRVN---LSLKGDELIGAEIVKRALFAPLRQIAENAGFDAGVVANSVSCADCPNYGFNAASGEYVDMFEAGIIDPVKVERIALQNAVSVASLLLTTEATVSEIKEDK 526
>gi|25452865|sp|Q93GW2|CH60_WOLRE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|15594159|dbj|BAB64927.1| heat shock protein [Campylobacter rectus] (547 aa)
Score = 1652, Expect = 0.0e+00, Identities = 363/539 (67%), Positives = 441/539 (81%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARN+L+ GV++L DAVKVTMGPRGRNVL+QKS+GAP ITKDGVSVAKE++L + +ENMGA LVK+VASKT DEAGDGTTTATVLA+ +FKEGLRN+ +GANP+E+KRGMDK   AI+ EL   S+K+  K EI QVATISANSD  IG LIA+AMEKVG DGVITVEEAK I DEL VVEGMQFDRGY+SPYF+T+  KM  +L++PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  V+++LG + +  TL DLGQA SV+IDKDN+TIV G G +S I  RI +IK  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAA +    +++   LNL GDE IG  IV  A+ +P+ QI  NAGFD GVV N +  + + + GFNAATG+YVDMF+ GIIDPVKV RIALQNAVSV+S+LLTTEA I ++K+DK   +PAMP+M
  S:     1 MAKEIFFSDEARNRLYEGVRKLNDAVKVTMGPRGRNVLVQKSFGAPAITKDGVSVAKEIELKDALENMGAGLVKEVASKTNDEAGDGTTTATVLAHSIFKEGLRNITAGANPVEVKRGMDKQAAAIIAELKNLSRKVTDKKEIAQVATISANSDSAIGGLIADAMEKVGKDGVITVEEAKSIQDELNVVEGMQFDRGYLSPYFITNAEKMQVELQSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVVSEELGRTLESATLSDLGQASSVIIDKDNTTIVNGAGEKSAIDARIIQIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAAFIKAGAKVD---LNLSGDEAIGADIVRRALTAPLRQIAENAGFDAGVVANSVSVSKDDNYGFNAATGEYVDMFKAGIIDPVKVERIALQNAVSVASLLLTTEATISELKEDK--PMPAMPDM 534
>gi|157165097|ref|YP_001466610.1| chaperonin GroEL [Campylobacter concisus 13826] >gi|166198442|sp|A7ZCV2|CH60_CAMC1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|112800743|gb|EAT98087.1| chaperonin GroL [Campylobacter concisus 13826] (544 aa)
Score = 1645, Expect = 0.0e+00, Identities = 357/538 (66%), Positives = 448/538 (83%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEI +SD ARN+L+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + IENMGA LV++VASKT D+AGDGTTTATVLA+ +FKEGLRNV +GANPIE+KRGMDK V A+++ L   SKK++   EI Q+ATISANSD+ IG+LIA+AMEKVG DGVITVEEAK I DEL+VVEGMQFDRGY+SPYF+T+  KM  +L NP+IL+ DKK++++KD+LP+LE++ K+G+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+ DLGQA SVVIDKDN+TIV G G +S I  RI++IK  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSAT+AA+EEGIV+GGG+AL+  SK +N   LNL GDE IG +IV  A+ +P+ QI  NAGFD GVV N +  + + + GFNAATG+YV+MF+ GIIDPVKV R+ALQNAVSV+S+LLTTEA I ++K++K  ++PAMP+
  S:     1 MAKEIFYSDDARNRLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPNITKDGVSVAKEVELKDTIENMGASLVREVASKTNDQAGDGTTTATVLAHAIFKEGLRNVTAGANPIEVKRGMDKEVAALIDALKNISKKVSGSKEIAQIATISANSDESIGKLIADAMEKVGKDGVITVEEAKSIQDELSVVEGMQFDRGYLSPYFITNPEKMQVELSNPFILLFDKKITNLKDLLPVLEQVQKSGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATINDLGQASSVVIDKDNTTIVNGAGEKSAIDARITQIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATRAAVEEGIVVGGGSALILASKSVN---LNLQGDEAIGAEIVRRALRAPLRQIAENAGFDAGVVANAVETSKDANFGFNAATGEYVNMFEAGIIDPVKVERVALQNAVSVASLLLTTEATISEIKEEK--AMPAMPD 533
>gi|86150713|ref|ZP_01068929.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841883|gb|EAQ59129.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 260.94] (545 aa)
Score = 1645, Expect = 0.0e+00, Identities = 362/539 (67%), Positives = 445/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVGELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|154173786|ref|YP_001408485.1| chaperonin GroEL [Campylobacter curvus 525.92] >gi|166198443|sp|A7GZ43|CH60_CAMC5 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|153793006|gb|EAU00075.2| chaperonin GroL [Campylobacter curvus 525.92] (544 aa)
Score = 1644, Expect = 0.0e+00, Identities = 357/538 (66%), Positives = 448/538 (83%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEI +SD ARN+L+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + IENMGA LV++VASKT D+AGDGTTTATVLA+ +FKEGLRNV +GANPIE+KRGMDK V A+++EL   +KK++   EI Q+ATISANSD+ IG+LIA+AMEKVG DGVITVEEAK I DEL VVEGMQFDRGY+SPYF+T+  KM  +L NP+IL+ DKK++++KD+LP+LE+I KTG+PLLI+A+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  TL+DLGQA SVVIDKDN+TIV G G +S I  RI++IK  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSAT+AA+EEGIV+GGG+AL+  SKR+    L+L GDE IG +IV  A+ +P+ QI  NAGFD GVV N +  +++ + GFNA +G+YV+MF+ GIIDPVKV R+ALQNAVSV+S+LLTTEA I ++K+DK   +PAMP+
  S:     1 MAKEIFYSDDARNRLYEGVRKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDTIENMGASLVREVASKTNDQAGDGTTTATVLAHAIFKEGLRNVTAGANPIEVKRGMDKEVAALIDELKNIAKKVSGSKEIAQIATISANSDESIGKLIADAMEKVGKDGVITVEEAKSIEDELNVVEGMQFDRGYLSPYFITNAEKMQVELSNPFILLFDKKITNLKDLLPVLEQIQKTGKPLLIVAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATLEDLGQASSVVIDKDNTTIVNGAGEKSAIDARINQIKAQIAETTSDYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATRAAVEEGIVVGGGSALILASKRVK---LDLSGDEAIGAEIVRRALRAPLRQIAENAGFDAGVVTNAVEVSSDVNYGFNAVSGEYVNMFEAGIIDPVKVERVALQNAVSVASLLLTTEATISELKEDK--PMPAMPD 533
>gi|148926221|ref|ZP_01809906.1| 60 kD chaperonin (cpn60) [Campylobacter jejuni subsp. jejuni CG8486] >gi|157415484|ref|YP_001482740.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni 81116] >gi|172047164|sp|A8FMS6|CH60_CAMJ8 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|145845392|gb|EDK22485.1| 60 kD chaperonin (cpn60) [Campylobacter jejuni subsp. jejuni CG8486] >gi|157386448|gb|ABV52763.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 81116] (545 aa)
Score = 1644, Expect = 0.0e+00, Identities = 362/539 (67%), Positives = 445/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|153951379|ref|YP_001397688.1| chaperonin GroEL [Campylobacter jejuni subsp. doylei 269.97] >gi|166198446|sp|A7H2F8|CH60_CAMJD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|152938825|gb|ABS43566.1| co-chaperonin GroEL [Campylobacter jejuni subsp. doylei 269.97] (545 aa)
Score = 1642, Expect = 1.1e-180, Identities = 361/539 (66%), Positives = 445/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+T+V G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    PAMP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTVVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PAMPDM 532
>gi|152993543|ref|YP_001359264.1| chaperonin GroEL [Sulfurovum sp. NBC37-1] >gi|166201757|sp|A6QBP8|CH60_SULNB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|151425404|dbj|BAF72907.1| co-chaperonin GroEL [Sulfurovum sp. NBC37-1] (542 aa)
Score = 1640, Expect = 1.7e-180, Identities = 357/545 (65%), Positives = 447/545 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           MAKEI FSD ARN LF GV +L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVA+E++L + +ENMGAQLVK+VAS TADEAGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AI+ EL K SK++  K EI QVATISANSD+ IG LIA AM++VG DGVITVEEAKGIND+L VVEGMQFDRGY+SPYFVT+T KM  ++ENP ILITD K++S+KD++P+LE+I ++GRPLLII+DD++GEAL TLV+N+++GV N+ AVKAP FGD++K++L+DIAILTG + +T++LG+S DK TL DLGQA  VVIDKDN+ IV GKG  + +  R+++IK  +E T S+YDK+ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA++EGIVIGGGAAL   SK +    L+L  DE +G +I++ A+ +P+ QI  NAGFD GVV ++I   +  +LGFNAATG+YV+M + GIIDP+KV R+ALQNA SV+S+LLTTEA + D+K +     P MP+M GM GMM
  S:     1 MAKEIFFSDKARNGLFEGVTKLADAVKVTMGPRGRNVLIQKSFGAPHITKDGVSVAREIELEDTLENMGAQLVKEVASNTADEAGDGTTTATVLAHSIFKEGLRNITAGANPIEVKRGMDKASAAIIEELKKISKEVKDKKEIAQVATISANSDETIGNLIAEAMDRVGKDGVITVEEAKGINDDLEVVEGMQFDRGYLSPYFVTNTEKMTCEMENPLILITDSKITSLKDLIPVLEQIQQSGRPLLIISDDLEGEALATLVLNRLKGVLNIAAVKAPGFGDRKKEMLKDIAILTGANVITEELGLSLDKATLDDLGQAGRVVIDKDNTVIVDGKGDSAAVDARVAEIKIQVENTTSEYDKEKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVDEGIVIGGGAALAKASKAVK---LDLEHDEAVGAEIILRAVYAPMKQIAQNAGFDAGVVADKIANNSEANLGFNAATGEYVNMLEAGIIDPLKVARVALQNATSVASLLLTTEATVSDIK-EAPTPAPTMPDMGGMPGMM 542
>gi|15792545|ref|NP_282368.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|88596234|ref|ZP_01099471.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612249|ref|YP_001000895.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005807|ref|ZP_02271565.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni 81-176] >gi|166198447|sp|A1W0K4|CH60_CAMJJ 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|9297084|sp|O69289|CH60_CAMJE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|18308144|gb|AAL67841.1|AF461534_1 60 kDa chaperonin Cpn60 [Campylobacter jejuni] >gi|18308146|gb|AAL67842.1|AF461535_1 60 kDa chaperonin Cpn60 [Campylobacter jejuni] >gi|18308150|gb|AAL67844.1|AF461537_1 60 kDa chaperonin Cpn60 [Campylobacter jejuni] >gi|18652059|gb|AAL76936.1|AF461064_1 60 kDa chaperonin [Campylobacter jejuni] >gi|87249858|gb|EAQ72817.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 81-176] >gi|88191075|gb|EAQ95047.1| co-chaperonin GroEL [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360539|emb|CAL35336.1| 60 kD chaperonin (cpn60) [Campylobacter jejuni subsp. jejuni NCTC 11168] (545 aa)
Score = 1640, Expect = 1.8e-180, Identities = 361/539 (66%), Positives = 444/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    P MP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PTMPDM 532
>gi|57238093|ref|YP_179343.1| chaperonin GroEL [Campylobacter jejuni RM1221] >gi|68566257|sp|Q5HTP2|CH60_CAMJR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|57166897|gb|AAW35676.1| co-chaperonin GroEL [Campylobacter jejuni RM1221] (545 aa)
Score = 1639, Expect = 2.0e-180, Identities = 361/539 (66%), Positives = 444/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    P MP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PTMPDM 532
>gi|3063761|emb|CAA73778.1| heat shock protein [Campylobacter jejuni] (545 aa)
Score = 1638, Expect = 3.1e-180, Identities = 360/539 (66%), Positives = 443/539 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAKEI FSD ARNKL+ GV++L DAVKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEE K INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    P MP+M
  S:     1 MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEPKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGATTETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PTMPDM 532
>gi|152990258|ref|YP_001355980.1| chaperonin GroEL [Nitratiruptor sp. SB155-2] >gi|166201735|sp|A6Q2B4|CH60_NITSB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|151422119|dbj|BAF69623.1| co-chaperonin GroEL [Nitratiruptor sp. SB155-2] (547 aa)
Score = 1627, Expect = 4.6e-179, Identities = 361/536 (67%), Positives = 444/536 (82%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTG-RPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AKEI FSD AR +LF GV++L DAVKVTMGPRGRNVLIQKS+G+P ITKDGVSVAKE++L N +ENMGAQLVK+VASKTADEAGDGTTTATVLAY +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K +K++  K EI QVATISAN+D KIGELIA AMEKVG DGVITVEE K + DEL VVEGMQFDRGY+SPYFVTDT KM A LEN YIL+ DKK+S++KD+LP+LE++++TG +PLLIIA+D++GEAL TLVVNK+RG  NV AVKAP FGD+RK +L+DIAILTGG  +++++G + +  TL+DLGQA+ +V+DK+N+TIV GKG ++ ++ RI +IK  IE T S+YDK+ L+ RLAKL  GVAVIKVGA +E E+KEKKDRVDDAL+ATKAA+EEGIVIGGG ALV  + ++N   L+L GDEKIG +I++ AI +P+ QI  NAGFD GVV N +  A N + GFNAATG+YVDMF+ GI+DP KV R+ALQNAVSV+S+LLTTEA + ++K+DK    PA P
  S:     3 AKEIHFSDIARGELFEGVKKLADAVKVTMGPRGRNVLIQKSFGSPSITKDGVSVAKEIELPNTVENMGAQLVKEVASKTADEAGDGTTTATVLAYNIFKEGLRNITAGANPIEVKRGMDKAAEAIVAELKKIAKEVKDKKEIAQVATISANNDPKIGELIAEAMEKVGKDGVITVEEGKSLQDELEVVEGMQFDRGYLSPYFVTDTEKMEAVLENAYILLYDKKISNMKDLLPVLEKVVQTGNKPLLIIAEDIEGEALATLVVNKLRGTLNVCAVKAPGFGDRRKAMLQDIAILTGGQVISEEVGRTLESATLEDLGQADRIVVDKENTTIVGGKGDKAAVEARIKEIKAQIEQTTSEYDKEKLQERLAKLAGGVAVIKVGAATETEMKEKKDRVDDALAATKAAVEEGIVIGGGTALVRAANKVN---LDLCGDEKIGAEIILRAIKAPLKQIAENAGFDPGVVANNVENAENENTGFNAATGEYVDMFEAGIVDPAKVERVALQNAVSVASLLLTTEATVSEIKEDK----PAAP 532
>gi|78776830|ref|YP_393145.1| chaperonin GroEL [Sulfurimonas denitrificans DSM 1251] >gi|119366276|sp|Q30SX1|CH60_THIDN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78497370|gb|ABB43910.1| chaperonin GroEL [Sulfurimonas denitrificans DSM 1251] (542 aa)
Score = 1610, Expect = 4.5e-177, Identities = 345/529 (65%), Positives = 429/529 (81%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAKEI FSD+ARN L  GV +L DAVKVTMGPRGRNVLIQKSYG P+ITKDGVSVA+E++L + +ENMGA LVKDVAS+TADEAGDGTTTATVLA  +F EGLRN+ +GANPIE+KRGMDK    I+  L  SSK I  K +I QVATISANSD  IG++IA AMEKVG DGVITVEEAKGI DEL VVEGMQFDRGY+SPYF+T+T KM A++ENP+IL+ D K++S+KD+LP+LE++ KT RPLLIIA+DV+GEAL+TLVVNK+RGV N+ AVKAP FGD+RK +L+DIA+LT G+ ++++ G +    T+Q LGQA  +VIDKDN+ IV G G    ++ R+  IK  +  T S+YDK+ L+ RLAKL+ GVAVIKVGA SE E+KEKKDRVDDALSATKAA+EEGIVIGGGAALV    ++    L+L GD+KIG +I++ AI +P+ QI +NAG+D GVV+N +  ATN ++GFNAATG+YVDMF+ GIIDP KV R+AL NA S++S+LLTTEA IY++ ++K
  S:     1 MAKEIIFSDNARNALARGVAKLTDAVKVTMGPRGRNVLIQKSYGNPIITKDGVSVAREIELQDKLENMGATLVKDVASRTADEAGDGTTTATVLANAIFSEGLRNITAGANPIEVKRGMDKACEEILKHLKASSKVINGKKDIAQVATISANSDTAIGDMIAEAMEKVGQDGVITVEEAKGIVDELDVVEGMQFDRGYLSPYFITNTEKMTAEIENPWILLADSKIASLKDLLPVLEQVQKTSRPLLIIAEDVEGEALSTLVVNKLRGVLNISAVKAPGFGDRRKAMLQDIAVLTAGTVISEETGHTLSGATIQHLGQASRIVIDKDNTVIVNGAGTSEAVQARVDAIKVQMNTTTSEYDKEKLQERLAKLSGGVAVIKVGAASETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALVRAGAKVK---LDLSGDQKIGCEIILRAIKAPLKQIATNAGYDAGVVVNAVEGATNENIGFNAATGEYVDMFEAGIIDPFKVGRVALTNATSIASLLLTTEAAIYELPEEK 526
>gi|154148819|ref|YP_001406156.1| chaperonin GroEL [Campylobacter hominis ATCC BAA-381] >gi|166198445|sp|A7I0W5|CH60_CAMHC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|153804828|gb|ABS51835.1| chaperonin GroL [Campylobacter hominis ATCC BAA-381] (543 aa)
Score = 1598, Expect = 1.3e-175, Identities = 351/539 (65%), Positives = 437/539 (81%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAK+I FSD ARN+L++GV++L D VKVTMGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + IENMGA LVK+VA+KT D+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK    +V EL K SK +  K EI QVATISANSD+ IG+LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+TD  KM  +L +P +L+ DKK++++KD+LP+LE++ KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG+ ++++LG + +  ++ DLG+AE ++IDKDN+TIV G G +  IK R+ +IK  I +T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+   K  N    NL GDEKIG  IV  A+ +P+ QI  NAGFD GV+ N +        GF+AA G++V+MF+ GIIDPVKV R+ALQNAVSV+S+LLTTEA + ++K+DK    PAMP M
  S:     1 MAKDIIFSDDARNRLYDGVKKLNDTVKVTMGPRGRNVLIQKSFGAPAITKDGVSVAKEVELKDTIENMGAALVKEVANKTNDQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKICADVVAELKKISKPVKDKKEIAQVATISANSDESIGKLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITDAEKMQVELNSPLVLLFDKKITNLKDLLPVLEQVQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGTVISEELGRTLESASIADLGKAERILIDKDNTTIVNGAGKKDDIKARVDQIKAQIAVTSSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALI---KAGNAVKENLKGDEKIGADIVKRALFAPLRQIAENAGFDAGVIANAVSINKEKAYGFDAACGEFVNMFEAGIIDPVKVERVALQNAVSVASLLLTTEATVSEIKEDK----PAMPQM 532
>gi|149194851|ref|ZP_01871945.1| chaperonin GroEL [Caminibacter mediatlanticus TB-2] >gi|149135010|gb|EDM23492.1| chaperonin GroEL [Caminibacter mediatlanticus TB-2] (544 aa)
Score = 1575, Expect = 5.6e-173, Identities = 345/538 (64%), Positives = 444/538 (82%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTG--RPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEI +SD ARN+L  GV++L DAV+VTMGP+GRNVL+Q+S+GAP ITKDGVSVAKE++L +P+ENMGAQLVK+VASKTADEAGDGTTTATVLA+ +FKEGL+ + +GANPI +KRGMD    AI+ EL K SK +  K++I QVATISAN+DKKIGELIA AM+KVG DGVITVEE K + DEL VVEGMQFDRGY+SPYFVT+ +KM+A+ E+ YIL+ DKK+S++KD+LP+LE++++ G  +PLLIIA+DVDGEAL TLVVNK+RGV NVVAVKAP FGD+RK +L+DIAILTGG  ++++LG + +  TL DLGQA  +V+DK+N+TIV GKG ++ I+ RI++IK  IE T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGG+A++  +K+  V +++   DE+IG  I+  A+ +PI QI SNAG++ GVV+  + +  + +LGFNAATG+YVDMF+ GIIDP KV RIALQNA SV  +LLTTEA + + +  +E + PAMP+
  S:     1 MAKEIVYSDKARNELLAGVEKLADAVRVTMGPKGRNVLLQRSFGAPHITKDGVSVAKEIELKDPVENMGAQLVKEVASKTADEAGDGTTTATVLAHAIFKEGLKYITAGANPIAVKRGMDAATKAIIEELKKMSKPVENKEQIAQVATISANNDKKIGELIAEAMDKVGKDGVITVEEGKSLEDELEVVEGMQFDRGYLSPYFVTNPDKMVAEYEDAYILLYDKKISNMKDLLPLLEQLVQQGGNKPLLIIAEDVDGEALATLVVNKLRGVLNVVAVKAPGFGDRRKAMLQDIAILTGGQVISEELGRTLESATLADLGQAGRIVVDKENTTIVDGKGDKAAIEARINQIKKEIEETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGSAILKAAKKAEVESVD--PDEQIGIDIIKRAVKAPIKQIASNAGYEPGVVVMTV-ENGDENLGFNAATGEYVDMFEAGIIDPTKVERIALQNATSVGGLLLTTEAAVTE-EPKEEKAAPAMPD 536
>gi|86152587|ref|ZP_01070792.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843472|gb|EAQ60682.1| chaperonin GroEL [Campylobacter jejuni subsp. jejuni HB93-13] (516 aa)
Score = 1546, Expect = 1.2e-169, Identities = 339/510 (66%), Positives = 419/510 (82%)
  Q:    30 MGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MGPRGRNVLIQKS+GAP ITKDGVSVAKEV+L + +ENMGA LV++VASKTAD+AGDGTTTATVLA+ +FKEGLRN+ +GANPIE+KRGMDK   AIV EL K S+++  K EI QVATISANSD+KIG LIA+AMEKVG DGVITVEEAK INDEL VVEGMQFDRGY+SPYF+T+  KM  +L +PYIL+ DKK++++KD+LP+LE+I KTG+PLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  ++++LG + +  T+QDLGQA SV+IDKDN+TIV G G ++ I  R+++IK  I  T SDYD++ L+ RLAKL+ GVAVIKVGA +E E+KEKKDRVDDALSATKAA+EEGIVIGGGAAL+    +I    L+L GDE IG  IV  A+ +P+ QI  NAGFD GVV+N +  A + + GF+AA G+YV+M ++GIIDPVKV R+AL NAVSV+SMLLTTEA I ++K+DK    P MP+M
  S:     1 MGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTIVNGAGEKANIDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDALSATKAAVEEGIVIGGGAALIKAKAKIK---LDLQGDEAIGAAIVERALRAPLRQIAENAGFDAGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEATISEIKEDK----PTMPDM 503
>gi|189220187|ref|YP_001940827.1| Chaperonin GroEL (HSP60 family) [Methylokorus infernorum V4] >gi|189187045|gb|ACD84230.1| Chaperonin GroEL (HSP60 family) [Methylacidiphilum infernorum V4] (544 aa)
Score = 1466, Expect = 2.4e-160, Identities = 317/543 (58%), Positives = 418/543 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AK++ F +SAR+ L  GV++L  AVK T+GP GRNV++ K +G+P ITKDGV+VAKEV+L +P ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++KEGL+NV +GANP+++KRG+DK V A+V +L + S  +  K+EI QVAT+SAN D  IGE+IA+A++KVG DG +TVEEAK I   L VVEGMQFDRGYISPYFVT+  ++ A LEN YILI +KK+S++KD+LP+LE+I K GRPLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +T+DLGI  + V L+DLG+A+ ++++K+N+TI++G G  S+I+ RI++I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E ELKEKK RV+DAL AT+AA+EEGIV GGG AL+   K I    L+L GDE+IG  IV  A+  P+  +  NAG +  V++NE+ KA   + GF+ A   YVDMF+ GI+DP KVTR AL+NA S++ +LLTTEA++ ++ + ++   PA P  G GGM
  S:     3 AKQLIFDESARHALLRGVEKLSKAVKCTLGPAGRNVILDKKFGSPTITKDGVTVAKEVELEDPWENMGAQLVKEVASKTSDVAGDGTTTATVLAESIYKEGLKNVTAGANPMDLKRGVDKAVQAVVKQLKEISHIVKGKEEIKQVATVSANWDTSIGEIIADALDKVGKDGTVTVEEAKHIETTLEVVEGMQFDRGYISPYFVTNAEELEAVLENAYILIHEKKISNLKDLLPLLEKIAKAGRPLLIIAEDVEGEALATLVVNKLRGTLQVCAVKAPGFGDRRKAMLEDIAILTGGRCLTEDLGIKLENVQLEDLGRAKRIIVEKENTTIIEGSGSRSEIQGRINQIRRQIEETTSDYDREKLQERLAKLAGGVAVIHVGAATETELKEKKARVEDALHATRAAVEEGIVPGGGVALLRCQKAI--EGLSLKGDEQIGANIVYKALEYPLKTLADNAGLEGSVIVNEV-KAKKGNEGFDVAKRSYVDMFEAGIVDPTKVTRTALENAASIAGLLLTTEAMVTEIPEKEKK--PATP-AGAGGM 539
>gi|584920|sp|Q07201|CH60_BACST 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|289300|gb|AAA22752.1| GroEL [Geobacillus stearothermophilus] (539 aa)
Score = 1457, Expect = 2.8e-159, Identities = 322/545 (59%), Positives = 421/545 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SPY +TDT KM A LENPYILITDKKVSSI++ILPILE++++ GRPLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+N+TIV+G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI   AG + G +I E LK   P +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +   P MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIQGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFATELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQEILPILEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSATIASLGRASKVVVTKENTTIVEGAGDSKRIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNVYSK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQTAGLE-GSIIVERLKTEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNPGMPD--MGGMM 539
>gi|171324905|ref|ZP_02913416.1| chaperonin GroEL [Geobacillus sp. WCH70] >gi|171089180|gb|EDT35514.1| chaperonin GroEL [Geobacillus sp. WCH70] (539 aa)
Score = 1451, Expect = 1.4e-158, Identities = 321/545 (58%), Positives = 420/545 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SPY +TDT KM A LENPYILITDKK+S+I+DILPILE++++ G+PLLIIA+DV+GEAL TLVVNK+RG F  VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+N+TIV G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G VI E LK   P +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +   P MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIKGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRDLKSTTIASLGRASKVVVTKENTTIVDGAGDSERIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNVYNK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSVIVERLKTEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNPGMPD--MGGMM 539
>gi|94502301|ref|ZP_01308779.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|161833791|ref|YP_001597987.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS] >gi|189082373|sp|A8Z640|CH60_SULMW 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|94451140|gb|EAT14087.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|152206281|gb|ABS30591.1| 60 kDa chaperonin GroEL [Candidatus Sulcia muelleri GWSS] (543 aa)
Score = 1445, Expect = 7.5e-158, Identities = 323/545 (59%), Positives = 426/545 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK I+F   AR+KL  GV  L +AVKVT+GP+GRNV++QKS+G P +TKDGVSVAKE++L +PIEN+GAQ+VK+VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+++KRG+DK V A+VN+L K S+++   +E I QVA+ISAN+D+ IGELI+ A +KVG +GVITVEEAKGI   + VVEGMQFDRGY SPYFVT+++KMI + +NPYIL++DKK+SS+KD+LPILE + ++G+PLLII+++V+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +   L  LG+AE V IDKDN+TIV G G +S I+ R+++IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   K +N   ++ + D+  G +IV  ++  P+ QIV+NAG +  V++ ++ +  N   G++A  G+Y +M   GIIDP KVTR+AL+NA SVS MLLTTE VI ++K + E ++P MPN GMGGMM
  S:     1 MAKNIQFDIEARDKLKKGVDALANAVKVTLGPKGRNVVLQKSFGGPQVTKDGVSVAKEIELEDPIENLGAQMVKEVASKTNDIAGDGTTTATVLAQAIVREGLKNVAAGANPMDLKRGIDKAVEAVVNDLKKQSREVGGSNEKIKQVASISANNDEAIGELISVAFDKVGKEGVITVEEAKGIETTVDVVEGMQFDRGYQSPYFVTNSDKMITEFDNPYILLSDKKISSMKDLLPILEPVAQSGKPLLIISEEVEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEETGSKLEDTKLSFLGKAERVTIDKDNTTIVNGNGKKSDIESRVNQIKAQIEKTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAIKSLNGLKVDNV-DQDTGIKIVKRSLQEPLRQIVANAGEEGSVIVAKVAEGKN-EFGYDAKLGEYKNMISEGIIDPTKVTRVALENAASVSGMLLTTECVITEIKKE-EPAMPQMPNSGMGGMM 543
>gi|108762020|ref|YP_633052.1| chaperonin GroEL [Myxococcus xanthus DK 1622] >gi|118597098|sp|Q1D2S1|CH602_MYXXD 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|108465900|gb|ABF91085.1| chaperonin GroEL [Myxococcus xanthus DK 1622] (549 aa)
Score = 1440, Expect = 2.8e-157, Identities = 313/531 (58%), Positives = 405/531 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           MAK+I F   AR  +  GV  L DAVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +F+EG + V +G NP++IKRG+DK V AIV EL K +K    K EI QV TISAN D+ IG +IA+AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  +M A L +  ILI +KK+SS+KD+LPILE++ + G+PLLIIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LEDIA LTGG  + +DLGI  D +TLQDLG+A+ + +DKDN+TIV G G + +I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL+AT+AA+EEG+V GGG A +   K +  + L L G EK G  I+  A+  P+ QIV N G +  VV+N++ +++ P  GFNAATG Y D+   G+IDP KV+R ALQNA SVSS++LTTEA++ +   +++D
  S:     1 MAKDILFDVRAREAILRGVNILADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIFREGAKLVAAGHNPMDIKRGIDKAVGAIVAELKKLAKPTKDKKEIAQVGTISANGDETIGTIIADAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTDPERMEAALNDALILINEKKISSMKDLLPILEQVARAGKPLLIIAEDIEGEALATLVVNKIRGVLNVCAVKAPGFGDRRKAMLEDIATLTGGRMIAEDLGIKLDTITLQDLGRAKRITVDKDNTTIVDGAGGQQEIEARVKQIRAQIEETSSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALNATRAAVEEGVVPGGGVAYIRCLKAL--DGLQLSGGEKFGVDIIRRAVEEPLRQIVGNGGLEGSVVVNKVKESSGP-FGFNAATGTYEDLLAAGVIDPAKVSRTALQNAASVSSLMLTTEAMVAERPKEEKD 528
>gi|22538209|ref|NP_689060.1| chaperonin GroEL [Streptococcus agalactiae 2603V/R] >gi|76786852|ref|YP_330603.1| chaperonin GroEL [Streptococcus agalactiae A909] >gi|77409160|ref|ZP_00785873.1| chaperonin, 60 kDa [Streptococcus agalactiae COH1] >gi|77411832|ref|ZP_00788166.1| chaperonin, 60 kDa [Streptococcus agalactiae CJB111] >gi|29839300|sp|Q8CX00|CH60_STRA5 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|119366272|sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|22535120|gb|AAN00933.1|AE014285_15 60 kda chaperonin [Streptococcus agalactiae 2603V/R] >gi|76561909|gb|ABA44493.1| chaperonin GroEL [Streptococcus agalactiae A909] >gi|77162109|gb|EAO73086.1| chaperonin, 60 kDa [Streptococcus agalactiae CJB111] >gi|77172244|gb|EAO75400.1| chaperonin, 60 kDa [Streptococcus agalactiae COH1] (540 aa)
Score = 1438, Expect = 4.2e-157, Identities = 319/543 (58%), Positives = 422/543 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V+A V EL + ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+++LENPYILITDKK+S+I++ILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ VT+DLG+     T+Q LGQ+  V +DKD++ IV+G G  S I  R++ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L L GDE+ G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++VDM  TGIIDPVKVTR ALQNA SV+S++LTTEAV+ +  + +  + PAM    MGG
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVSAAVEELKEIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNIQEILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVVTEDLGLDLKDATMQVLGQSAKVTVDKDSTVIVEGAGDSSAIANRVAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVNVIEK--VAALKLNGDEETGRNIVLRALEEPVRQIAYNAGYEGSVII-ERLKQSEIGTGFNAANGEWVDMVTTGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPEAPTAPAMDPSMMGG 539
>gi|196233177|ref|ZP_03132024.1| chaperonin GroEL [Chthoniobacter flavus Ellin428] >gi|196222821|gb|EDY17344.1| chaperonin GroEL [Chthoniobacter flavus Ellin428] (544 aa)
Score = 1438, Expect = 4.6e-157, Identities = 308/543 (56%), Positives = 415/543 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AK+++F ++AR  L  GV++L  AVK T+GP GRNV++ K +G+P ITKDGV+VAKE++L +P ENMGAQLV++VASKT+D AGDGTTTATVLA  ++KEGL+NV +GANP+ ++RG++K V A+VNE+++ SKK+  + EI QVAT+SAN D  IGE+IA+AM+KVG DG ITVEEAK I   L VVEGMQFD+GYISPYFVT+   +   L+NPYILI +KK+SS+KD+LP+LE+  KTG+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + +TL+DLG+A+ + IDK+N+TIV+G G  + I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E ELKEKK RV+DAL AT+AA+EEGIV GGG AL+   K +    + L GDE IG  I+  AI +P+ Q+  NAG +  ++++E+ K    + G+N ATG+Y D+ + G++DP KVTR ALQ+A S+S +LLTTEAVI ++ + ++ +       G GGM
  S:     3 AKQLQFDEAARQALLRGVEKLAKAVKATLGPAGRNVILDKKFGSPTITKDGVTVAKEIELDDPYENMGAQLVREVASKTSDMAGDGTTTATVLAEAIYKEGLKNVTAGANPMSLQRGINKAVEALVNEISRISKKVKDRTEIAQVATVSANWDTTIGEIIADAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYISPYFVTNAESLEVILDNPYILIHEKKISSLKDLLPVLEKTAKTGKPLLIIAEDVEGEALATLVVNKLRGTIQVAAVKAPGFGDRRKAILEDIAILTGGRLLSEDLGIKLENITLEDLGKAKRITIDKENTTIVEGSGKNTDIQGRVGQIRRQIEETTSDYDREKLQERLAKLAGGVAVINVGAATETELKEKKARVEDALHATRAAVEEGIVPGGGVALIRAQKAL--EAVKLEGDEAIGLAIIKRAIEAPLRQLADNAGQEGALIVSEV-KKRKGNEGYNVATGEYTDLIKAGVVDPAKVTRSALQHAASISGLLLTTEAVITELPEKEKPAGGDAHGHGPGGM 542
>gi|76798805|ref|ZP_00781018.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Streptococcus agalactiae 18RS21] >gi|76585843|gb|EAO62388.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Streptococcus agalactiae 18RS21] (540 aa)
Score = 1438, Expect = 4.8e-157, Identities = 319/543 (58%), Positives = 422/543 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V+A V EL + ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+++LENPYILITDKK+S+I++ILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ VT+DLG+     T+Q LGQ+  V +DKD++ IV+G G  S I  R++ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L L GDE+ G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++VDM  TGIIDPVKVTR ALQNA SV+S++LTTEAV+ +  + +  + PAM    MGG
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVSAAVEELKEIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNIQEILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVVTEDLGLDLKDATMQVLGQSAKVTVDKDSTVIVEGAGDSSAIANRVAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVNVIEK--VAALKLNGDEETGRNIVLRALEEPVRQIAYNAGYEGSVII-ERLKQSEIGTGFNAABGEWVDMVTTGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPEAPTAPAMDPSMMGG 539
>gi|6526961|dbj|BAA88110.1| Cpn60 [Bacillus sp. MS] (539 aa)
Score = 1437, Expect = 5.2e-157, Identities = 318/545 (58%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SPY +TDT KM A LENPYILITDKK+S+I+DILPILE++++ G+PLLIIA+D++GEAL TLVVNK+RG F  VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+N+TIV G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GV VIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G VI E LK   P +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +     MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIKGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVVQQGKPLLIIAEDIEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSATIASLGRASKVVVTKENTTIVDGAGDSERIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNVYNK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSVIVERLKTEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNAGMPD--MGGMM 539
>gi|77412967|ref|ZP_00789170.1| chaperonin, 60 kDa [Streptococcus agalactiae 515] >gi|77160979|gb|EAO72087.1| chaperonin, 60 kDa [Streptococcus agalactiae 515] (540 aa)
Score = 1437, Expect = 6.1e-157, Identities = 319/543 (58%), Positives = 421/543 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L    ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V+A V EL + ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+++LENPYILITDKK+S+I++ILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ VT+DLG+     T+Q LGQ+  V +DKD++ IV+G G  S I  R++ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L L GDE+ G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++VDM  TGIIDPVKVTR ALQNA SV+S++LTTEAV+ +  + +  + PAM    MGG
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEEHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVSAAVEELKEIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNIQEILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVVTEDLGLDLKDATMQVLGQSAKVTVDKDSTVIVEGAGDSSAIANRVAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVNVIEK--VAALKLNGDEETGRNIVLRALEEPVRQIAYNAGYEGSVII-ERLKQSEIGTGFNAANGEWVDMVTTGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPEAPTAPAMDPSMMGG 539
>gi|25452855|sp|Q8VV84|CH60_BACTR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|18250941|dbj|BAB83940.1| GroEL [Geobacillus thermoglucosidasius] (539 aa)
Score = 1436, Expect = 6.8e-157, Identities = 319/545 (58%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TDT KM A LENPYILITDKK+S+I+DILPILE++++ G+PLLIIA+DV+GEAL TLVVNK+RG F  VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+N+TIV+G G   +IK RI++I+  +E T S++D+  L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G VI E LK+  P +GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +     MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIQGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSERIKARINQIRAQLEETTSEFDRGKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNVYNK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSVIVERLKSEKPGIGFNAATGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNSGMPD--MGGMM 539
>gi|187735900|ref|YP_001878012.1| chaperonin GroEL [Akkermansia muciniphila ATCC BAA-835] >gi|187425952|gb|ACD05231.1| chaperonin GroEL [Akkermansia muciniphila ATCC BAA-835] (550 aa)
Score = 1436, Expect = 7.5e-157, Identities = 305/532 (57%), Positives = 400/532 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS 532
           MAK+I+F ++AR  L  GV+Q+  AVK T+GP GRNV+I K +G+P+ITKDGV+VAKE++L +P ENMGAQLV++V+SKT D AGDGTTTATVLA  +++EGLRNV +GANPI ++RG+ K  +++V EL K SK +    E+ QVAT+SAN D +IG +IA AM+KVG DG ITVEEAKGI   L VVEGMQFD+GY+SPYFVT+   M A LENPYILI +KK++++KD LP+LE++ K+GRP L+IA+D++GEAL TLVVN++RGV N+ AVKAP FGD+RK ++EDIAILTGG  +T+DLGI  + V ++DLGQA+ VV+ KD + IV+G    S I+ RIS+I+  I+ T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RVDDAL AT+AA+EEGIV GGG AL+   K I  +TL L GDE  G QIV  A+ +P+ Q+  NAG +  +++  +    N   G+N AT KY D+   G++DP KVTR ALQNA S++ +LLTTE VI D  + K  S
  S:     1 MAKQIQFDETARQALLRGVEQIAKAVKSTLGPAGRNVVIDKKFGSPLITKDGVTVAKEIELEDPFENMGAQLVREVSSKTNDVAGDGTTTATVLAESIYREGLRNVTAGANPISLQRGIMKAADSVVEELKKISKPVDSSKEVAQVATVSANWDAEIGNIIAEAMDKVGKDGTITVEEAKGIETTLDVVEGMQFDKGYLSPYFVTNAETMEAVLENPYILIHEKKINNLKDFLPLLEKVAKSGRPFLVIAEDIEGEALATLVVNRLRGVLNICAVKAPGFGDRRKAMMEDIAILTGGKCITEDLGIKLENVGIEDLGQAKRVVVSKDETVIVEGSAKSSDIEARISQIRRQIKDTTSDYDREKLQERLAKLAGGVAVIHVGAATETEMKEKKARVDDALHATRAAVEEGIVPGGGVALIRAQKAI--DTLKLEGDEATGAQIVYRAVEAPLRQLACNAGREGALIVANVKGMKNTAEGYNVATDKYEDLLSAGVVDPTKVTRSALQNAASIAGLLLTTECVIADKPEKKSCS 530
>gi|110638228|ref|YP_678437.1| 60 kDa chaperonin [Cytophaga hutchinsonii ATCC 33406] >gi|118597110|sp|Q11U19|CH60_CYTH3 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|110280909|gb|ABG59095.1| 60 kDa chaperonin [Cytophaga hutchinsonii ATCC 33406] (542 aa)
Score = 1433, Expect = 1.8e-156, Identities = 313/529 (59%), Positives = 412/529 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK+I F   AR KL  GV  L DAVKVT+GP+GRNV++ K +G+P ITKDGVSVAK+++L + IENMGAQLVK+VASKTAD+AGDGTTTATVL   +F  GL+NV +GANP+++KRG+DK V+AI+ +L   SKKI+  +EI QVATISAN+D +IG++IA+AM+KVG DGVITVEEAKG   E+  VEGMQFDRGY+SPYFVT+T+KM  +L+ PYILI DKKVSS+K++LPILE+++++GRPLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL+ LG AE + IDKDN+T+V G GL+  I  R+++IK+ +E T SDYD++ L+ RLAKL+ GVA++ +GA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+     ++ N      DEK G QI+ +AI SP+  IV NAG +  V++ ++ + T  + G+NA   +Y  M   GIIDP KVTR+AL+NA SV+S+LLTTE V+ D  ++K
  S:     1 MAKQILFDRDAREKLKKGVDALADAVKVTLGPKGRNVILDKKFGSPAITKDGVSVAKDIELKDAIENMGAQLVKEVASKTADQAGDGTTTATVLTQAIFNAGLKNVAAGANPMDLKRGIDKAVSAIIADLKVQSKKISNSNEIAQVATISANNDHEIGKMIAHAMDKVGKDGVITVEEAKGTETEVKTVEGMQFDRGYLSPYFVTNTDKMEVELDRPYILIYDKKVSSMKELLPILEQVVQSGRPLLIIAEDVDGEALATLVVNKIRGALKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEESGYKLENATLEYLGTAEKINIDKDNTTVVNGSGLKDNIVARVNQIKSQMENTTSDYDREKLQERLAKLSGGVAIMYIGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALIRAGAALD-NVAFHNEDEKTGIQIIRTAIESPLRAIVYNAGLEGSVIVQKVKEGTGDY-GYNAREDRYEAMIAAGIIDPTKVTRLALENAASVASLLLTTECVVADEPEEK 527
>gi|138893899|ref|YP_001124352.1| chaperonin GroEL [Geobacillus thermodenitrificans NG80-2] >gi|196251098|ref|ZP_03149778.1| chaperonin GroEL [Geobacillus sp. G11MC16] >gi|166198462|sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|134265412|gb|ABO65607.1| GroEL [Geobacillus thermodenitrificans NG80-2] >gi|196209392|gb|EDY04171.1| chaperonin GroEL [Geobacillus sp. G11MC16] (540 aa)
Score = 1433, Expect = 1.8e-156, Identities = 320/545 (58%), Positives = 423/545 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I+RG++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SPY +TDT KM A LENPYILITDKKVS+I+++LP+LE++++ GRPLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+ +TIV+G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G +I E LK     +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M+LTTEAV+ D  +++K  + P MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSNIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSTTVASLGRASKVVVTKETTTIVEGAGDSERIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNVYSK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSIIVERLKNEKAGIGFNAATGEWVDMIEEGIVDPTKVTRSALQNAASVAAMVLTTEAVVADKPEENKGGANPGMPD--MGGMM 540
>gi|83591502|ref|YP_425254.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170] >gi|119366187|sp|Q2RY28|CH601_RHORT 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|83574416|gb|ABC20967.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170] (543 aa)
Score = 1433, Expect = 1.8e-156, Identities = 309/543 (56%), Positives = 421/543 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP-NMGMGGM 544
           AK++KFS  AR++L  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASK+AD AGDGTTTATVLA  + +EG + V +G NP+++KRG+D  V A+V ++   S+KIA  DEI QV TISAN D+++G++IA AM+KVG +GVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT+  KM+A LENPYILI +KK+S ++ +LP+LE ++++GRPLLIIA+DV+GEAL TLVVN++RG   V +VKAP FGD+RK +LEDIAILTGG  +++DLGI  + VTL  LG A++V I KDN+TIV G G+++ I  R ++I+  IE T SDYD++ L+ RLAKL+ GVAVI+VG  SEVE+KEKKDRVDDA+ AT+AA+EEGI+ GGG AL+H +K ++  +     D+K+G +IV  A+ +P+ QI  NAG D  VV  ++L++++   G+NA TG Y ++ + G+IDP KV R ALQ A SV+S+L+TTEA++ ++ + K    PA+P   GMG M
  S:     3 AKDVKFSSDARDRLLRGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELKDKFENMGAQMLREVASKSADVAGDGTTTATVLAQAIVREGSKAVAAGMNPMDLKRGIDLAVAAVVKDVKTRSRKIATNDEIAQVGTISANGDEEVGKIIARAMDKVGHEGVITVEEAKGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILIHEKKLSGLQPLLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNRLRGGLKVASVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLETVTLDMLGTAKTVTITKDNTTIVDGAGVKADIDARCAQIRATIEDTTSDYDREKLQERLAKLSGGVAVIRVGGASEVEVKEKKDRVDDAMHATRAAVEEGIIAGGGVALLHAAKALDALS-PANADQKVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLESSDADFGYNAQTGVYENLVKVGVIDPTKVVRTALQGAASVASLLITTEAMVAEIPEKK----PALPAGGGMGDM 541
>gi|25012067|ref|NP_736462.1| chaperonin GroEL [Streptococcus agalactiae NEM316] >gi|29839302|sp|Q8CX22|CH60_STRA3 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|24413610|emb|CAD47688.1| chaperonin GroEL [Streptococcus agalactiae NEM316] (540 aa)
Score = 1431, Expect = 2.4e-156, Identities = 318/543 (58%), Positives = 421/543 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V+A V EL + ++ ++ K+ I QVA +S+ S+K +GE I+ AM +VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+++LENPYILITDKK+S+I++ILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ VT+DLG+     T+Q LGQ+  V +DKD++ IV+G G  S I  R++ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L L GDE+ G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++VDM  TGIIDPVKVTR ALQNA SV+S++LTTEAV+ +  + +  + PAM    MGG
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVSAAVEELKEIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMGRVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNIQEILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVVTEDLGLDLKDATMQVLGQSAKVTVDKDSTVIVEGAGDSSAIANRVAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVNVIEK--VAALKLNGDEETGRNIVLRALEEPVRQIAYNAGYEGSVII-ERLKQSEIGTGFNAANGEWVDMVTTGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPEAPTAPAMDPSMMGG 539
>gi|25452879|sp|Q9AME7|CH60_STRAG 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|13123671|gb|AAK12938.1| 60kDa chaperonin [Streptococcus agalactiae] (540 aa)
Score = 1431, Expect = 2.5e-156, Identities = 319/543 (58%), Positives = 420/543 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS  AR+ +  GV  L D V VT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V+A V EL + ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+++LENPYILITDKK+S+I++ILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ VT+DLG+     T+Q LGQ+  V +DKD++ IV+G G  S I  R++ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L L GDE+ G  IV+ A+  P+ QI  NAG+ KG VI   LK +    GFNAA G++VDM  TGIIDPVKVTR ALQNA SV+S++LTTEAV+ +  + +  + PAM    MGG
  S:     1 MAKDIKFSADARSAMVRGVDILADTVFVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLPQAIVREGLKNVTAGANPIGIRRGIETAVSAAVEELKEIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVSELENPYILITDKKISNIQEILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVVTEDLGLDLKDATMQVLGQSAKVTVDKDSTVIVEGAGDSSAIANRVAIIKSQMEATTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALVNVIEK--VAALKLNGDEETGRNIVLRALEEPVRQIAYNAGY-KGSVIIARLKQSEIGTGFNAANGEWVDMVTTGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPEAPTAPAMDPSMMGG 539
>gi|12006268|gb|AAG44815.1|AF274871_2 GroEL [Geobacillus stearothermophilus] (539 aa)
Score = 1431, Expect = 2.7e-156, Identities = 318/545 (58%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TDT KM A LENPYILITDKK+S+I+D+LPILE++++ G+PLLIIA+DV+GEAL TLVVNK+RG F  VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+N+TIV+G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL +T+AA+EEGIV GGG AL++V  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G VI E LK   P +GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +     MP+  MGGMM
  S:     1 MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVVEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIQGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDLLPILEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRASKVVVTKENTTIVEGAGDSDRIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALDSTRAAVEEGIVAGGGTALMNVYSK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSVIVERLKTEKPGIGFNAATGEWVNMIEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENKGGNNGMPD--MGGMM 539
>gi|56418784|ref|YP_146102.1| chaperonin GroEL [Geobacillus kaustophilus HTA426] >gi|68566258|sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|56378626|dbj|BAD74534.1| chaperonin (GroEL protein) [Geobacillus kaustophilus HTA426] (538 aa)
Score = 1431, Expect = 2.9e-156, Identities = 319/545 (58%), Positives = 421/545 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I+RG++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SPY +TDT KM A LENPYILITDKKVSSI+++LP+LE++++ GRPLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+ +TIV+G G   +IK RI++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL+++  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G +I E LK   P +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M+LTTEAV+ D K ++      MP+  MGGMM
  S:     1 MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRAAKVVVTKETTTIVEGAGDSERIKARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALMNIYNK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSIIVERLKNEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEAVVAD-KPEENKGNNNMPD--MGGMM 538
>gi|171911500|ref|ZP_02926970.1| chaperonin GroEL [Verrucomicrobium spinosum DSM 4136] (539 aa)
Score = 1427, Expect = 7.7e-156, Identities = 306/542 (56%), Positives = 408/542 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMG 542
           MAK++ F +SAR  L  GVQ++  AVK T+GP GRNV+++K +G+P ITKDGV+VAKE++L++P ENMGAQLVK+V+SKT+D AGDGTTTATVLA  ++ EGLRNV +GANP  ++RG+ K   AIV +L + S+ +    EI QVAT+SAN D +IG +IA+AM+KVG DG ITVEEAK I   L VVEGMQFD+GY+SPYFVTD   M A LEN  ILI +KK+S++KD+LP+LE++ +TGRPLLIIA+DV+GEAL TLVVN++RG  N+ AVKAP FGD+RK +LEDIAILTGG  +T+DLG+  + + L DLG+A+ V IDK+N+TIV+G+G    I  R+++I+  I+ T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG AL+     +    L L GDE  G  IV  AI +P+ Q+ +NAG +  +++ E+ K +  + G+N ATG+YVD+ + G++DP KVTR ALQNA S+S +LLTTE +I D+  + E + PA  + GMG
  S:     1 MAKQLNFDESARQALLRGVQKIARAVKATLGPSGRNVILEKKFGSPTITKDGVTVAKEIELSDPYENMGAQLVKEVSSKTSDVAGDGTTTATVLAEAIYSEGLRNVTAGANPTSLQRGILKATEAIVAKLKEISQPVTNATEIAQVATVSANWDTEIGNIIADAMDKVGKDGTITVEEAKSIETSLDVVEGMQFDKGYLSPYFVTDAESMEAVLENALILIHEKKISNLKDLLPLLEKVARTGRPLLIIAEDVEGEALATLVVNRLRGTLNICAVKAPGFGDRRKAMLEDIAILTGGRCITEDLGLKLENLELTDLGRAKRVTIDKENTTIVEGEGGSEAIAGRVNQIRRQIDETTSDYDREKLQERLAKLAGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRAQAAL--AELQLTGDEATGADIVRRAIEAPLRQLAANAGLEGALIVAEVKKGSG-NSGYNVATGEYVDLIKAGVVDPTKVTRSALQNAASISGLLLTTECLISDIPKE-EKAEPAHDHGGMG 538
>gi|167404952|ref|ZP_02309722.1| chaperonin GroEL [Listeria monocytogenes FSL J2-003] (574 aa)
Score = 1427, Expect = 8.3e-156, Identities = 310/543 (57%), Positives = 416/543 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGG 543
           MAK+IKFS+ AR  +  GV QL +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ ++RG++K V   + EL   SK I  K+ I QVA IS+  D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE PYILITDKK+++I++ILP+LE++++ GRP+LIIA+DV+GEA  TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T+DLG+     T+  LG A  VV+ KD++TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV +  +  V  L   GD + G  IV+ ++  P+ QI  NAG + G VI E LK     +GFNAA G++V+M   GI+DP KVTR ALQNA SV+++LLTTEAV+ D  D  E+   A+P+MGMGG
  S:     1 MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISS-GDEEVGKLIAEAMERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQISARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNK--VAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE-GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADKPD--ENGPAAVPDMGMGG 537
>gi|42518557|ref|NP_964487.1| chaperonin GroEL [Lactobacillus johnsonii NCC 533] >gi|45645206|sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|41582842|gb|AAS08453.1| 60 kDa chaperonin GroEL [Lactobacillus johnsonii NCC 533] (543 aa)
Score = 1427, Expect = 8.9e-156, Identities = 317/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS++AR+ L  GV +L D VK T+GP+GRNV+++KSYGAP IT DGV++AK ++L N  ENMGA+LV + A KT D AGDGTTTATVL   + +EG++NV +GANP+ I+RG++    A V+EL+K S K++ KDEI QVA++S+ S  ++G LIA+AMEKVG DGVIT+EE+KGI+ EL+VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+S+I+DILP+L+EI++ G+ LLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ ++ DLG+      +  LG+A  V + KD++TIV+G G +  I ER+ +IK  I  T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV V K I         D + G +IVM A+ +P+ QI  NAG D G VI + L+  +P +G+NAAT K+ +M + GIIDP KVTR ALQNA S++++LLTTEAV+ D  +D ++  PA PN GMG  M
  S:     1 MAKEIKFSENARHSLLKGVDKLADTVKTTLGPKGRNVVLEKSYGAPDITNDGVTIAKSIELENHFENMGAKLVSEAAQKTNDIAGDGTTTATVLTQAIVREGMKNVTAGANPVGIRRGIETATKAAVDELHKISHKVSTKDEIAQVASVSSAS-TEVGNLIADAMEKVGHDGVITIEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDILPLLQEIVQQGKSLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVISSDLGLELKDTKIDQLGKAGKVTVTKDSTTIVEGAGSKEAIAERVDQIKKQIADTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGYVAGGGTALVDVMKSIQGTVKGDSEDAETGVKIVMKALGAPVRQIAENAGKD-GAVILDHLEHEDPEVGYNAATNKWENMVKAGIIDPTKVTRSALQNAASIAALLLTTEAVVADAPEDDKNQAPAAPNPGMGMGM 543
>gi|116629080|ref|YP_814252.1| chaperonin GroEL [Lactobacillus gasseri ATCC 33323] >gi|122273922|sp|Q045Q8|CH60_LACGA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116094662|gb|ABJ59814.1| Chaperonin GroEL (HSP60 family) [Lactobacillus gasseri ATCC 33323] (543 aa)
Score = 1425, Expect = 1.3e-155, Identities = 317/545 (58%), Positives = 414/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS++AR  L  GV +L D VK T+GP+GRNV+++KSYGAP IT DGV++AK +DL +  ENMGA+LV + A KT D AGDGTTTATVL   + +EG++NV +GANP+ I+RG++    A V+EL+K S K++ KDEI QVA++S+ S  ++G LIA+AMEKVG DGVIT+EE+KGI+ EL+VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+S+I+DILP+L+EI++ G+ LLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ ++ DLG+      +  LG+A  V + KD++TIV+G G +  I ER+ +IK  I  T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV V K I  N      D + G  IVM A+ +P+ QI  NAG D G VI + L+  +P +G+NAAT K+ +M + GIIDP KVTR ALQNA S++++LLTTEAV+ D  +D ++  PA PN GMG  M
  S:     1 MAKDIKFSENARRSLLKGVDKLADTVKTTLGPKGRNVVLEKSYGAPDITNDGVTIAKSIDLKDHFENMGAKLVSEAAQKTNDIAGDGTTTATVLTQAIVREGMKNVTAGANPVGIRRGIETATKAAVDELHKISHKVSTKDEIAQVASVSSAS-TEVGNLIADAMEKVGHDGVITIEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDILPLLQEIVQQGKSLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVISSDLGLELKDTKIDQLGKAGKVTVTKDSTTIVEGAGSKDAISERVDQIKKQIADTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGYVAGGGTALVDVMKSIQGNVKGDSQDAQTGVNIVMKALGAPVRQIAENAGKD-GAVILDHLEHEDPEIGYNAATDKWENMVKAGIIDPTKVTRSALQNAASIAALLLTTEAVVADAPEDDKNQAPAAPNPGMGMGM 543
>gi|153890394|ref|ZP_02011476.1| chaperonin GroEL [Opitutaceae bacterium TAV2] >gi|151583535|gb|EDN47006.1| chaperonin GroEL [Opitutaceae bacterium TAV2] (543 aa)
Score = 1425, Expect = 1.6e-155, Identities = 307/529 (58%), Positives = 411/529 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           AK++ F ++AR K+  GV+ L  AVKVT+GP+GRNV++ K +G+P +TKDGV+VAKEV+L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  V+KEGL++V +GANPI +KRG+DK V A V +L K+SKK+  ++EI QVAT+SAN D  IGE+IA+AM+KVG DG ITVEEAK I   L VVEGMQFD+GY+SPYF T+   + A LE+ Y+LI +KK+SS+ ++LP+L+ + KTG+PLLIIA+DV+GEAL  LVVNK+RGV NV AVKAP FGD+RK +LEDIA+LTGG  +T+DLGI  + VT+ DLG+ + VVIDK+N+TIV+G G  S I+ R+ +I+  I+ T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG AL+  +K I+     L GDEK+G  I+  A+ +P+ Q+V+NAG +  VV+ ++L +   + G+N ATG+Y D+ + G++DP KVTRIALQNA S++ +LLTTEA+I D  +DK+
  S:     3 AKQLIFEEAARQKILRGVEILARAVKVTLGPKGRNVVLDKKFGSPTVTKDGVTVAKEVELPDAYENIGAQLVKEVASKTNDSAGDGTTTATVLAEAVYKEGLKHVTAGANPIYLKRGIDKAVEAAVADLAKASKKVNNREEIRQVATVSANWDTTIGEIIADAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYLSPYFATNQESLEAVLEDAYVLIHEKKISSLNELLPLLQAVSKTGKPLLIIAEDVEGEALAALVVNKIRGVLNVCAVKAPGFGDRRKAMLEDIAVLTGGKLLTEDLGIKLENVTVADLGKVKRVVIDKENTTIVEGSGKSSDIQGRVKQIRRQIDETTSDYDREKLQERLAKLAGGVAVINVGAATESEMKEKKQRVEDALHATRAAVEEGIVSGGGVALLRTAKAIDAAIATLEGDEKLGASIIRRAVEAPLKQLVANAGIEGAVVVQQVLSSKGAN-GYNVATGQYEDLVKAGVVDPTKVTRIALQNAASIAGLLLTTEAIITDAPEDKK 530
>gi|8489169|gb|AAF75593.1|AF214488_3 GroEL [Lactobacillus johnsonii] (543 aa)
Score = 1423, Expect = 2.6e-155, Identities = 316/545 (57%), Positives = 414/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKEIKFS++AR+ L  GV +L D VK T+GP+GRNV+++KSYGAP IT DGV++AK ++L N  ENMGA+LV + A KT D AGDGTTTATVL   + +EG++NV +GANP+ I+RG++    A V+EL+K S K++ KDEI QVA++S+ S  ++G LI +AMEKVG DGVIT+EE+KGI+ EL+VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+S+I+DILP+L+EI++ G+ LLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ ++ DLG+      +  LG+A  V + KD++TIV+G G +  I ER+ +IK  I  T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV V K I         D + G +IVM A+ +P+ QI  NAG D G VI + L+  +P +G+NAAT K+ +M + GIIDP KVTR ALQNA S++++LLTTEAV+ D  +D ++  PA PN GMG  M
  S:     1 MAKEIKFSENARHSLLKGVDKLADTVKTTLGPKGRNVVLEKSYGAPDITNDGVTIAKSIELENHFENMGAKLVSEAAQKTNDIAGDGTTTATVLTQAIVREGMKNVTAGANPVGIRRGIETATKAAVDELHKISHKVSTKDEIAQVASVSSAS-TEVGNLIRDAMEKVGHDGVITIEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDILPLLQEIVQQGKSLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVISSDLGLELKDTKIDQLGKAGKVTVTKDSTTIVEGAGSKEAIAERVDQIKKQIADTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGYVAGGGTALVDVMKSIQGTVKGDSEDAETGVKIVMKALGAPVRQIAENAGKD-GAVILDHLEHEDPEVGYNAATNKWENMVKAGIIDPTKVTRSALQNAASIAALLLTTEAVVADAPEDDKNQAPAAPNPGMGMGM 543
>gi|148254475|ref|YP_001239060.1| chaperonin GroEL [Bradyrhizobium sp. BTAi1] >gi|187470725|sp|A5EG60|CH603_BRASB 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|146406648|gb|ABQ35154.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Bradyrhizobium sp. BTAi1] (540 aa)
Score = 1419, Expect = 6.5e-155, Identities = 312/538 (57%), Positives = 416/538 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AK++KFS  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKTAD AGDGTTTATVLA  + KEG ++V +G NP+++KRG+D  V+AIV +L   +KKI   DEI QV TISAN D +IG  +A AM+KVG++GVITVEEAK ++ EL VVEGMQFDRGY+SPYFVT++ KM  +LE+PYILI +KK+S ++ +LP+LE ++++G+PLLI+A+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ VVIDK+N+TIV G G +  I+ R  +IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGI+ GGG AL+  +K ++ V T N   D+K G  I+  AI  P+ QIV NAG D  +V+ ++L+      GFNAATG+Y D+ Q G+IDP KV R ALQ+A SV+S+L+TTEA++ D K  K ++  A P M
  S:     3 AKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVDAIVADLKAHAKKITSNDEIAQVGTISANGDNEIGRFLAEAMQKVGNEGVITVEEAKSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAVVQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTTISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIKLQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALLRATKVLDGVKTAN--ADQKAGVDIIRRAIQVPVRQIVQNAGEDGSLVVGKLLEKDTYSWGFNAATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVAD-KPKKAEATQAAPAM 538
>gi|94968126|ref|YP_590174.1| chaperonin GroEL [Acidobacteria bacterium Ellin345] >gi|118597105|sp|Q1ISQ0|CH60_ACIBL 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|94550176|gb|ABF40100.1| chaperonin GroEL [Acidobacteria bacterium Ellin345] (553 aa)
Score = 1419, Expect = 6.8e-155, Identities = 314/535 (58%), Positives = 415/535 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTV-----------NAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           MAK+I   + +R  +  GV  L DAVKVT+GP+GRNV+I K +G+P+ITKDGV+VAKE++L + +ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG++NV +G+NP+ +KRG+DK V           N I   L+K SK +   + I QV TISAN+D+ IG++IA AM+KVG DGVITVEE+K +  +L VVEGMQFDRGY+SPYFVTD  +M A LENPYILI +KKVSS+KD+LP+LE+I K GRPL+IIA+DV+GEAL TLVVNK+RG  NV AVKAP FGD+RK +L+DIAILTGG  +T+DLGI  + V + DLG A+ V IDKDN+TIV+GKG  S I+ R+ +I++ +E T SDYD++ L+ RLAKL  GVAVIKVGA +E E+KEKK RV+DA+ AT+AA+EEGIV GGG AL+   +   V+ L L GDE IG  I+  A+  P+ QIV NAG +  +V+ +I    +PH G+NA T +YVD+ + G+IDP KVTR ALQNA S++ ++LTTEA+I ++ ++K+ S PA
  S:     1 MAKQIVHGEESRQSILRGVNVLADAVKVTLGPKGRNVVIDKKFGSPLITKDGVTVAKEIELKDTLENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGVKNVAAGSNPMALKRGIDKAVTAVCGYNDAEGNRIPGALDKFSKPVT-GEMIAQVGTISANNDETIGKIIAEAMKKVGKDGVITVEESKTMETQLEVVEGMQFDRGYLSPYFVTDPERMEAVLENPYILIHEKKVSSMKDLLPLLEQIAKGGRPLVIIAEDVEGEALATLVVNKLRGTLNVAAVKAPGFGDRRKAMLQDIAILTGGKAITEDLGIKLENVHMDDLGSAKKVTIDKDNTTIVEGKGKSSDIEGRVKEIRSQVEKTTSDYDREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDAMHATRAAVEEGIVPGGGVALIRCVEA--VDALKLTGDEGIGANIIKRALEEPLRQIVGNAGEEGAIVVGKIRDHKDPHYGYNAQTSEYVDLVKAGVIDPTKVTRTALQNAGSIAGLMLTTEALISEIPEEKK-SEPA 542
>gi|150019962|ref|YP_001305316.1| chaperonin GroEL [Thermosipho melanesiensis BI429] >gi|166201759|sp|A6LJ30|CH60_THEM4 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|149792483|gb|ABR29931.1| chaperonin GroEL [Thermosipho melanesiensis BI429] (539 aa)
Score = 1419, Expect = 7.1e-155, Identities = 307/537 (57%), Positives = 415/537 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS-VPAMP 537
           MAK ++FS+ AR  L  GV  + DAVK+T+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  + KEG++NV +GANPI +KRG+DK V A V ++   SKK++  D+I  VA+ISANS++ IG+LIA AMEKVG DGVITVE++K I+  +   EGMQFDRGYISPYFVTD  KM      P+ILITD+K+S+IK ++PILE++ +TG+PL+IIA+DV+GEALTTLV+NK++G  N VAVKAP FGD+RK +L+DIAILTGG   ++++GI+ + +TL DLG+A+ V + KD + IV G G + +IK+RI++IK  IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEKIG +IV  A+ +PI+QI  NAG+D  ++I+++L+  +P  GF+A  G+Y DMF+ GIIDP KVTR ALQNA S++ MLLTTE ++ +  + K ++ +P MP
  S:     1 MAKMLRFSEEARRALERGVDAVADAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGIKNVTAGANPILVKRGIDKAVAAAVEKIKDISKKLSNSDDIAHVASISANSEE-IGKLIAEAMEKVGEDGVITVEDSKSIDTFVEFTEGMQFDRGYISPYFVTDPEKMEVVYNEPFILITDRKLSNIKPLIPILEKVAQTGKPLVIIAEDVEGEALTTLVLNKLKGTLNTVAVKAPGFGDRRKAMLQDIAILTGGIVASEEVGINLEDLTLNDLGRADVVRVKKDETIIVGGHGDQEEIKKRIAQIKAQIEQTTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGITLLRARKPVEKIVEELDGDEKIGAKIVYEALSAPINQIAKNAGYDGAIIIHKVLEQDDPAYGFDALKGEYCDMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEPKNNNPMPEMP 537
>gi|25452894|sp|Q9WWL4|CH60_METSS 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|4929776|gb|AAD34149.1|AF152236_2 chaperonin GroEL [Methylovorus sp. SS1] (540 aa)
Score = 1419, Expect = 7.8e-155, Identities = 304/539 (56%), Positives = 415/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AKE+KF D AR ++  GV  L DAVKVT+ PR    LI++S+GAPVITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V++G NP+++KRG+DK V  +V+EL+K SK I    EI QV +ISANSD  IG++IA+AM+KVG +GVITVE+ K +++EL VVEGMQFDRGY+SPYF+ +  K   + ++P IL+ DKK+SSI+D+LP LE + K G+PLLIIA+D++GEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G   +K +L+DLG+A+ V + K+N+ I+ G G +  I+ R+  I+  I+ + SDYD++ L+ R+AKL+ GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+    RI VN     GD+  G +IV+ AI +P+  I +NAG +  VVIN++L A + + G+NAATG+Y D+ +TG++DP KVTR ALQNA SV+S++LTT+A I ++  +++ +VPAMP+MG
  S:     3 AKEVKFHDHARTRIVQGVNVLADAVKVTLAPRAVMCLIERSFGAPVITKDGVSVAKEIELQDKFENMGAQMVKQVASKTADIAGDGTTTATVLAQAIVQEGMKHVVAGVNPMDLKRGIDKAVATVVDELHKLSKPITTNKEIAQVGSISANSDHPIGKIIADAMDKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNPEKQTVEFDDPLILLYDKKISSIRDLLPTLENVAKAGKPLLIIAEDLEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEETGKQLEKASLEDLGRAKRVELQKENTIIIDGAGEQKAIEARVKAIQAQIDESTSDYDREKLQERVAKLSGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRARSRI-VNLKGDNGDQDAGIRIVLRAIEAPLRAIAANAGDEPSVVINKVL-AGSGNFGYNAATGEYADLVETGVVDPTKVTRTALQNAASVASLILTTDASIAELPKEEKAAVPAMPDMG 539
>gi|29377118|ref|NP_816272.1| chaperonin, 60 kDa [Enterococcus faecalis V583] >gi|30179852|sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|29344584|gb|AAO82342.1| chaperonin, 60 kDa [Enterococcus faecalis V583] (541 aa)
Score = 1418, Expect = 9.1e-155, Identities = 321/545 (58%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM-PNMGMGGMM 545
           MAKEIKF++ AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++      V EL+  S  +  K+ I QVA +S+ S+K +G+LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I  R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V  L   GD   G +IV+ A+  PI QI  NAG++  V++++ LK  +  +GFNAA G++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D K +     P M P+MGMGGMM
  S:     1 MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKTAVEELHNISSVVDSKEAIAQVAAVSSGSEK-VGQLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVIGK--VAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVDLGIGFNAANGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD-KPEPAAPAPMMDPSMGMGGMM 541
>gi|27380338|ref|NP_771867.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110] >gi|2829663|sp|P77829|CH601_BRAJA 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|1613782|gb|AAC44753.1| heat shock protein GroEL >gi|27353502|dbj|BAC50492.1| heat shock protein [Bradyrhizobium japonicum USDA 110] (540 aa)
Score = 1418, Expect = 9.1e-155, Identities = 307/538 (57%), Positives = 420/538 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AKE+KFS  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG ++V +G NP+++KRG+D  V AIVN+L   +KK+   +EI Q+ATISAN D +IG  +A+AM+KVG+DGVITVEEAK ++ EL VVEGMQFDRGY SPYFVT+  KM  + E+PYILI +KK+S+++ +LP+LE ++++G+PLL++A+DV+GEAL TLVVN++RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + VTL+ LG+A+ VVIDK+N+TIV G G +  I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEGI+ GGG AL+   K ++ + T+N   D+K G  IV  AI  P  QIV NAG D  +V+ ++L+ ++ + GFNAA+G+Y D+ + G+IDP KV R ALQ+A SV+++L+TTEA+I + K  K +  PA P M
  S:     3 AKEVKFSTDARDRVLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVEAIVNDLKAHAKKVTTNEEIAQIATISANGDIEIGRFLADAMQKVGNDGVITVEEAKSLDTELEVVEGMQFDRGYASPYFVTNAEKMRVEFEDPYILIHEKKLSTLQSMLPLLEAVVQSGKPLLVVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQAISEDLGIKLENVTLKMLGRAKKVVIDKENTTIVNGAGSKKDIEARVTQIKMQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRGLKALDAIKTVN--ADQKAGVDIVRRAIQVPARQIVQNAGEDGSLVVGKLLENSSYNWGFNAASGEYQDLAKAGVIDPAKVVRTALQDAASVAALLITTEALIAE-KPKKSEPAPAAPPM 538
>gi|83945762|ref|ZP_00958106.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633] >gi|83850852|gb|EAP88713.1| chaperonin GroEL [Oceanicaulis alexandrii HTCC2633] (546 aa)
Score = 1417, Expect = 1.0e-154, Identities = 311/537 (57%), Positives = 419/537 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK++KF  SAR K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP  TKDGVSVAKE++L +  ENMGAQ+V++VAS+T DEAGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V  ++ +L  ++  I    E+ QV TISAN +K+IGE+IANAMEKVG++GVITVEEAK +  EL VVEGMQFDRGY+SPYFVTD+ KMIA LE+PYIL+ +KK+SS++ +LP+LE ++++ RPLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIA+LTGG  V++DLGI  + VTL  LG A+ V I KD++TIV G G +  I+ R+++I+  IE T SDYDK+ L+ RLAKL  GVAVIKVG  SE+E+KE+KDRVDDAL+AT+AA+EEGIV GGG AL+  +K ++  T +   D+  G  IV  A+ +PI QIV NAG +  +V+ ++L+  +P+ G+NA TG+Y D+ ++G+IDPVKV+RIALQ+A SV+S+L+TTEA I + K  K+   PA P+
  S:     3 AKDVKFGASAREKMLKGVDILADAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELEDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGIDKAVALVIEQLKSTATPIKGSSEVAQVGTISANGEKEIGEMIANAMEKVGNEGVITVEEAKSLATELDVVEGMQFDRGYLSPYFVTDSEKMIADLEDPYILLFEKKLSSLQPMLPVLEAVVQSNRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGQVVSEDLGIKLENVTLDMLGTAKKVSITKDDTTIVDGAGEKEAIEGRVNQIRRQIEDTSSDYDKEKLQERLAKLAGGVAVIKVGGASEIEVKERKDRVDDALNATRAAVEEGIVPGGGIALLKATKALDGVTGD-NEDQNQGIAIVARALQAPIRQIVENAGSEGSIVVGKVLENKDPNFGYNAQTGEYEDLVKSGVIDPVKVSRIALQDAASVASLLITTEAAIAE-KPKKDGGAPAAPD 537
>gi|70780035|gb|AAZ08341.1| GroEL [Streptococcus sobrinus] (525 aa)
Score = 1417, Expect = 1.1e-154, Identities = 311/524 (59%), Positives = 412/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG+++ V+  V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     ++  LGQA  + IDKD++ IV+G G    I ER++ IK+ +E T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L+L GD+  G  IV+ A+  P+ QI  NAG++  V+I E LKA+    GFNAA G +VDM + GIIDPVKV+R ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIERAVSTAVDELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMATELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQDVLPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKNASIASLGQAAKITIDKDSTVIVEGAGSADAIAERVAVIKSQLESTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIEK--VTALDLAGDQATGRNIVLRALEEPVRQIARNAGYEGSVII-EKLKASKSGTGFNAADGSWVDMVEAGIIDPVKVSRSALQNAASVASLILTTEAVVAD 520
>gi|13472184|ref|NP_103751.1| chaperonin GroEL [Mesorhizobium loti MAFF303099] >gi|25452874|sp|Q98IH9|CH602_RHILO 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|14022929|dbj|BAB49537.1| heat shock protein GroEL [Mesorhizobium loti MAFF303099] (542 aa)
Score = 1417, Expect = 1.2e-154, Identities = 308/540 (57%), Positives = 416/540 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AKE+KF   AR K+  GV  L DAVKVT+GP+GRNV+I KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+DK V AIV EL  +++K+ R DEI QV TISAN D +IG  +A AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+ +KM  +LE PY+LI +KK+S+++ +LP+LE ++++ +PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL+ LG+A+ VVI+K+N+TIV G G + +I+ R+S+IK+ IE T SDYDK+ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEG++ GGG AL+  +K ++ V   N   D+K G +IV  AI +P+ QI  NAG +  +++ ++ +      G+NA T  + D++  G+IDPVKV R ALQ+A SV+ +L+TTEA++ + K  KE +VPAMP  GM
  S:     3 AKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVSQIKSQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALLRAAKALDSVQAEN--EDQKHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKPEFGWGWNAQTNAFGDLYNEGVIDPVKVVRTALQDAASVAGLLVTTEAMVAE-KPKKEPAVPAMPAGGM 540
>gi|188996527|ref|YP_001930778.1| chaperonin GroEL [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931594|gb|ACD66224.1| chaperonin GroEL [Sulfurihydrogenibium sp. YO3AOP1] (544 aa)
Score = 1416, Expect = 1.5e-154, Identities = 315/533 (59%), Positives = 410/533 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK++ + D AR KL  GV +L +AVKVT+GPRGR V+++K +G+PV+TKDGVSVAKE++LT+P ENM AQLVK+VASKTAD AGDGTTTATVL   +++EGL+ + SGANPI +KRG+D+ V  IV EL K SK +  + EI QVATISAN+D +IG++IA+AMEKVG DGVITVEE+K     L V EGMQFDRGY+SPYFVT+  KM A LENPYILI +KKV +I+++LP+LE++++T +PLLIIA+DV+GEAL TLVVN ++GV  V AVKAP FG++RK +L+DIAILTGG+ +T+DLGI  + V L  LG+A+ VV+DKDN+TI+ GKG    IK RI +IK  IE T S+YDK+ L+ RLAKL  GVA+IKVGA +E ELKEKKDRVDDA+ ATKAA+EEGIV GGG A+   S+ + N+   N   D+  G +IV +A   P+ QI  NAGF+  V+I +I    N + GF+AATG+YVDM + GIIDP KV R ALQNA S++  +LT E ++ ++K +KE+ +P
  S:     3 AKKLVYGDEARAKLKAGVDKLANAVKVTLGPRGREVILEKKWGSPVVTKDGVSVAKEIELTDPYENMAAQLVKEVASKTADVAGDGTTTATVLTQAIYEEGLKAIASGANPIYVKRGIDEAVKIIVEELKKISKPVTGRKEIEQVATISANNDPEIGKIIADAMEKVGKDGVITVEESKSAETVLEVTEGMQFDRGYLSPYFVTNAEKMEAVLENPYILIYEKKVGNIRELLPVLEKVVQTNKPLLIIAEDVEGEALATLVVNHIKGVLRVCAVKAPGFGERRKAMLQDIAILTGGTAITEDLGIKLESVDLDMLGKADKVVVDKDNTTIIGGKGNPEDIKARIEQIKKQIETTTSEYDKEKLQERLAKLAGGVAIIKVGAATEAELKEKKDRVDDAVHATKAAVEEGIVPGGGIAIFRASRALCNIKEENT--DKAWGIKIVKNACKVPLKQIAYNAGFEGSVIIEKIKDVDNVNYGFDAATGEYVDMVEAGIIDPTKVVRTALQNAASIAGTMLTAECLVAEIK-EKEEKLP 533
>gi|110635424|ref|YP_675632.1| chaperonin GroEL [Mesorhizobium sp. BNC1] >gi|118597097|sp|Q11DQ8|CH602_MESSB 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|110286408|gb|ABG64467.1| chaperonin GroEL [Mesorhizobium sp. BNC1] (542 aa)
Score = 1415, Expect = 1.8e-154, Identities = 301/536 (56%), Positives = 414/536 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AK++KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVL   + KEG + V SG NP+++KRG+DK V AIV EL K+++K+ + DEI QV TISAN D++IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+  KM  +L+ PY+LI +KK++S++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DIAILTGG+ +++DLGI  + VTL+ LG+A+ VVI+K+N+TIV G G + +I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEG++ GGG AL+  +K ++ N      D+K+G  IV  AI +PI QI  NAG +  +++  + +  +   G+NA TG+Y D++Q G+IDPVKV R ALQ+A SV+ +L+TTEA++ D    K+++ PAMP
  S:     3 AKDVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDAAGDGTTTATVLTQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVEELKKNARKVTKNDEIAQVGTISANGDQEIGRFLAQAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQEKMRVELDEPYLLIHEKKLASLQPLLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTAISEDLGIKLENVTLEMLGRAKKVVIEKENTTIVDGAGSKDEIQGRVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGLLPGGGVALLRAAKALD-NVTGENEDQKVGISIVRRAIEAPIRQIAENAGAEGSIIVGRVREKPDFGYGWNAQTGEYGDLYQMGVIDPVKVVRAALQDAASVAGLLITTEAMVAD--RPKKETAPAMP 535
>gi|83855555|ref|ZP_00949084.1| chaperonin GroEL [Croceibacter atlanticus HTCC2559] >gi|83849355|gb|EAP87223.1| chaperonin GroEL [Croceibacter atlanticus HTCC2559] (544 aa)
Score = 1415, Expect = 1.8e-154, Identities = 320/528 (60%), Positives = 409/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF  +AR+ +  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EGL+NV +GANP+++KRG+DK V A+  +L K SK++    E I QVA+ISAN+D +IGELIA A  KVG +GVITVEEAKG +  + VVEGMQFDRG++SPYFVTD+ KM   LENPYIL+ DKKVSS+KD+LP+LE + +TG+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG  ++++ G + +  T++ LG AE+V IDKDN+T+V G G +  IK R+++IK+ IE T SDYDK+ L+ RLAKL+ GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   K +   T   + DE  G QIV  AI +P+  IV NAG +  VVIN++L+      G++A T +YVDM + GIIDP KVTRIAL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKDIKFDLAARDGIKRGVDALANAVKVTLGPKGRNVIISKSFGAPQVTKDGVSVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVAEGLKNVAAGANPMDLKRGIDKAVEALTKDLAKQSKEVGNSSEKIKQVASISANNDDQIGELIAQAFGKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGFLSPYFVTDSEKMTTDLENPYILLVDKKVSSMKDLLPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEERGFTLENATIEQLGTAETVTIDKDNTTVVNGSGDKDMIKNRVNQIKSQIETTTSDYDKEKLQERLAKLSGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKKVLEKLTSETL-DETTGIQIVSKAIEAPLRTIVQNAGGEGSVVINKVLEGKK-DFGYDAKTEQYVDMLKAGIIDPKKVTRIALENAASVAGMILTTECALIDIKED 527
>gi|70780026|gb|AAZ08335.1| GroEL [Streptococcus sobrinus] (525 aa)
Score = 1415, Expect = 1.9e-154, Identities = 311/524 (59%), Positives = 412/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG+++ V+  V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     ++  LGQA  + IDKD++ IV+G G    I ER++ IK+ +E T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L+L GD+  G  IV+ A+  P+ QI  NAG++  V+I E LKA+    GFNAA G +VDM + GIIDPVKV+R ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIERAVSTAVDELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMATELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQDVLPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDASIASLGQAAKITIDKDSTVIVEGAGSADAIAERVAVIKSQLESTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIEK--VTALDLAGDQATGRNIVLRALEEPVRQIARNAGYEGSVII-EKLKASKSGTGFNAADGSWVDMVEAGIIDPVKVSRSALQNAASVASLILTTEAVVAD 520
>gi|25452839|sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|21310099|gb|AAM46146.1|AF378196_2 GroEL [Streptococcus constellatus] (540 aa)
Score = 1415, Expect = 1.9e-154, Identities = 320/545 (58%), Positives = 413/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V  L  +S  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE   S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V+V     V  L+L GDE  G  IV+ A+  PI QI  NAGF+  +VI+  LK +    GFNAATG++VDM + GIIDPVKVTR ALQNA SV+S++LTTEAV+   + +     PAM    MGGMM
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVATAVEALKANSVPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENILKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGAAEAIANRVAVIKSQIESATSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVNVLN--TVEALDLSGDEATGRNIVLRALEEPIRQIAINAGFEGSIVIDR-LKNSEVGTGFNAATGEWVDMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVAS-QPEPASPAPAMDPSMMGGMM 540
>gi|149004443|ref|ZP_01829178.1| chaperonin GroEL [Streptococcus pneumoniae SP14-BS69] >gi|147757633|gb|EDK64652.1| chaperonin GroEL [Streptococcus pneumoniae SP14-BS69] (540 aa)
Score = 1414, Expect = 2.6e-154, Identities = 318/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KSEPVAPAPAMDPSMMGGMM 540
>gi|15901732|ref|NP_346336.1| chaperonin GroEL [Streptococcus pneumoniae TIGR4] >gi|15903764|ref|NP_359314.1| chaperonin GroEL [Streptococcus pneumoniae R6] >gi|111657026|ref|ZP_01407826.1| hypothetical protein SpneT_02001740 [Streptococcus pneumoniae TIGR4] >gi|116516636|ref|YP_817135.1| chaperonin GroEL [Streptococcus pneumoniae D39] >gi|148985488|ref|ZP_01818677.1| chaperonin GroEL [Streptococcus pneumoniae SP3-BS71] >gi|148993221|ref|ZP_01822787.1| chaperonin GroEL [Streptococcus pneumoniae SP9-BS68] >gi|148998443|ref|ZP_01825884.1| chaperonin GroEL [Streptococcus pneumoniae SP11-BS70] >gi|149007387|ref|ZP_01831030.1| chaperonin GroEL [Streptococcus pneumoniae SP18-BS74] >gi|149023444|ref|ZP_01836033.1| chaperonin GroEL [Streptococcus pneumoniae SP23-BS72] >gi|168484915|ref|ZP_02709860.1| chaperonin GroL [Streptococcus pneumoniae CDC1873-00] >gi|168487170|ref|ZP_02711678.1| chaperonin GroL [Streptococcus pneumoniae CDC1087-00] >gi|168490106|ref|ZP_02714305.1| chaperonin GroL [Streptococcus pneumoniae SP195] >gi|168494758|ref|ZP_02718901.1| chaperonin GroL [Streptococcus pneumoniae CDC3059-06] >gi|168576685|ref|ZP_02722551.1| chaperonin GroL [Streptococcus pneumoniae MLV-016] >gi|194398217|ref|YP_002038500.1| chaperonin GroL [Streptococcus pneumoniae G54] >gi|122278019|sp|Q04IQ3|CH60_STRP2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|61220901|sp|P0A335|CH60_STRPN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|61220902|sp|P0A336|CH60_STRR6 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|18028147|gb|AAL55997.1|AF325449_1 GroEL [Streptococcus pneumoniae] >gi|14973411|gb|AAK75976.1| chaperonin, 60 kDa [Streptococcus pneumoniae TIGR4] >gi|15459401|gb|AAL00525.1| Chaperonin GroEL [Streptococcus pneumoniae R6] >gi|116077212|gb|ABJ54932.1| chaperonin GroEL [Streptococcus pneumoniae D39] >gi|147755636|gb|EDK62682.1| chaperonin GroEL [Streptococcus pneumoniae SP11-BS70] >gi|147760959|gb|EDK67928.1| chaperonin GroEL [Streptococcus pneumoniae SP18-BS74] >gi|147922208|gb|EDK73329.1| chaperonin GroEL [Streptococcus pneumoniae SP3-BS71] >gi|147928195|gb|EDK79213.1| chaperonin GroEL [Streptococcus pneumoniae SP9-BS68] >gi|147929767|gb|EDK80757.1| chaperonin GroEL [Streptococcus pneumoniae SP23-BS72] >gi|172041934|gb|EDT49980.1| chaperonin GroL [Streptococcus pneumoniae CDC1873-00] >gi|183569951|gb|EDT90479.1| chaperonin GroL [Streptococcus pneumoniae CDC1087-00] >gi|183571543|gb|EDT92071.1| chaperonin GroL [Streptococcus pneumoniae SP195] >gi|183575372|gb|EDT95900.1| chaperonin GroL [Streptococcus pneumoniae CDC3059-06] >gi|183577599|gb|EDT98127.1| chaperonin GroL [Streptococcus pneumoniae MLV-016] >gi|194357884|gb|ACF56332.1| chaperonin GroL [Streptococcus pneumoniae G54] (540 aa)
Score = 1414, Expect = 2.7e-154, Identities = 318/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KPEPVAPAPAMDPSMMGGMM 540
>gi|146339700|ref|YP_001204748.1| chaperonin GroEL [Bradyrhizobium sp. ORS278] >gi|187470736|sp|A4YRI5|CH601_BRASO 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|146192506|emb|CAL76511.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Bradyrhizobium sp. ORS278] (539 aa)
Score = 1414, Expect = 2.8e-154, Identities = 310/535 (57%), Positives = 414/535 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED-SVPAM 536
           AK++KFS  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKTAD AGDGTTTATVLA  + KEG ++V +G NP+++KRG+D  V AIV +L   +KKI   DEI QV TISAN D +IG  +A AM+KVG++GVITVEEAK ++ EL VVEGMQFDRGY+SPYFVT++ KM  +LE+PYILI +KK+S ++ +LP+LE ++++G+PLLI+A+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ VVIDK+N+TIV G G +  I+ R  +I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGI+ GGG AL+  +K ++ V T N   D+K G  I+  AI  P+ QIV NAG D  +V+ ++L+  +   GFNAATG+Y D+ Q G+IDP KV R ALQ+A SV+S+L+TTEA++ D     E  + PAM
  S:     3 AKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVEAIVKDLKAHAKKITSNDEIAQVGTISANGDSEIGRFLAEAMQKVGNEGVITVEEAKSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDPYILIHEKKLSGLQTMLPLLEAVVQSGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTTISEDLGIKLENVTLSMLGRAKKVVIDKENTTIVDGAGAKKDIEARTQQIRLQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGVALLRATKVLDGVKTAN--ADQKAGVDIIRRAIQVPVRQIVQNAGDDGSLVVGKLLEKDSYSWGFNAATGEYQDLVQAGVIDPAKVVRTALQDAASVASLLITTEALVADKPKKAETAAAPAM 537
>gi|195977293|ref|YP_002122537.1| heat shock protein 60 family chaperone GroEL [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195973998|gb|ACG61524.1| heat shock protein 60 family chaperone GroEL [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (541 aa)
Score = 1414, Expect = 2.9e-154, Identities = 314/545 (57%), Positives = 412/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA++S+ S+K +G+ I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+     T+  LGQA  V +DKDN+ IV+G G    I  R+S IK+ +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V  +  V  L L GD   G  IV+ A+  P+ QI  NAG++  V+I++ LK +   +GFNAATG++VDM  TGIIDPVKVTR ALQNA SV+ ++LTTEAV   V    E + PAMP     GMM
  S:     1 MAKDIKFSADARESMVRGVDILADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAATTTAVEALKAVAQPVSGKEAIAQVASVSSRSEK-VGDYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLELKDATMAALGQAAKVTVDKDNTVIVEGAGSSEAISNRVSLIKSQLETTTSEFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALINVMDK--VAALELDGDAATGRNIVLRALEEPVRQIAYNAGYEGSVIIDK-LKNSAAGVGFNAATGEWVDMIATGIIDPVKVTRSALQNAASVAGLILTTEAV---VATKPEPAAPAMPQGMDPGMM 538
>gi|70780038|gb|AAZ08343.1| GroEL [Streptococcus downei] (526 aa)
Score = 1413, Expect = 3.6e-154, Identities = 312/529 (58%), Positives = 414/529 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG+++ V+  V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I+D+LP+LEE++KT RPLLIIADDV GEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + IDKD++ IV+G G    I ER++ IK+ +E T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V  L+L GD+  G  IV+ A+  P+ QI  NAG++  V+I E LKA+    GFNAA G +VDM + GIIDPVKV+R ALQNA SV+S++LTTEAV+ D  ++K
  S:     1 MAKDIKFSADARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIERAVSTAVDELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMATELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQDVLPLLEEVLKTSRPLLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIASLGQAAKITIDKDSTVIVEGAGSADTIAERVAVIKSQLESTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIEK--VAALDLDGDQATGRNIVLRALEEPVRQIARNAGYEGSVII-EKLKASQAGTGFNAADGSWVDMVEAGIIDPVKVSRSALQNAASVASLILTTEAVVADHPEEK 525
>gi|15625350|gb|AAL04033.1|AF335185_2 GroEL [Enterococcus faecalis] (541 aa)
Score = 1413, Expect = 3.9e-154, Identities = 320/545 (58%), Positives = 417/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM-PNMGMGGMM 545
           MAKEIKF++ AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++      V EL+  S  +  K+ I QVA +S+ S+K +G+LIA+AMEKVG+DGVIT+ E+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I  R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V  L   GD   G +IV+ A+  PI QI  NAG++  V++++ LK  +  +GFNAA G++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D K +     P M P+MGMGGMM
  S:     1 MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKTAVEELHNISSVVDSKEAIAQVAAVSSGSEK-VGQLIADAMEKVGNDGVITIAESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVIGK--VAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVDLGIGFNAANGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD-KPEPAAPAPMMDPSMGMGGMM 541
>gi|149012507|ref|ZP_01833538.1| chaperonin GroEL [Streptococcus pneumoniae SP19-BS75] >gi|147763563|gb|EDK70499.1| chaperonin GroEL [Streptococcus pneumoniae SP19-BS75] (540 aa)
Score = 1412, Expect = 4.0e-154, Identities = 318/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VATLELTGDEVTGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KPEPVAPAPAMDPSMMGGMM 540
>gi|91774720|ref|YP_544476.1| chaperonin GroEL [Methylobacillus flagellatus KT] >gi|118597118|sp|Q1H4F2|CH60_METFK 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|91708707|gb|ABE48635.1| chaperonin GroEL [Methylobacillus flagellatus KT] (544 aa)
Score = 1412, Expect = 4.1e-154, Identities = 310/543 (57%), Positives = 419/543 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGM 544
           AK++ F D AR K+ NGV  L +AVKVT+GP+GRNV++++S+G+P +TKDGVSVAKE++L++ +ENMGAQLVK+VASKT D AGDGTTTATVLA  + +EG + V +G NP ++KRG+DK V  IVNE+   +K      EI QV +ISANSD  IG++IA+AM+KVG +GVITVE+  G+ +EL VVEGMQFDRGY+SPYF+ +  + IA LENP++L+ DKK+S+I+D+LP LE++ K GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG+ + +++G+S +KVTL++LGQA+ V I K+N+TI+ G G E+ IK RI +IK  IE   SDYD++ L+ R+AKL  GVAVIKVGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG AL+     I      L G   D+  G +IV+ AI  P+ QIV+NAG +  VV+N++L+ T  + G+NA+ G Y D+ + G++DP KVTR ALQNA SV+S++LTT+A++ ++   KE++ PAMP+  GMGGM
  S:     3 AKQVIFGDDARAKIVNGVNILANAVKVTLGPKGRNVVLERSFGSPTVTKDGVSVAKEIELSDKLENMGAQLVKEVASKTNDNAGDGTTTATVLAQAIVREGFKYVAAGFNPTDLKRGIDKAVAEIVNEIKAIAKPTTTSKEIAQVGSISANSDADIGQIIADAMDKVGKEGVITVEDGSGLQNELDVVEGMQFDRGYLSPYFINNPERQIALLENPFVLLYDKKISNIRDLLPTLEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKAVAVKAPGFGDRRKAMLEDIAILTGGTVIAEEVGLSLEKVTLENLGQAKRVEIGKENTTIIDGAGSENNIKVRIDQIKKQIEDATSDYDREKLQERVAKLAGGVAVIKVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRARSSIK----ELKGDNPDQDAGIKIVLRAIEEPLRQIVANAGDEPSVVVNKVLEGTGNY-GYNASNGTYGDLVELGVLDPAKVTRSALQNAASVASLILTTDALVAELP--KEEAAPAMPDAGGMGGM 542
>gi|169833777|ref|YP_001695268.1| chaperonin GroL [Streptococcus pneumoniae Hungary19A-6] >gi|182684851|ref|YP_001836598.1| chaperonin GroEL [Streptococcus pneumoniae CGSP14] >gi|168996279|gb|ACA36891.1| chaperonin GroL [Streptococcus pneumoniae Hungary19A-6] >gi|182630185|gb|ACB91133.1| chaperonin GroEL [Streptococcus pneumoniae CGSP14] (540 aa)
Score = 1411, Expect = 5.6e-154, Identities = 318/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISNRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KPEPVAPAPAMDPSMMGGMM 540
>gi|85857894|ref|YP_460096.1| chaperonin GroEL [Syntrophus aciditrophicus SB] >gi|119366190|sp|Q2LPJ8|CH601_SYNAS 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|85720985|gb|ABC75928.1| chaperonin GroEL [Syntrophus aciditrophicus SB] (544 aa)
Score = 1411, Expect = 5.6e-154, Identities = 306/543 (56%), Positives = 405/543 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AKEIK+   AR+K+  GV  L +AVKVT+GPRGRNV+I+K++G P ITKDGV+VAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTAT+LA  +++EG +   +G NP+ +KRG+DK+V  +++EL K SK I  K EI QV TISAN+D  IGE+I+ AMEKVG +GVITVEEAKG+   L +VEGMQFDRGY+SPYFVTD  KM   +E+PYIL+ DKK+S ++D++PILE+I ++GRP+LI+++D++GEAL TLVVN +RG     AVKAP FGD+RK +LEDIAILTGG  V+++LGI  D +TL DLG  + + I KDN+TIV G G ++ I+ R+ +I+T IE T SDYD++ L+ RLAKL  GVAVIKVGA +E+E+KEKK RV+DAL AT+AA+EEGIV GGG AL+     +    ++L  DE+ G  IV  A+  P+ QI +NAGF+  +V+ ++ K    + GFNA T KYVDM + GIIDP KV R ALQNA SV+S+LLTTEA+I +    K   +P      MG M
  S:     3 AKEIKYDSVARDKVMKGVDTLANAVKVTLGPRGRNVVIEKAWGGPTITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDMAGDGTTTATILAQAIYREGTKLAAAGMNPMSLKRGIDKSVQLVIDELKKISKDIRDKKEITQVGTISANNDNTIGEIISEAMEKVGKEGVITVEEAKGMETTLEIVEGMQFDRGYVSPYFVTDPEKMEVVMEDPYILLYDKKISVMQDLVPILEQIARSGRPMLIVSEDLEGEALATLVVNNIRGTLKCAAVKAPGFGDRRKAMLEDIAILTGGKVVSEELGIKLDSITLTDLGTCKRLHITKDNTTIVDGAGSQADIEGRVKQIRTQIEETTSDYDREKLQERLAKLVGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRTLPAL--AGMDLPDDERPGLNIVKRAVEEPMRQIAANAGFEGSIVVEKV-KENTGNFGFNADTEKYVDMMEAGIIDPTKVVRFALQNAASVASLLLTTEAMIAEAPKKKGAGMPGGMPPDMGDM 542
>gi|78189271|ref|YP_379609.1| chaperonin GroEL [Chlorobium chlorochromatii CaD3] >gi|119366232|sp|Q3AR09|CH60_CHLCH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78171470|gb|ABB28566.1| Chaperonin Cpn60/TCP-1 [Chlorobium chlorochromatii CaD3] (547 aa)
Score = 1411, Expect = 5.7e-154, Identities = 315/530 (59%), Positives = 406/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L + +ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AMEKVG DGVITVEEAKG+  EL VVEGMQFDRGY+SPYFVT+++ M A+L+NP ILI DKK+S++K++LPILE+  ++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LGQA SV +DKDN+T+V+GKG    IK RI++IK  IE + SDYD + L+ RLAKL+ GVAVI +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K +N N      D+KIG +IV  A+  P+ QIV+N G   G V+ E +K      GFNA T  Y ++ + G++DP KVTR AL+NA SV+ +LLTTEA I D+KDDK D
  S:     3 AKDIFFDTDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELADAVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVTAGARPIDLKRGIDRAVKEVVAELKAISRSISSKKEIAQVGTISANNDPEIGELIAEAMEKVGKDGVITVEEAKGMETELKVVEGMQFDRGYLSPYFVTNSDTMEAELDNPLILIYDKKISNMKELLPILEKSAQSGRPLLIIAEDIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATLSYLGQAGSVSLDKDNTTLVEGKGASDAIKARINEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVINIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGLN-NAQADNEDQKIGIEIVRRALEEPLRQIVANTGTQDGAVVLEKVKEGEGDFGFNARTETYENLVEAGVVDPTKVTRSALENAASVAGILLTTEAAITDIKDDKMD 531
>gi|25452840|sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|21310096|gb|AAM46144.1|AF378195_2 GroEL [Streptococcus anginosus] (540 aa)
Score = 1411, Expect = 5.8e-154, Identities = 318/545 (58%), Positives = 414/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V  L  +S  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE + SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V+V     V  L+L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M   GIIDPVKVTR ALQNA SV+S++LTTEAV+ + + +     PAM    MGGMM
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVATAVEALKANSVPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENILKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGDAEAIANRVAVIKSQIESSTSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVNVLSA--VEALDLSGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGTGFNAATGEWVNMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-QPEPASPTPAMDPSMMGGMM 540
>gi|150384633|ref|ZP_01923314.1| chaperonin GroEL [Victivallis vadensis ATCC BAA-548] >gi|150258972|gb|EDM96222.1| chaperonin GroEL [Victivallis vadensis ATCC BAA-548] (545 aa)
Score = 1410, Expect = 6.7e-154, Identities = 305/535 (57%), Positives = 404/535 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           MAK++ FSD AR  +  GV  L  AVK T+GP+GRNV++ K +GAP ITKDGV+VAKE++L  P  NMGAQ+VK+VASKT D AGDGTTTATVLA  +++EGL+NV +G+NP+E+KRG++K V  +V  + K SKK+   D I QVATISAN D  IG++IA AMEKVG +G ITVEEAK +   L VVEGMQFD+GY+SPYF T+T  M A LE+ Y+LI +KK+S++ D+LP+L+ + K G+PLLIIA+DV+GEAL TLV+N MRG+  V AVKAP FGD+RK +L+DIA+LTGG+ +T+DLGI  + VT+  LG+A+ V + K+N+TIV+G G ++ I  R+++I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  +K +    L L GDE  G  IV  A+  P+ Q+ +N G++  VV+  I K    + GFN ATG+Y DM + GI+DP KVTR ALQNA S++S+LLTTE +I D+K++KE ++PA
  S:     1 MAKQLVFSDEARRGILEGVTLLSKAVKATLGPKGRNVVLDKKFGAPTITKDGVTVAKEIELKCPYANMGAQMVKEVASKTNDVAGDGTTTATVLAEAIYREGLKNVTAGSNPMELKRGIEKAVETVVAGIAKMSKKV-EGDMIAQVATISANGDTTIGQIIAEAMEKVGQEGTITVEEAKTLETTLDVVEGMQFDKGYLSPYFATNTEAMEAVLEDAYLLIHEKKISNLNDMLPLLQSVAKEGKPLLIIAEDVEGEALATLVINSMRGILKVCAVKAPGFGDRRKAMLQDIAVLTGGTCITEDLGIKLENVTIDQLGKAKRVTVTKENTTIVEGAGTQAAIMGRVAQIRREIEETSSDYDREKLQERLAKLAGGVAVINVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAAKAL--KDLKLCGDEATGAAIVERAVEEPLRQLAANGGYEGSVVVQRI-KELKDNEGFNVATGEYGDMLKAGILDPAKVTRSALQNAASIASLLLTTECLITDIKEEKEPAMPA 531
>gi|148269555|ref|YP_001244015.1| chaperonin GroEL [Thermotoga petrophila RKU-1] >gi|170288231|ref|YP_001738469.1| chaperonin GroEL [Thermotoga sp. RQ2] >gi|166201760|sp|A5IJR6|CH60_THEP1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|147735099|gb|ABQ46439.1| chaperonin GroEL [Thermotoga petrophila RKU-1] >gi|170175734|gb|ACB08786.1| chaperonin GroEL [Thermotoga sp. RQ2] (538 aa)
Score = 1410, Expect = 7.1e-154, Identities = 306/537 (56%), Positives = 411/537 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           M K +KF++ AR  L  GV ++ +AVKVT+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANPI +KRG+DK V   V E+ K SKK++ +++I  VA ISANS  +IGELIA AM+KVG DGVITVE++K +   +   EGMQFDRGYISPYFVTD  KM   L+ P+ILITD+K+S++K ++PILE++ +TGRPLL+IA+DV+GE LTTLV+NK++G     AVKAP FG++RK +L+DIAILTGG   +++LGI+ + +TL+DLG+A+ V + KD + I+ GKG    IK+RI++IK  IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEKIG QIV  A+ +PI QI  NAG+D  V+I +IL   +P  GF+A  G+Y +MF+ GIIDP KVTR ALQNA S++ MLLTTE +I +  ++K+++ P++P
  S:     1 MPKILKFNEEARRALERGVDKVANAVKVTLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGIDKAVEKAVEEIKKVSKKLSGREDIAHVAAISANS-AEIGELIAEAMDKVGEDGVITVEDSKTLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPFILITDRKLSAVKPLIPILEKVAQTGRPLLVIAEDVEGEVLTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVASEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLRARKAVEKVIEELEGDEKIGAQIVYKALSAPIKQIAENAGYDGAVIIEKILSNDDPAYGFDALRGEYCNMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLIVEKPEEKKET-PSIP 535
>gi|15643272|ref|NP_228316.1| groEL protein [Thermotoga maritima MSB8] >gi|14916540|sp|Q9WYX6|CH60_THEMA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|4981018|gb|AAD35591.1|AE001727_3 groEL protein [Thermotoga maritima MSB8] (538 aa)
Score = 1410, Expect = 7.1e-154, Identities = 306/537 (56%), Positives = 411/537 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           M K +KF++ AR  L  GV ++ +AVKVT+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANPI +KRG+DK V   V E+ K SKK++ +++I  VA ISANS  +IGELIA AM+KVG DGVITVE++K +   +   EGMQFDRGYISPYFVTD  KM   L+ P+ILITD+K+S++K ++PILE++ +TG+PLL+IA+DV+GE LTTLV+NK++G     AVKAP FG++RK +L+DIAILTGG   +++LGI+ + +TL+DLG+A+ V + KD + I+ GKG    IK+RI++IK  IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEKIG QIV  A+ +PI QI  NAG+D  V+I +IL   +P  GF+A  G+Y +MF+ GIIDP KVTR ALQNA S++ MLLTTE +I +  ++K+++ P+MP
  S:     1 MPKILKFNEEARRALERGVDKVANAVKVTLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGIDKAVEKAVEEIKKVSKKLSGREDIAHVAAISANS-AEIGELIAEAMDKVGEDGVITVEDSKTLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPFILITDRKLSAVKPLIPILEKVAQTGKPLLVIAEDVEGEVLTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVASEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLRARKAVEKVIEELEGDEKIGAQIVYKALSAPIKQIAENAGYDGAVIIEKILSNDDPAYGFDALRGEYCNMFERGIIDPAKVTRSALQNAASIAGMLLTTEVLIVEKPEEKKET-PSMP 535
>gi|86131567|ref|ZP_01050165.1| 60 kDa chaperonin [Cellulophaga sp. MED134] >gi|85818012|gb|EAQ39180.1| 60 kDa chaperonin [Dokdonia donghaensis MED134] (544 aa)
Score = 1410, Expect = 7.6e-154, Identities = 319/528 (60%), Positives = 412/528 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARK-DEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+I+F+  AR+ L  GV +L +AVKVT+GP+GRNV+I KS+GAP +TKDGV+VAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EGL+NV +GANP+++KRG+DK V AIV +L K + K+    D+I QVA+ISAN+D+ IGELIA A  KVG +GVITVEEAKG    + VVEGMQFDRG++SPYFVT++ KM A+L++PYIL+ DKK+S++KD+LP+LE + +TG+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  TL  LG AE+V IDKDN+T+V G G    IK R+ +IK+ IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   K ++ + T N   D++ G QIV  AI SP+  IVSNAG +  VVI+++L+      GFNA  G+Y DM + GIIDP KVTR+AL+NA SVS M+LTTE  + D+K+D
  S:     1 MAKDIQFNIEARDGLKRGVDKLANAVKVTLGPKGRNVIISKSFGAPHVTKDGVTVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVTEGLKNVAAGANPMDLKRGIDKAVEAIVADLEKQTAKVGNSSDKIKQVASISANNDEVIGELIAEAFGKVGKEGVITVEEAKGTETYVDVVEGMQFDRGFLSPYFVTNSEKMSAELDSPYILLFDKKISNMKDLLPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGALKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENTTLDMLGTAETVTIDKDNTTVVNGSGDSDMIKARVGQIKSQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKKSLDKIKTEN--ADQETGVQIVNRAIESPLRTIVSNAGGEGAVVISKVLEGKK-DFGFNAKNGEYTDMLKAGIIDPKKVTRVALENAASVSGMILTTECALTDIKED 527
>gi|88713402|ref|ZP_01107485.1| chaperonin GroEL [Flavobacteriales bacterium HTCC2170] >gi|88708312|gb|EAR00549.1| chaperonin GroEL [Flavobacteriales bacterium HTCC2170] (544 aa)
Score = 1410, Expect = 8.6e-154, Identities = 323/528 (61%), Positives = 403/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV +L   SKK+    E I QVA+IS+N+D+ IGELIA A  KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVTD+ KM A LENPYIL+ DKK+SS+KD+LP+LE + ++G+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ + ++ G S D  T+  LG  E V IDKDN+TIV G G+   IK R+++IK+ IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV     ++ V   N   DE+ G QIV  AI SP+  IV NAG +  VV+ ++        GF+A + KYV MF+ GIIDP KVTR+AL+NA SVS M+LTTE  + D+K+D
  S:     1 MAKDIKFDIEARDGLRRGVDALANAVKVTLGPKGRNVIISKSFGAPAVTKDGVSVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQSIVKEGLKNVAAGANPMDLKRGIDKAVEAIVGDLTNQSKKVGDSSEKIKQVASISSNNDETIGELIAQAFGKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGYLSPYFVTDSEKMTADLENPYILLFDKKISSMKDLLPVLEPVAQSGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTKGTVIAEERGFSLDNTTIDMLGTCEKVSIDKDNTTIVNGGGVAKNIKTRVNQIKSQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKNALSKVKADN--ADEETGLQIVARAIESPLRTIVENAGGEGSVVVAKVQDGKG-DFGFDAKSEKYVQMFKAGIIDPTKVTRVALENAASVSGMILTTECALTDIKED 527
>gi|163753923|ref|ZP_02161046.1| chaperonin GroEL [Kordia algicida OT-1] >gi|161326137|gb|EDP97463.1| chaperonin GroEL [Kordia algicida OT-1] (545 aa)
Score = 1409, Expect = 9.5e-154, Identities = 318/528 (60%), Positives = 412/528 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L NP+ENMGAQ+VK+VAS+T D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV++LNK +KK+    E I Q+A+ISAN+D+ +G+LIA A  KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVT++ KM A+LE+PYIL+ DKK+SS+KD++P+LE + +TG+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  T+  LG AE + IDKDN+TIV G G    I+ R+ +IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV     + ++ T NL  DE  G +I+  AI  P+  IVSNAG +  VV++++++      G+NA T +YVDM + GIIDP KVTRIAL+NA SVS M+LTTE  + D+K++
  S:     1 MAKDIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIISKSFGAPSVTKDGVSVAKEIELENPLENMGAQMVKEVASRTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVTAIVDDLNKQAKKVGDSSEKIKQIASISANNDEVVGDLIAKAFGKVGKEGVITVEEAKGTDTTVDVVEGMQFDRGYLSPYFVTNSEKMEAELESPYILLFDKKISSMKDLMPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGALKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENATIDMLGTAEKITIDKDNTTIVNGAGDAEMIQTRVGQIKAQIESTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKGVLESITTDNL--DEVTGIKIIARAIEEPLRTIVSNAGGEGSVVVSKVMEGEK-DFGYNAKTDEYVDMLKAGIIDPKKVTRIALENAASVSGMILTTECALIDIKEE 527
>gi|25452854|sp|Q8VT58|CH60_STRGN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|18478665|gb|AAL73234.1|AF338228_3 GroEL [Streptococcus gordonii] (540 aa)
Score = 1409, Expect = 1.0e-153, Identities = 317/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V+ L +++  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD+ KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE   S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ + + +     PAM    MGGMM
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVSALKETAIPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESILKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLDLKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESATSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVSVLDA--VAGLELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-QPEPASPAPAMDPSMMGGMM 540
>gi|168492118|ref|ZP_02716261.1| chaperonin GroL [Streptococcus pneumoniae CDC0288-04] >gi|183573691|gb|EDT94219.1| chaperonin GroL [Streptococcus pneumoniae CDC0288-04] (540 aa)
Score = 1409, Expect = 1.0e-153, Identities = 317/545 (58%), Positives = 414/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++  PLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNHPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KPEPVAPAPAMDPSMMGGMM 540
>gi|157151055|ref|YP_001451151.1| chaperonin GroEL [Streptococcus gordonii str. Challis substr. CH1] >gi|189082372|sp|A8AZE1|CH60_STRGC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|157075849|gb|ABV10532.1| 60 kDa chaperonin/groEL protein [Streptococcus gordonii str. Challis substr. CH1] (540 aa)
Score = 1408, Expect = 1.3e-153, Identities = 316/545 (57%), Positives = 416/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V+ L +++  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD+ KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE   S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V V     V+ + L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ + + +     PAM    MGGMM
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVSALKETAIPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESILKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGAGNPEAIANRVAVIKSQIESATSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVSVLDA--VSGIELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGAGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-QPEPASPAPAMDPSMMGGMM 540
>gi|32475649|ref|NP_868643.1| 60 kDa chaperonin 5 [Rhodopirellula baltica SH 1] >gi|68566290|sp|Q7UM97|CH602_RHOBA 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|32446191|emb|CAD76020.1| 60 kDa chaperonin 5 [Rhodopirellula baltica SH 1] (540 aa)
Score = 1408, Expect = 1.3e-153, Identities = 290/534 (54%), Positives = 400/534 (74%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           MAK++ F D AR ++  GV++L  AV  TMGP GRNV+I KS+G P +TKDGV+VAKE++L +  ENMGA+LV +VA KT+D AGDGTTTATVLA  +FKEGLRN+++G+NP  I+RG++K V A  ++L +  + ++ K E+  V  ISAN+D  IGEL+A+A+E+VG DGVITVEE K  N E+  V+GMQFD+GY+SPYF+TD++ M A LE+  +L+ +KKVS+I+D++P+LE+  +TG+PLLIIA+DVD EALT LVVNK+RG  NV AVKAP FGD+RK +L DIA LTGG+ +++DLG+  + VTL+ LG+A+ V +DK N+TIV+G G    I +R+++I+  IE TDSDYDK+  + RLAKL  GVAVI VGA +E E+K+ K R++DAL AT+AA+EEGI+ GGG ALVH  + +        GDEKIG  IV+ A+ +P+ QI  N G D  VV++E+L+  +P +GFNA TG+Y DM + G+IDPVKV R AL NA S++ +LLTTEA++ + + + +D  P
  S:     1 MAKQLLFEDHARARMLAGVEKLAKAVATTMGPTGRNVIIDKSFGGPTVTKDGVTVAKEIELEDRFENMGAKLVIEVAQKTSDLAGDGTTTATVLARAIFKEGLRNIVAGSNPTAIRRGIEKAVEAACDQLVEMGRPVSGKQEVAHVGAISANNDNVIGELLADALERVGKDGVITVEEGKSRNTEVEYVDGMQFDKGYVSPYFITDSSTMEASLEDALVLLYEKKVSNIRDLVPLLEKTAQTGQPLLIIAEDVDAEALTLLVVNKLRGTLNVCAVKAPGFGDRRKAMLGDIATLTGGTLISEDLGMQLENVTLEHLGRAKKVTVDKSNTTIVEGAGKREDIDKRVAQIRAQIEQTDSDYDKEKFQERLAKLAGGVAVISVGAETEAEMKQTKARLEDALHATRAAVEEGILPGGGVALVHCREAVEAAKKKAKGDEKIGVDIVLGALDAPMRQIADNGGIDGSVVVDEVLQKNDPKIGFNAHTGEYTDMVKAGVIDPVKVVRTALTNAASIAGLLLTTEALVTNFEQEDKDKRP 534
>gi|85859566|ref|YP_461768.1| chaperonin GroEL [Syntrophus aciditrophicus SB] >gi|119366224|sp|Q2LU42|CH603_SYNAS 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|85722657|gb|ABC77600.1| chaperonin GroEL [Syntrophus aciditrophicus SB] (542 aa)
Score = 1407, Expect = 1.5e-153, Identities = 307/537 (57%), Positives = 410/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKEIK+   AR K+  GV  L +AVKVT+GP+GRNV I KS+GAP +TKDGV+VAKE++L +  ENMGAQ+VK+VASKT+D+AGDGTTTATVLA  +++EG + V+SG NP+ +KRG+DK V  +V+EL K SK I+ K EI Q+ TISAN+D  IG +I+ AMEKVG DGVITVEEAKG+  EL +VEGMQFDRGY+SPYFVTD  KM  +L++PYIL+ +KK+S++KD++P+LE+I KTG+PLL++A+D++GEAL TLVVNKMRG    VAVKAP FGD+RK +L+DIA+LTGG+ +++D+GI  + VTLQDLG  + V +DKDN+TIV G G  + I+ R+ +I+  IE T SDYD++ L+ RLAK+  GVAVI+VGA +E+E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +      L  +E+ G  IV  A+  P+ QI +NAG +  +V+ ++ ++   H GF+A T +YVDM + GIIDP KV R ALQNA SV+S+LLTTEA+I +    KE  +PAMP+
  S:     3 AKEIKYDMQAREKIMKGVDTLANAVKVTLGPKGRNVAIAKSWGAPQVTKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDKAGDGTTTATVLAQAIYREGSKLVVSGMNPMSLKRGIDKGVALVVDELKKRSKTISDKKEIAQIGTISANNDATIGNIISEAMEKVGKDGVITVEEAKGMETELEIVEGMQFDRGYVSPYFVTDAEKMEVRLDDPYILLHEKKISAMKDMVPLLEQIAKTGKPLLLVAEDIEGEALATLVVNKMRGTLKCVAVKAPGFGDRRKAMLQDIAVLTGGNLISEDVGIKLENVTLQDLGTCKKVTVDKDNTTIVDGAGNRADIEGRVKQIRAEIEETKSDYDREKLQERLAKIVGGVAVIRVGAATEIEMKEKKARVEDALHATRAAVEEGIVPGGGVAFIRSIGAL--ADAKLPDEEQQGLNIVRRALEEPLRQIAANAGCEGSIVVEKVKESNGTH-GFDAETEQYVDMLKAGIIDPTKVARFALQNAASVASLLLTTEAMIAEKPKKKEPPMPAMPS 536
>gi|189501756|ref|YP_001957473.1| hypothetical protein Aasi_0308 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497197|gb|ACE05744.1| hypothetical protein Aasi_0308 [Candidatus Amoebophilus asiaticus 5a2] (544 aa)
Score = 1407, Expect = 1.6e-153, Identities = 309/535 (57%), Positives = 413/535 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           MAK I F   AR KL +GV  + +AVKVT+GP+GRNV+I K YGAP ITKDG+SVAKE++L +P+EN+GAQL+K+VASKTAD AGDGTTTATVLA  +F  G++NV +GANP+++KRG+DK + A+V  L ++S+KI+   EI QVATISAN+D KIG++IA+AM+KVG DGVITVEEAKG   E+ VVEGM+FDRGY+SPYFVT+T KM A+L N YILI DKK+S +K++LPILE I +TGRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LG AE + IDK+N+ IV G G +  I+ RIS+I++ IE T SDYDK+ L+ RLAKL+ GVA++ +GA +EVE+KEKKDRVDDAL AT+AA++EG+V GGG AL+     + N+   N   D+  G  IV +++ +P+  IVSNAG +  V++ +I +A     G+NA TG + ++++ G+IDP KVTR+AL+NA S++S+LLTTE VI D K++ +  V A
  S:     1 MAKHIIFDSEARAKLKSGVDTMANAVKVTLGPKGRNVVIDKKYGAPSITKDGISVAKEIELKDPVENLGAQLIKEVASKTADGAGDGTTTATVLAQSIFSAGIKNVAAGANPMDLKRGVDKAIEAVVERLKQNSRKISNSKEIEQVATISANNDSKIGKMIADAMDKVGKDGVITVEEAKGTETEVKVVEGMEFDRGYLSPYFVTNTEKMEAELGNAYILICDKKISVMKELLPILEAISQTGRPLLIIAEDIEGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGYKLENATLDYLGTAEKINIDKENTLIVNGGGKKEDIQARISQIRSQIENTTSDYDKEKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVQEGVVAGGGVALIRTIPALENIEVEN--EDQATGINIVRTSLEAPLRTIVSNAGGEGAVIVQKIREAQG-DFGYNARTGNFENLYEAGVIDPTKVTRLALENAASIASLLLTTECVIADEKEEDKPGVGA 533
>gi|104774423|ref|YP_619403.1| chaperonin GroEL [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514521|ref|YP_813427.1| chaperonin GroEL [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274747|sp|Q048Y3|CH60_LACDB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|118597115|sp|Q1G937|CH60_LACDA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|103423504|emb|CAI98406.1| 60 kDa chaperonin GroEL [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093836|gb|ABJ58989.1| Chaperonin GroEL (HSP60 family) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (537 aa)
Score = 1407, Expect = 1.8e-153, Identities = 307/539 (56%), Positives = 411/539 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           MAK+IKFS+ AR  L NGV +L + VK T+GP+GRNV++++SYGAP IT DGV++AK ++L +  EN+GA+LV + ASKT D AGDGTTTATVL   + +EG++NV++GANP+ I+RG++K   A V++L+K+S K++ +D+I QVA+IS+ S K+IG+LIA AMEKVG DGVIT+E+++GI  EL+VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+L+EI++ GR LLIIADDV GEAL TLV+NK+RG FNVVAVKAP FGD+RK+ L DIA LTGG+ +++DLG+      L  LGQA  V I KD++TIV G G +  I+ER+  I+  IE T SD+DK  L+ RLAKL  GVAVI VGA +E ELKE++ RV+DAL+AT+AA++EG V GGG ALV+V + +   T     DE+ G  IV  A+ +P+ QI  NAG +  VV++  L+  +P +G+NAA  KYV+M   GIIDP +VTR ALQNA S++ +LLTTEAV+ ++ +DK ++ PA P M
  S:     1 MAKDIKFSEDARRSLLNGVNKLANTVKTTLGPKGRNVVLEQSYGAPTITNDGVTIAKAIELEDHYENIGAKLVAEAASKTNDIAGDGTTTATVLTQAIVQEGMKNVVAGANPVGIRRGIEKATKAAVDQLHKNSHKVSSRDQIAQVASISSAS-KEIGDLIAEAMEKVGKDGVITIEDSRGIETELSVVEGMQFDRGYLSQYMVTDNDKMEADLENPYILITDKKISNIQDILPMLQEIVQQGRSLLIIADDVTGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKEQLADIAALTGGTVISEDLGLELKDTQLSQLGQARRVTITKDSTTIVDGSGAKEAIQERVDTIRKQIEDTSSDFDKKKLQERLAKLTGGVAVIHVGAATETELKERRYRVEDALNATRAAVDEGYVAGGGTALVNVEEAVKA-TKGDTDDEQTGINIVARALTAPVRQIAENAGQEGSVVVDH-LRKVDPEVGYNAAEDKYVNMIDEGIIDPTQVTRSALQNAASIAGLLLTTEAVVAEIPEDKPEAAPAQPGM 536
>gi|75676299|ref|YP_318720.1| chaperonin GroEL [Nitrobacter winogradskyi Nb-255] >gi|119366180|sp|Q3SQS3|CH601_NITWN 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|74421169|gb|ABA05368.1| chaperonin Cpn60/TCP-1 [Nitrobacter winogradskyi Nb-255] (542 aa)
Score = 1407, Expect = 1.8e-153, Identities = 306/539 (56%), Positives = 410/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AKE++FS  AR K+  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + KEG + V +G NP+++KRG+D  V A+V +L K++KKI    EI QVATISAN D +IG  +A AM+KVG++GVITVEEAK +  EL VVEGMQFDRGY+SPYFVTD  KM  + E+PY+LI +KK+S ++ ++P+LE ++++G+PLL+IA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ VVIDK+N+TIV G G +  I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEGI+ GGG AL+   K ++    +   D+K G  IV  AI  P  QI+ NAG D  +V+ ++L+    + GFNAATG+Y D+   G+IDP KV R ALQ+A SV+S+L+TTEA++   +  K+D  PA+P  G
  S:     3 AKEVRFSSDAREKMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGIDLAVEAVVKDLTKNAKKITSNSEIAQVATISANGDTEIGRFLAEAMQKVGNEGVITVEEAKSLETELEVVEGMQFDRGYVSPYFVTDAEKMRVEFEDPYVLIHEKKLSGLQAMVPLLESVVQSGKPLLVIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLNMLGRAKKVVIDKENTTIVDGAGRKKDIEARVTQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGILPGGGVALLRALKALDAVKPD-NPDQKAGVDIVRRAIQVPARQIIQNAGEDGSLVVGKLLEKNTYNWGFNAATGEYQDLVGVGVIDPAKVVRTALQDAASVASLLITTEALV--AEKPKKDVAPALPPGG 538
>gi|162147833|ref|YP_001602294.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5] >gi|187596231|ref|ZP_02982494.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5] >gi|187470746|sp|A9HK37|CH601_GLUDA 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|161786410|emb|CAP55992.1| 60 kDa chaperonin [Gluconacetobacter diazotrophicus PAl 5] >gi|187492065|gb|EDU30003.1| chaperonin GroEL [Gluconacetobacter diazotrophicus PAl 5] (547 aa)
Score = 1407, Expect = 1.9e-153, Identities = 303/528 (57%), Positives = 405/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF   AR ++  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A+V EL K++KKI    E  QV TISAN + +IGE+I+ AM+KVGS+GVITVEEAKG++ EL VVEGMQFDRGYISPYF+T+  KM+A L+NPYILI +KK+SS++ +LP+LE ++++GRPLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + VTL  LG+A+ V I+K+N+TIV+G G    IK R  +I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL   S  + N++  N   D+++G +I+  A+ +P+ QI  NAG D  V+  ++L++ + + GF+A  G Y D+   GIIDP KV R ALQ+A SV+ +L+TTEA++ +  + K
  S:     3 AKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVIAVVEELKKNTKKITTPAETAQVGTISANGEHEIGEMISQAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFITNAEKMVADLDNPYILIHEKKLSSLQPMLPLLESVVQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLETVTLAMLGRAKKVRIEKENTTIVEGAGASDDIKGRCGQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALARASTALGNLHFHN--DDQRVGAEIIRKALQAPLRQIAHNAGEDGAVIAGKVLESNDYNYGFDAQIGDYKDLVAAGIIDPTKVVRTALQDASSVAGLLITTEAMVAEKPEKK 529
>gi|148266317|ref|YP_001233023.1| chaperonin GroEL [Geobacter uraniireducens Rf4] >gi|187470759|sp|A5G9I2|CH60_GEOUR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|146399817|gb|ABQ28450.1| chaperonin GroEL [Geobacter uraniireducens Rf4] (549 aa)
Score = 1406, Expect = 2.2e-153, Identities = 309/537 (57%), Positives = 405/537 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           MAK IKF    RN    GV  L DAVKVT+GP+GRNV+I+KS+GAP+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+DK V  +V EL   SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A LEN  ILI DKK+S++KD+LP+LE+  K+GRPL+IIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIA+LTGG  +++++G   +  T+  LGQA+ + +DKDN+TI+ G G E++I+ R+  I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA++EGIV GGG A +     +  ++L+L  +++ G  ++  A+  PI QI  NAG D  +V++++ K      G+NAA  +YVDM Q GIIDP KV+R ALQNA S++ ++LTTEA+I D K  +E S+PAMP
  S:     1 MAKIIKFDQEGRNAFLKGVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIELDDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGIDKAVETLVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEATLENANILIHDKKISNMKDLLPVLEQTAKSGRPLIIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAVLTGGKVISEEIGFKLENTTMDMLGQAKKITVDKDNTTIIDGAGSEAEIQGRVKMIRAQIEETTSDYDREKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVDEGIVPGGGVAYLRAMSAL--DSLDLSTEQQFGVNVIKRALEEPIRQIAQNAGVDGSIVVDKV-KNGKDAFGYNAADDEYVDMIQAGIIDPTKVSRSALQNASSIAGLMLTTEAMIAD-KPKEEGSMPAMP 533
>gi|126663269|ref|ZP_01734267.1| 60 kDa chaperonin [Flavobacteria bacterium BAL38] >gi|126624927|gb|EAZ95617.1| 60 kDa chaperonin [Flavobacteria bacterium BAL38] (541 aa)
Score = 1406, Expect = 2.3e-153, Identities = 316/528 (59%), Positives = 403/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+G P +TKDGVSVAKE++L +P+ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V  IV EL K S  +    E I QVA+ISAN+D  IG+LIA A  KVG +GVITVEEAKG+   + VVEGMQFDRGY+SPYFVTD +KM+A+L NPY+L+ DKK+S+++++LP+LE + ++GRPLLIIA+DVDG+AL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ + ++ G + +  TL  LG AE++ IDKDN+TIV G G    IK R+++IK+ IE T SDYD++ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV     + N+   N   DE  G QI+  A+ SP+  IV NAG +  VVI ++ + T    GFNA TG+YV M   GIIDP KVTR+AL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKDIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIISKSFGGPTVTKDGVSVAKEIELQDPLENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVETIVAELGKQSVAVGDSSEKIKQVASISANNDDTIGDLIATAFSKVGKEGVITVEEAKGMETYVDVVEGMQFDRGYLSPYFVTDADKMVAELSNPYVLLYDKKISNLQELLPVLEPVAQSGRPLLIIAEDVDGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVIAEESGYALENTTLDMLGTAENITIDKDNTTIVNGSGDAENIKARVNQIKSQIETTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKAALANIKAEN--ADEATGIQIINKAVESPLRTIVENAGGEGSVVIAKVTEGT-ADFGFNAKTGEYVQMLAAGIIDPKKVTRVALENAASVAGMILTTECALIDIKED 527
>gi|69247573|ref|ZP_00604407.1| Chaperonin Cpn60/TCP-1 [Enterococcus faecium DO] >gi|68194797|gb|EAN09274.1| Chaperonin Cpn60/TCP-1 [Enterococcus faecium DO] (541 aa)
Score = 1406, Expect = 2.5e-153, Identities = 321/545 (58%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKE+KF++ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QVA +S+ SDK +G LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+    VT+++LG A  VV+DKDN+TIV+G G +  I+ R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V+ +   GD   G +IV+ A+  PI QI  NAG++  V++++ LK      GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D  +    + PAM    MGGMM
  S:     1 MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISTVVDSKEAIAQVAAVSSGSDK-VGHLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDVTIENLGNASKVVVDKDNTTIVEGSGEKEAIEARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVISK--VSAVEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVELGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPAAPAAPAMDPSMMGGMM 541
>gi|182413871|ref|YP_001818937.1| chaperonin GroEL [Opitutus terrae PB90-1] >gi|177841085|gb|ACB75337.1| chaperonin GroEL [Opitutus terrae PB90-1] (544 aa)
Score = 1405, Expect = 2.7e-153, Identities = 301/529 (56%), Positives = 404/529 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           AK++ F +SAR K+  GV+ L  AVKVT+GP+GRNV+I K +G+P +TKDGV+VAKEV+L +P ENMGAQ+VK+VASKT++ AGDGTTTATVLA  ++KEGL+NV +G+NP+ +KRG+DK V A V EL + SKK+  ++EI QVAT+SAN D+ IG +IA+AM+KVG DG ITVEEAK I   L VVEGMQFD+GY+SPYF T+     A LE+ Y+LI +KK+SS++D+LP+L+ + K+G+PLL+IA++V+GEAL  LVVNK+RG  NV AVKAP FGD+RK +LEDIA+LTGG  +T+DLGI  + V + DLG+A+ + +DK+N+TIV+G G  S I+ R+ +I+  I+ T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG AL+   K I  + L L GDEKIG QIV  A+  PI  +  NAG +  VV+ EIL +   + G+N AT KY D+ + G++DP KVTR ALQNA SV+ +LLTTE +I ++ + ++
  S:     3 AKQLLFDESARQKILRGVELLSRAVKVTLGPKGRNVVIDKKFGSPTVTKDGVTVAKEVELPDPYENMGAQMVKEVASKTSNAAGDGTTTATVLAEAIYKEGLKNVTAGSNPVYLKRGIDKAVEAAVTELARVSKKVNDREEIRQVATVSANWDETIGNIIADAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYLSPYFATNAEAQEAILEDAYVLIHEKKISSLQDLLPLLQTVAKSGKPLLVIAEEVEGEALAALVVNKIRGTLNVCAVKAPGFGDRRKAMLEDIAVLTGGRCITEDLGIKLENVQVSDLGRAKRITVDKENTTIVEGAGKSSDIQGRVKQIRRQIDETTSDYDREKLQERLAKLAGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVAGGGVALLRCVKVI--DALQLEGDEKIGSQIVRRAVEHPIRMLCQNAGVEGAVVVGEIL-SNKGNYGYNVATDKYEDLVKAGVVDPTKVTRTALQNAASVAGLLLTTECMITEIPEKEK 528
>gi|126647994|ref|ZP_01720488.1| chaperonin GroEL [Algoriphagus sp. PR1] >gi|126575587|gb|EAZ79897.1| chaperonin GroEL [Algoriphagus sp. PR1] (543 aa)
Score = 1405, Expect = 3.1e-153, Identities = 315/528 (59%), Positives = 413/528 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           M+KE+ F   AR++L  GV  L DAVKVT+GP+GRNV++ K +GAP ITKDGVSVAKE++L  PIENMGAQLVK+VASKTAD AGDGTTTATVLA  +F  G++NV +GANP+++KRG+DK V A+V  L  +SK+I+   EI QVAT+SAN+D++IG +I+NAM+KVG DGVITVEEAKG   E+  VEGMQFDRGY+SPYFVT+T KM A+LE PYILI DKK+SS+K++LP+LE + ++G+PL+II++DVDGEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T   LG+AE + IDKDN+TIV G G  + IK R+S+IK  I+ T SDYD++ L+ RLAKL+ GVA++ +GA +EVE+KEKKDRVDDAL AT+AA++EG+V+GGG ALV  S+ + V+   L  DE  G  I+  AI SP+  IV NAG +  VVIN+I +    + G+NA T KY D+F+ G+IDP KVTR+AL+NA S++++LLTTE V+ DVK+D
  S:     1 MSKELFFDTDARDRLKKGVDALADAVKVTLGPKGRNVILDKKFGAPTITKDGVSVAKEIELEEPIENMGAQLVKEVASKTADNAGDGTTTATVLAQSIFNVGIKNVAAGANPMDLKRGIDKAVTAVVASLRANSKEISTSKEIAQVATVSANNDEEIGTMISNAMDKVGKDGVITVEEAKGTETEVKTVEGMQFDRGYLSPYFVTNTEKMEAELEQPYILIYDKKISSMKELLPVLEPVAQSGKPLVIISEDVDGEALATLVVNKIRGALKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFKLENATTDMLGRAEKINIDKDNTTIVNGSGDATAIKGRVSEIKAQIDKTTSDYDREKLQERLAKLSGGVAILYIGAATEVEMKEKKDRVDDALHATRAAVQEGVVVGGGVALVRASEAL-VDLKGLNEDEDTGINIIRQAIESPLRTIVLNAGGEPSVVINKI-RENKGNYGYNARTDKYEDLFKVGVIDPTKVTRLALENAASIAALLLTTECVVADVKED 526
>gi|67942334|gb|AAY83367.1| HSP60 [Streptococcus criceti] (525 aa)
Score = 1404, Expect = 3.4e-153, Identities = 311/529 (58%), Positives = 413/529 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG+++ V   V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     ++  LGQA  + IDKD++ IV+G G    I ER++ IK+ +E T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V ++  V +L++ GDE  G  IV+ A+  P+ QI  NAG++  V+I E LKA+    GFNAA G +VDM + GIIDPVKV+R ALQNA SV+S++LTTEAV+ D  ++K
  S:     1 MAKDIKFSADARSAMVRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIERAVATAVEGLKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQDVLPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDASIASLGQAAKITIDKDSTVIVEGAGQADAIAERVNVIKSQLETTTSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIEK--VASLDVKGDEATGRNIVLRALEEPVRQIARNAGYEGSVII-EKLKASAVGTGFNAADGSWVDMVEAGIIDPVKVSRSALQNAASVASLILTTEAVVADHPEEK 525
>gi|83589410|ref|YP_429419.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073] >gi|119366178|sp|Q2RL13|CH601_MOOTA 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|83572324|gb|ABC18876.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073] (539 aa)
Score = 1404, Expect = 3.6e-153, Identities = 307/539 (56%), Positives = 411/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AK++ F   AR  L  GV  +  AVKVT+GP+GRNV++++ +G+PVITKDGV+VAKE++L +P ENMGAQL ++VASKT D AGDGTTTATVLA  +  EGL+NV +GANPI +K+G+D+ V  +V+E+ K S  +  K+ I  VA+I+AN +++IGELIA+AMEKVG DGVITVEE+KG    + VVEGM+FDRGY+SPYFVT+T  M A+ E PYILI +KK+S+I D+LP+LE++++TG+PL+IIA+D++GEAL TLVVNK+RG  N  AVKAP FGD+RK ++EDIAILTGG+F+++DLG+  + V L  LG+A+ V I K+ +TIV+G G +  +  RI++IK  IE TDSDYD++ L+ RLAKL  GVAVI+VGA +E ELKEKK RV+DAL+AT+AA+EEGIV GGGA LVH      V  +   GDE +G +IV  A+  P+ QI +NAG + G VI E +++  P +GF+A   +YVDM + GI+DP KVTR ALQNA S++SMLLTTEA+I ++   KE+  PAMP  G
  S:     3 AKQLAFDVEARRALEKGVSTVAQAVKVTLGPKGRNVVLERKFGSPVITKDGVTVAKEIELKDPYENMGAQLCREVASKTNDVAGDGTTTATVLAQAIMLEGLKNVAAGANPIFVKKGIDRAVETVVDEIKKISIPVESKESIAHVASIAAN-EREIGELIADAMEKVGKDGVITVEESKGTATTVEVVEGMEFDRGYVSPYFVTNTEAMEAEFEEPYILIHEKKISAINDLLPLLEKVVRTGKPLVIIAEDIEGEALATLVVNKLRGTLNCAAVKAPGFGDRRKAMMEDIAILTGGTFLSEDLGVKLENVDLNMLGRAKKVKIAKEKTTIVEGYGKKEAVDGRIAQIKKQIEETDSDYDREKLQERLAKLAGGVAVIRVGAATETELKEKKHRVEDALAATRAAVEEGIVPGGGATLVHAIPA--VEKIQAEGDEAVGVRIVRRALEEPLRQIAANAGLE-GSVIVERVRSEQPGIGFDAVKEEYVDMIKAGIVDPAKVTRSALQNAASIASMLLTTEAIIAEIP--KEEKAPAMPPGG 535
>gi|49484255|ref|YP_041479.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus MRSA252] >gi|59797752|sp|Q6GF43|CH60_STAAR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|49242384|emb|CAG41097.1| 60 kDa chaperonin [Staphylococcus aureus subsp. aureus MRSA252] (538 aa)
Score = 1404, Expect = 3.7e-153, Identities = 306/545 (56%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     T+  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +   D     PNM GM GMM
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDATIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEVGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQ----PNMGGMPGMM 538
>gi|119953427|ref|YP_945636.1| 60 kDa chaperonin GroEL [Borrelia turicatae 91E135] >gi|119862198|gb|AAX17966.1| 60 kDa chaperonin GroEL [Borrelia turicatae 91E135] (544 aa)
Score = 1403, Expect = 4.5e-153, Identities = 305/541 (56%), Positives = 418/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS---VPAMPNMGM 541
           MAK+I F++ AR  L +G+++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L N +ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G++  V     ++ KS+KKI  K+EI QVA+ISAN+D  IGE IA AM++VG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ YILI +KK+S+IK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+KAP FGD+RK +LEDIAILTGG FV+++LG++ + V L+ LGQA+SV +DKDN+TI+   G + QIKER   IK  IE T S+YDK+ L+ RLAKL  GVAVI VGAV+E+ELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ V+T  L  +EK G++IV  ++  P+ QI++NAGF+  + I++I K     LGF+AA+ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I +VK++K ++    P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELDNALENMGAQLLKEVAIKTNDLAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIEHAVTLASEKIRKSAKKITTKEEIAQVASISANNDTSIGEKIAEAMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAYILICEKKISTIKELLPVLEKVLNTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKAPGFGDRRKAMLEDIAILTGGVFVSEELGLTLENVELEQLGQAKSVKVDKDNTTIIN-TGNKEQIKERAELIKKQIEETSSEYDKEKLQERLAKLVGGVAVINVGAVTELELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTVDTSKLSYEEKQGFEIVKRSLEEPMRQIIANAGFESSIYIHQI-KTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITEVKEEKSNAGGGYPMDPGMGM 543
>gi|187918505|ref|YP_001884068.1| 60 kDa chaperonin GroEL [Borrelia hermsii DAH] >gi|119861353|gb|AAX17148.1| 60 kDa chaperonin GroEL [Borrelia hermsii DAH] (554 aa)
Score = 1403, Expect = 4.9e-153, Identities = 304/541 (56%), Positives = 415/541 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +G+++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L N  ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D+ V     ++ KS+KKI  K+EI QVA+ISAN+D  IGE IA AM++VG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ YILI +KK+S+IK++LP+LE+++ T +PLLIIA+D++GEAL  LV+N +RG   V A+KAP FGD+RK +LEDIAILTGG  V+++LG++ + V L+ LGQA+S+ +DKDN+TI+   G +  IKER   IK  IE T S+YD++ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ V+T  L  +EK G++IV  ++  P+ QI++NAGF+  + I++I K     LGF+AA+ K+V+M ++GIIDP KVTR ALQNA S+  +LLTTE  I +VK++K ++     P  P MGM
  S:    10 MAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENAFENMGAQLLKEVAIKTNDLAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDRAVTLAAEKIRKSAKKITTKEEIAQVASISANNDTSIGEKIAEAMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAYILICEKKISTIKELLPVLEKVLNTNKPLLIIAEDIEGEALAALVLNSVRGALKVCAIKAPGFGDRRKAMLEDIAILTGGVLVSEELGLTLENVELEQLGQAKSIRVDKDNTTIIN-TGNKEPIKERAELIKKQIEETSSEYDREKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTVDTSKLSYEEKQGFEIVKRSLEEPMRQIIANAGFESSIYIHQI-KTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAASIVGLLLTTECAITEVKEEKSNAGGGGYPMDPGMGM 553
>gi|82703461|ref|YP_413027.1| chaperonin GroEL [Nitrosospira multiformis ATCC 25196] >gi|119366251|sp|Q2Y6I6|CH60_NITMU 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|82411526|gb|ABB75635.1| Chaperonin Cpn60/TCP-1 [Nitrosospira multiformis ATCC 25196] (552 aa)
Score = 1402, Expect = 5.6e-153, Identities = 301/528 (57%), Positives = 411/528 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KFSDSAR+K+ NGV  L DAVKVT+GP+GRNV++++SYG+P ITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + KEG++ V +G NP+++KRG+DK V A V EL K SK      EI QV +ISANSD +IG++IA+AMEKVG +GVITVE+  G+ +EL VVEGMQFDRGY+SPYF+ + ++ IA LE+P+IL+ DKK+S+I+D+LP+LE++ K G+PLLIIA+DVDGEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG+ + +++G+S +K TL +LGQA+ V + K+ +TI+ G G    I+ R+ +I+  IE   SDYDK+ L+ R+AKL  GVA+IKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+     ++    NL G   D+  G +IV+ A+  P+ QIV+N G +  VVIN++L+ T  + G+NAA+ +Y DM Q G++DP KVTR ALQ+A S++ ++LTT+A++ +V  ++
  S:     3 AKEVKFSDSARHKMVNGVNILADAVKVTLGPKGRNVVLERSYGSPTITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQSIVKEGMKYVAAGMNPMDLKRGIDKAVVATVEELKKLSKPCTTGKEIAQVGSISANSDPEIGKIIADAMEKVGKEGVITVEDGSGLQNELEVVEGMQFDRGYLSPYFINNADRQIALLESPFILLHDKKISNIRDLLPVLEQVAKAGKPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGTVIAEEVGLSLEKATLAELGQAKRVEVGKEETTIIDGAGDTQNIEGRVKQIRAQIEEATSDYDKEKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRTRSAVS----NLKGDNHDQDAGIKIVLRALEEPLRQIVANCGDEPSVVINKVLEGTE-NFGYNAASSEYGDMVQMGVLDPTKVTRYALQHAASIAGLMLTTDALVAEVPKEE 528
>gi|15925019|ref|NP_372553.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus Mu50] >gi|15927604|ref|NP_375137.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus N315] >gi|21283682|ref|NP_646770.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus MW2] >gi|49486824|ref|YP_044045.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus MSSA476] >gi|148268482|ref|YP_001247425.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus JH9] >gi|150394545|ref|YP_001317220.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus JH1] >gi|156980345|ref|YP_001442604.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus Mu3] >gi|166201754|sp|A7X4J1|CH60_STAA1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|189082369|sp|A6U3B5|CH60_STAA2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|189082370|sp|A5IUH6|CH60_STAA9 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|54036835|sp|P63767|CH60_STAAW 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|54036842|sp|P99083|CH60_STAAN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|54040885|sp|P63766|CH60_STAAM 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59797747|sp|Q6G7S8|CH60_STAAS 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|13701823|dbj|BAB43116.1| GroEL protein [Staphylococcus aureus subsp. aureus N315] >gi|14247802|dbj|BAB58191.1| GroEL protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21205124|dbj|BAB95818.1| GroEL protein [Staphylococcus aureus subsp. aureus MW2] >gi|49245267|emb|CAG43741.1| 60 kDa chaperonin [Staphylococcus aureus subsp. aureus MSSA476] >gi|147741551|gb|ABQ49849.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus JH9] >gi|149946997|gb|ABR52933.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus JH1] >gi|156722480|dbj|BAF78897.1| GroEL protein [Staphylococcus aureus subsp. aureus Mu3] (538 aa)
Score = 1402, Expect = 6.9e-153, Identities = 305/545 (55%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +   D     PNM GM GMM
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEAGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQ----PNMGGMPGMM 538
>gi|46580385|ref|YP_011193.1| chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602243|ref|YP_966643.1| chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166198455|sp|A1VCQ0|CH60_DESVV 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59797790|sp|Q72AL6|CH60_DESVH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|46449802|gb|AAS96452.1| chaperonin, 60 kDa [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562472|gb|ABM28216.1| chaperonin GroEL [Desulfovibrio vulgaris subsp. vulgaris DP4] (547 aa)
Score = 1402, Expect = 7.1e-153, Identities = 308/530 (58%), Positives = 403/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           +KEI F   AR KL  GV +L +AVKVT+GP+GRNV+I+KS+G+PVITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTAT+LA  +++EG++ V +G NP+ IKRG+DK V ++V EL   +K    + EI QV TISANSD  IG +IA AM KVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  KM+ +L+ P+IL  +KK+S++KD+LP+LE++ K  RPL+IIA+DVDGEAL TLVVNK+RG   VVA+KAP FG++RK +L+DIA+LTGG  V++D+GI  + +++ DLG A+ VVIDK+N+TIV G G    IK R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKKDRV+DAL+AT+AA+EEGIV GGG ALV V+K ++ +      DE  G  I+  AI  P+ QI SNAGF+  +V+  + +  +   GFNAATG+Y D+   G+IDP KVTRIALQNA SV+S+LLTTE  I +  + K+D
  S:     3 SKEILFDTKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIYREGVKLVAAGRNPMAIKRGVDKAVESLVRELGNLAKPTRDQKEIAQVGTISANSDSTIGNIIAEAMSKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDPEKMVCELDEPFILCNEKKISTMKDMLPVLEQVAKMQRPLVIIAEDVDGEALATLVVNKLRGALQVVAIKAPGFGERRKAMLQDIAVLTGGQVVSEDMGIKLENISVADLGTAKRVVIDKENTTIVDGAGKGDDIKARVKQIRAQIEETTSDYDREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTALVRVAKVLD-DIKPADDDETAGVNIIRRAIEEPLRQIASNAGFEGSIVVERVREGKD-GFGFNAATGEYEDLIGVGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKKD 530
>gi|189425979|ref|YP_001953156.1| chaperonin GroEL [Geobacter lovleyi SZ] >gi|189422238|gb|ACD96636.1| chaperonin GroEL [Geobacter lovleyi SZ] (548 aa)
Score = 1401, Expect = 7.5e-153, Identities = 305/521 (58%), Positives = 400/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEI+F++  RN +  GV  L DAVKVT+GP+GRNV+I+KS+G+P+ITKDGVSVAKEV+L N  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++K+G + V +G NP+EIKRG+DK V AIV EL K SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFV+D  +M A LEN  ILI DKK+S++KD+LP+LE+  K+GRPL+IIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LEDIAILTGG  +++++G   +  T++ LG+A+ +V+DKDN+TI+ G G E+ I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +E E+KEKK RV+DAL AT+AA++EGIV GGG A +     +  +++ L  +++ G  I+ S++ +PI QI  NAG D  +V++++ K      G+NAA   YVDM + GIIDP KV+R ALQNA SV+ ++LTTE +I
  S:     3 AKEIRFNEEGRNAILRGVNALADAVKVTLGPKGRNVIIEKSFGSPLITKDGVSVAKEVELENKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYKQGSKLVAAGHNPMEIKRGIDKAVEAIVAELQKISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVSDPERMEATLENATILIYDKKISNMKDMLPVLEQTAKSGRPLMIIAEDIEGEALATLVVNKLRGVLNVCAVKAPGFGDRRKAMLEDIAILTGGKVISEEMGFKLENTTMEMLGRAKRIVVDKDNTTIIDGDGSEADIQGRVKQIRAQIEDTTSDYDREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVAYIRALNAL--DSVVLPAEQQFGVTIIKSSLEAPIRQIADNAGIDASIVVDKV-KNGKEAFGYNAADDTYVDMLEAGIIDPTKVSRCALQNASSVAGLMLTTECMI 520
>gi|57650701|ref|YP_186835.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus COL] >gi|87160700|ref|YP_494633.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus USA300] >gi|151222149|ref|YP_001332971.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510241|ref|YP_001575900.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729307|ref|ZP_02761584.1| chaperone GroEL [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|172048965|sp|A6QIM7|CH60_STAAE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|189082371|sp|A8Z4T2|CH60_STAAT 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68566255|sp|Q5HEH2|CH60_STAAC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|119366267|sp|Q2FF95|CH60_STAA3 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|57284887|gb|AAW36981.1| chaperonin, 60 kDa [Staphylococcus aureus subsp. aureus COL] >gi|87126674|gb|ABD21188.1| 60 kDa chaperonin [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|150374949|dbj|BAF68209.1| chaperonin 60 kDa subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369050|gb|ABX30021.1| chaperone GroEL [Staphylococcus aureus subsp. aureus USA300_TCH1516] (538 aa)
Score = 1401, Expect = 8.6e-153, Identities = 305/545 (55%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +   D     PNM GM GMM
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQ----PNMGGMPGMM 538
>gi|158714743|gb|ABW80158.1| GroEL [Streptococcus sinensis] (540 aa)
Score = 1401, Expect = 9.5e-153, Identities = 317/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V+ L +++  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD+ KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R+  IK+ IE T S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ +  +    +    P+M MGGMM
  S:     1 MAKDIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVSALKETAIPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESILKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVVVIKSQIESTTSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVSVLGA--VAALELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPAPAAPAMDPSM-MGGMM 540
>gi|82751631|ref|YP_417372.1| chaperonin GroEL [Staphylococcus aureus RF122] >gi|119366269|sp|Q2YUD8|CH60_STAAB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|82657162|emb|CAI81602.1| 60 kDa chaperonin protein [Staphylococcus aureus RF122] (538 aa)
Score = 1400, Expect = 1.0e-152, Identities = 305/545 (55%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +   D     PNM GM GMM
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATDEWVNMLEAGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQ----PNMGGMPGMM 538
>gi|158714741|gb|ABW80157.1| GroEL [Streptococcus sinensis] (540 aa)
Score = 1400, Expect = 1.1e-152, Identities = 317/545 (58%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V+ L +++  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD+ KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R+  IK+ IE T S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ +  +    +    P+M MGGMM
  S:     1 MAKDIKFSSDARSAMVRGVAILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVSALKETAIPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESILKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVVVIKSQIESTTSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVSVLGA--VAALELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPAPAAPAMDPSM-MGGMM 540
>gi|154250218|ref|YP_001411043.1| chaperonin GroEL [Fervidobacterium nodosum Rt17-B1] >gi|171769400|sp|A7HNA3|CH60_FERNB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|154154154|gb|ABS61386.1| chaperonin GroEL [Fervidobacterium nodosum Rt17-B1] (538 aa)
Score = 1400, Expect = 1.2e-152, Identities = 300/537 (55%), Positives = 411/537 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           MAK +++S+ AR  L  GV  + +AVK+T+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +   N+GAQLVK+VASKT D AGDGTTTATVLA  + KEGL+ V +GANPI IK+G+DK  + +V E+ K SKK++  ++I  VA+ISANS++ IG+LIA AMEKVG DGVITVE++K I+  +   EGMQFDRGYISPYFVTD  KM      P+ILITD+K+S++K ++PILE++ +TGRPL+IIA+DV+GE LTTLV+NK++G  N VAVKAP FGD+RK +L+DIAILTGG   ++++GI+ + +TLQDLG+A+ V + KD + IV GKG   +IK+R+++IK  IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEK+G QIV +A+ +PI QI  NAG+D  ++I+ +L   +   GF+A  G+Y +M++ GIIDP KVTR ALQNA S++ MLLTTE ++ +  ++K+ + P MP
  S:     1 MAKLLRYSEEARRSLEAGVDAVANAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFANLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKMVAAGANPILIKKGIDKATSKVVEEIKKISKKLSSTEDIAHVASISANSEE-IGKLIAEAMEKVGEDGVITVEDSKTIDTYVEFTEGMQFDRGYISPYFVTDPEKMEVVYNEPFILITDRKLSNVKPLIPILEKVAQTGRPLVIIAEDVEGEVLTTLVLNKLKGTLNTVAVKAPGFGDRRKAMLQDIAILTGGIVASEEVGINLEDLTLQDLGRADVVRVKKDETIIVGGKGKPEEIKKRVAQIKAQIEQTTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGITLLRARKVLEPVLNELTGDEKLGAQIVYNALEAPIRQIALNAGYDGAIIIHNVLSKDDVAYGFDALKGEYCNMYERGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKPAAPEMP 536
>gi|25452880|sp|Q9EZV1|CH60_THENE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|12006275|gb|AAG44819.1|AF275319_2 chaperonin GROEL [Thermotoga neapolitana] (538 aa)
Score = 1400, Expect = 1.2e-152, Identities = 303/537 (56%), Positives = 412/537 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           M K +KF++ AR  L  GV ++ +AVK+T+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANPI +KRG+DK V   V E+ K SKK++ +++I  VA ISANS  +IGELIA AM+KVG DGVITVE++K +   +   EGMQFDRGYISPYFVTD  KM   L+ P ILITD+K+S++K ++PILE++ +TG+PLL+IA+DV+GEALTTLV+NK++G     AVKAP FG++RK +L+DIAILTGG   +++LGI+ + +TL+DLG+A+ V + KD + I+ GKG    IK+RI++IK  IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEKIG QIV  A+ +PI QI  NAG+D  V+I +IL + +P  GF+A  G++ +MF+ GIIDP KVTR ALQNA S++ MLLTTE ++ +  ++K+++ P++P
  S:     1 MPKLLKFNEEARRALERGVDKVANAVKITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQAMIKEGLKNVAAGANPILLKRGIDKAVERAVEEIKKLSKKLSGREDIAHVAAISANS-PEIGELIAEAMDKVGEDGVITVEDSKTLETYVEFTEGMQFDRGYISPYFVTDAEKMEVVLKEPSILITDRKLSAVKPLIPILEKVAQTGKPLLVIAEDVEGEALTTLVLNKLKGTLQSCAVKAPGFGERRKAMLQDIAILTGGQVASEELGINLEDLTLEDLGRADLVRVKKDETIIIGGKGDPEAIKKRIAQIKAQIEETTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLLRSRKAVEKLLEELDGDEKIGAQIVYKALSAPIRQIAENAGYDGAVIIEKILASDDPAYGFDALRGEFGNMFEKGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKET-PSLP 535
>gi|163793752|ref|ZP_02187726.1| feruloyl-CoA synthase [alpha proteobacterium BAL199] >gi|159180863|gb|EDP65380.1| feruloyl-CoA synthase [alpha proteobacterium BAL199] (547 aa)
Score = 1399, Expect = 1.3e-152, Identities = 297/528 (56%), Positives = 413/528 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF   ARNK+  GV  L DAVKVT+GP+GRNV+++KS+GAP ITKDGV+VAKE++L++  ENMGAQ+VK+VASK  D AGDGTTTATVLA  + +EG + V +G NP+++KRG+D  V A+V +L K SKKI+  D++ QV TISAN +++IG +IA AMEKVG++GVITVEEAK ++ EL VVEGMQFDRGY+SPYFVT+ +KM+ +LE+PYIL+ +KKVS+++ +LP+LE+I+++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ V++DLGI  + VTL  LG  + + I KD +TIV G G +  I+ R ++I+  +E T SDYD++ L+ RLAKL  GVAVI+VG  +E+E+KE+KDRVDDA+ AT+AA+EEGI+ GGGAALV+  + +  +  +N   D+++G  IV  A+ +P  QI +NAG D  V++ ++L++ +P+ GF+A  G++VD+ + GIIDP KV R ALQNA S++ +L+TTEA++ D  + K
  S:     3 AKDVKFGIDARNKMLRGVDILADAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEIELSDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVREGGKAVAAGINPMDLKRGIDAAVEAVVADLEKRSKKISTSDQVAQVGTISANGEREIGAMIAKAMEKVGNEGVITVEEAKSLHTELDVVEGMQFDRGYLSPYFVTNADKMVCELESPYILLHEKKVSNLQAMLPVLEQIVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIQLENVTLDMLGTTKRISITKDETTIVDGAGKKKDIEARCAQIRAQVEDTTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGILPGGGAALVYAIRSLEKLKAVN--DDQRMGMNIVRRALEAPARQIATNAGHDGSVIVGKLLESKDPNWGFDAQNGEFVDLIKAGIIDPTKVVRSALQNAASIAGLLVTTEAMVADKPEPK 529
>gi|157363182|ref|YP_001469949.1| chaperonin GroEL [Thermotoga lettingae TMO] >gi|167008697|sp|A8F401|CH60_THELT 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|157313786|gb|ABV32885.1| chaperonin GroEL [Thermotoga lettingae TMO] (539 aa)
Score = 1399, Expect = 1.3e-152, Identities = 295/537 (54%), Positives = 411/537 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           M K ++F + AR  L  GV ++ DAV++T+GP+GRNV+I+KS+G+P IT DGVS+AKE++L +  EN+GAQLVK+VASKT D AGDGTTTATVLA  + +EGL+NV +G+NPI +KRG+DK        +   +KK++ +++I  VA ISANS  +IG+LIA AM+KVG DGVITVE++K +   +   EGMQFDRGYISPYFVTD  KM  +L+ P+ILITDKK+S++K ++P+LE++ +TG+P+L+IA+DV+GEALTTLV+NK++G  +  AVKAP FGD+RK +L+DIAILTGG+ ++D+LGI+ + V ++DLG+A+ V + KD++ I+ GKG   +IK+RI++IK+ IE T S+Y+K++L+ R+AKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEGIV GGG  L+   K +      L GDEK+G  IV  A+ +PI QI  NAG+D  V+I +IL +     GF+A  G+Y DMF+ GIIDP KVTR ALQNA S++ MLLTTE ++ +  ++K+++ PAMP
  S:     1 MPKLLRFDEEARRSLEKGVNKVADAVRITLGPKGRNVVIEKSWGSPTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQSMIREGLKNVAAGSNPILLKRGIDKATEKAAKYIKDKAKKLSGREDIAHVAAISANS-SEIGDLIAEAMDKVGEDGVITVEDSKTLETYVEFTEGMQFDRGYISPYFVTDAEKMEVELKEPFILITDKKLSAVKPLIPVLEKVAQTGKPILVIAEDVEGEALTTLVLNKLKGTLSACAVKAPGFGDRRKAMLQDIAILTGGTVISDELGINLEDVAIEDLGRADIVRVKKDDTIIIGGKGNPEEIKKRIAQIKSQIEQTTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGIVPGGGVTLIRSRKAVEDVLKELDGDEKVGAMIVYKALEAPIRQIAENAGYDGAVIIEKILASKEESYGFDALKGEYTDMFKAGIIDPAKVTRSALQNAASIAGMLLTTEVLVVEKPEEKKEAAPAMP 536
>gi|167575637|ref|ZP_02368511.1| chaperonin GroEL [Borrelia valaisiana VS116] (545 aa)
Score = 1399, Expect = 1.3e-152, Identities = 302/541 (55%), Positives = 418/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  VN    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG+ ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVNLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGTLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|88195925|ref|YP_500736.1| chaperonin GroEL [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|119366268|sp|Q2FWN4|CH60_STAA8 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|87203483|gb|ABD31293.1| chaperonin, 60 kDa, GrpEL, putative [Staphylococcus aureus subsp. aureus NCTC 8325] (538 aa)
Score = 1399, Expect = 1.3e-152, Identities = 304/545 (55%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PY L+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +   D     PNM GM GMM
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYFLVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQ----PNMGGMPGMM 538
>gi|149198394|ref|ZP_01875439.1| chaperonin GroEL [Lentisphaera araneosa HTCC2155] >gi|149138400|gb|EDM26808.1| chaperonin GroEL [Lentisphaera araneosa HTCC2155] (550 aa)
Score = 1399, Expect = 1.4e-152, Identities = 297/528 (56%), Positives = 406/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK++ F ++AR KL +GV++L  AVKVT+GP+GRNV++ KS+G P ITKDGVSVAKE++L  P ENMGAQ+V++VASKTAD AGDGTTTATVLA  +++EGL+NV +GANP+ +KRG+DK V A+V EL   S  +   +++ Q+ATISAN D++IG +IA+AM+KVG DG I VEE+K I   L VV+GMQFD+GY+SPYF TD     A LE+PYILI +KK+++++D+LP+L+E+ KTG+P LIIA+DV+GEAL+TLV+NK+RG  NV AVKAP FGD+RK +LEDIAILTGG  +T+DLG+  + VTL+DLG A+ V++DKDN+ +V GKG +++I  R+  +K  IE + S+YDK+ L+ RLAKL  GVAVI VGA +E E+KEKKDRVDDAL AT+AA++EGIV GGG A  ++  +     + L GDE +G  I+  A  +P+ Q+V+NA  +  +VI ++ +    + GFN AT +YVDM + G+IDP KVTR ALQ+A S+S +LLTTE +I D+K++
  S:     1 MAKQLIFDENARRKLLSGVEKLSKAVKVTLGPKGRNVVLDKSFGTPHITKDGVSVAKEIELECPYENMGAQMVREVASKTADLAGDGTTTATVLAEAIYREGLKNVTAGANPMSLKRGIDKAVAAMVAELANISTPVETNEQVKQIATISANGDEEIGSIIADAMDKVGKDGTIAVEESKTIETTLDVVDGMQFDKGYLSPYFSTDLESREALLEDPYILIFEKKIANLQDMLPLLQEVSKTGKPFLIIAEDVEGEALSTLVINKLRGTLNVCAVKAPGFGDRRKAMLEDIAILTGGKCITEDLGMKLENVTLEDLGSAKRVIVDKDNTVVVDGKGAQAEIMGRVKLLKAQIEESTSEYDKEKLQERLAKLAGGVAVINVGAATETEMKEKKDRVDDALHATRAAVDEGIVAGGGVA--YIRAQAVAAGIELSGDEAVGASIIARACEAPLRQLVNNAAGEASIVIAKVREGEGNY-GFNVATDEYVDMLEAGVIDPKKVTRSALQHAGSISGLLLTTECLITDIKEE 525
>gi|4566773|gb|AAD23455.1| chaperonin GroEL [Streptococcus pneumoniae] (540 aa)
Score = 1399, Expect = 1.4e-152, Identities = 315/545 (57%), Positives = 413/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+ RNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV ++ASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V       TL L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK     +GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+ + K +     PAM    MGGMM
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKDRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEIASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAISQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--EATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVAN-KPEPVAPAPAMDPSMMGGMM 540
>gi|34498688|ref|NP_902903.1| chaperonin GroEL [Chromobacterium violaceum ATCC 12472] >gi|68566282|sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|34104540|gb|AAQ60898.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472] (538 aa)
Score = 1399, Expect = 1.4e-152, Identities = 296/534 (55%), Positives = 410/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AKE++F D+AR ++ NGV  L DAVKVT+GP+GRNVL+ +S+GAP ITKDGVSVAKE++L +P ENMGAQ+VK+VASKTAD AGDGTTTATVLA  + +EG++ V SG NP+++KRG+DK V+A++ EL   SK +    E  QVA +SANSD+ IG++IA+AM+KVG +GVITVE+ K +++EL VVEGMQFDRGY+SPYF+TD  K  A LE+P +L+ DKK+S+I+D+LP+LE++ K G+PLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTGG+ + ++ G++ +K  L +LG A+ V I K+N+TI+ G G +++I  R+  I+  I+   SDYD++ L+ R+AKL+ GVAVI++GA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+     I      L G   D+  G QIV+ A+ +P+  I +NAG +  V++N++L+    H G+NAA+G++ D+ + G+IDP KVTR ALQNA S++S++LTT+A + +   D +   PA
  S:     3 AKEVRFHDNARERIVNGVNVLADAVKVTLGPKGRNVLLARSFGAPHITKDGVSVAKEIELKDPFENMGAQMVKEVASKTADVAGDGTTTATVLAQAIVQEGMKYVASGMNPMDLKRGIDKAVHAVIKELQTLSKPVTNSKETAQVAALSANSDEAIGKIIADAMDKVGKEGVITVEDGKSLDNELAVVEGMQFDRGYLSPYFITDPEKQTAVLEDPLVLLYDKKISNIRDLLPVLEQVAKAGKPLLIVAEDVEGEALATLVVNSMRGILKVAAVKAPGFGDRRKAMLEDIAILTGGTVIAEETGLTLEKAGLAELGSAKRVEIGKENTTIIDGAGDKAKIDARVQAIRAQIDAATSDYDREKLQERVAKLSGGVAVIRIGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALLRARAHIK----ELKGDNPDQDAGIQIVLRALEAPLRAIAANAGDEPSVIVNKVLEGKGNH-GYNAASGQFGDLVEMGVIDPTKVTRTALQNAASIASLILTTDATVAEAGQDSKAKAPA 534
>gi|86609172|ref|YP_477934.1| chaperonin GroEL [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119366216|sp|Q2JKV7|CH602_SYNJB 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|86557714|gb|ABD02671.1| chaperonin GroEL [Synechococcus sp. JA-2-3B'a(2-13)] (539 aa)
Score = 1399, Expect = 1.5e-152, Identities = 287/529 (54%), Positives = 402/529 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK I F + AR  L  G+ QL DA+KVT+GP+GRNV+++K +GAP I  DGV++AKE++L +P+EN GAQL+++VASKT D AGDGTTTAT+LA  + +EGL+N+ +GANP+ ++RG++KT   +V ++   +K +  +  I +VATISA +D ++GE+IA AM+ VG DGVITVEE+K +  EL VVEGMQFDRGYISPYFVTD+ +M+A+ EN Y+LIT  K+SS++D++PILE + + GRPLL+IA+DV+GEAL TLVVN++RGV N VAVKAP FGD+RK +LEDIAILTGG  +++D+GI  DKVTL  +G A  + + KD +TIV     ++ +++R+++I+  +E TDS+YD++ L+ R+AKL  GVAVIKVGA +E ELK++K R++DAL+AT+AA+EEGIV GGGA L+H+SK I      L  +E++G +IV  A+ +P+ QI  NAG +  VV+ ++L+   P  GF+A TG YVDMF  GI+DP KV R ALQNA S++ M LTTEA++ +  + K
  S:     1 MAKRILFREEARKALEQGINQLADAIKVTIGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELADPLENTGAQLMREVASKTNDVAGDGTTTATILAQSMVREGLKNISAGANPVALRRGIEKTTAYLVEQIAAHAKPVEGRKTIAEVATISAGNDSEVGEMIAKAMDAVGRDGVITVEESKSLETELDVVEGMQFDRGYISPYFVTDSERMVAEYENAYLLITSNKISSLQDLVPILERVAREGRPLLVIAEDVEGEALATLVVNRLRGVLNAVAVKAPAFGDRRKAMLEDIAILTGGQLISEDVGIKLDKVTLDMMGVARKITVTKDKTTIVTDGSTKAAVEKRVAQIRKQLETTDSEYDREKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATRAAVEEGIVPGGGATLLHLSKGIPAFKAKLNAEEQVGAEIVYRALQAPLFQIAHNAGLEGSVVVEKVLEKEMP-FGFDALTGTYVDMFAQGIVDPAKVVRSALQNAASIAGMYLTTEAIVVEKPEPK 528
>gi|86605052|ref|YP_473815.1| chaperonin GroEL [Synechococcus sp. JA-3-3Ab] >gi|119366191|sp|Q2JXD4|CH601_SYNJA 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|86553594|gb|ABC98552.1| chaperonin GroEL [Synechococcus sp. JA-3-3Ab] (542 aa)
Score = 1399, Expect = 1.5e-152, Identities = 290/545 (53%), Positives = 408/545 (74%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+I F + AR  L  G+ QL DAVKVT+GP+GRNVL++K +GAP I  DGV++AKE++L +P+EN GAQL+++VA+KT D AGDGTTTAT+LA  + +EGL+N+ +GANP+ ++RG++KT   +V ++   +K +  +  I +VATISA +D ++GE+IA AM+ VG DGVITVEE+K +  +L VVEGMQFDRGYISPYFVTDT +M+A+ EN Y+LIT  K+S+++D++P+LE + + GRPLL+IA+DV+GEAL TLVVNK+RGV N VAVKAP FGD+RK +LEDIAILTGG  +++D+GI  + VTL  +G A  + + KD +TIV     ++ +++R+++I+  +E TDS+YD++ L+ R+AKL  GVAVIKVGA +E ELK++K R++DAL+AT+AA+EEGIV GGGA L+H+SK I     NL  +E++G  IV  A+ +P+ QI  NAG +  VV+ ++L+   P  GF+A TG YVDMF  GI+DP KV R ALQNA S+++M LTTEA++ +  + K  +       G  GMM
  S:     1 MAKQILFREEARKALEQGINQLADAVKVTIGPKGRNVLLEKKFGAPQIVNDGVTIAKEIELADPLENTGAQLMREVATKTNDVAGDGTTTATILAQSMVQEGLKNISAGANPVALRRGIEKTTAYLVEQIAAQAKPVEGRKNIAEVATISAGNDPEVGEMIARAMDAVGRDGVITVEESKSLETQLEVVEGMQFDRGYISPYFVTDTERMVAEYENAYLLITSNKLSNLQDLVPVLERVAREGRPLLVIAEDVEGEALATLVVNKLRGVLNAVAVKAPAFGDRRKAMLEDIAILTGGQLISEDIGIKLENVTLDMMGVARKITVTKDKTTIVTDGSTKAAVEKRVAQIRKQLETTDSEYDREKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATRAAVEEGIVPGGGATLLHLSKGIPAFKANLNAEEQVGADIVCRALQAPLYQIAHNAGLEGSVVVEKVLEKEMP-FGFDALTGTYVDMFAQGIVDPAKVVRSALQNAASIAAMYLTTEAIVVEKPEPKTKT--GASRSGGAGMM 542
>gi|21666290|gb|AAM73642.1|AF389514_2 GroEL [Streptococcus equinus] (537 aa)
Score = 1399, Expect = 1.6e-152, Identities = 311/522 (59%), Positives = 404/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+      +  LGQA  V +DKD++ IV+G G  S I  R++ IK+ +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L L GDE  G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARASMMRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIESAVAVAVDELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLDLKDANMTALGQAAKVTVDKDSTVIVEGAGEASSIANRVNVIKSQLEATTSEFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVISK--VAELELDGDEATGRNIVLRALEEPVRQIAFNAGYEGSVII-EHLKNSEVGTGFNAANGEWVNMVEAGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|172058771|ref|YP_001815231.1| chaperonin GroEL [Exiguobacterium sibiricum 255-15] >gi|171991292|gb|ACB62214.1| chaperonin GroEL [Exiguobacterium sibiricum 255-15] (545 aa)
Score = 1399, Expect = 1.6e-152, Identities = 305/538 (56%), Positives = 407/538 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+I FS+ AR  +  GV  L DAVKVT+GP+GRNV++++ +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT + AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V   V EL+  +K I  K+ I QVA ISA +D+++G+LIA AME+VG DGVIT+EE++G   EL VVEGMQFDRGY SPY +TD++KM A LENPYILITDKK+S+I++ILP+LE++++  +PLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI+I+TG   +T++LG+   +  +  LG+A  VV+ KDN+TIV+G G    I  R+  I++ IE T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL+AT+AA+EEGIV GGG A +HV+K +        GDE  G  IV+ A+ +P+ QI  NAG  +G VI E LK     +G+NAAT +YVDM +TGI+DP KVTR ALQNA SVS+M LTTEAVI D  +      PAMP+
  S:     1 MAKDILFSEEARRAMLRGVDALADAVKVTIGPKGRNVVLERKFGSPLITNDGVTIAKEIELEDHFENMGAKLVAEVASKTNEIAGDGTTTATVLAQAMIREGLKNVTAGANPMVIRKGIEKAVRRAVEELHAIAKPIEGKEAIAQVAAISA-ADEEVGQLIAEAMERVGQDGVITIEESRGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLENPYILITDKKISNIQEILPVLEQVVQQNKPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISIVTGAELITEELGLDLKETQITQLGRASKVVVSKDNTTIVEGNGHSDSITARVGAIRSQIEETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNATRAAVEEGIVAGGGTAFIHVTKAVESILAVTTGDEATGVNIVLRALEAPLRQIAENAG-QEGSVIVERLKHEAQGMGYNAATDEYVDMIETGIVDPAKVTRSALQNAASVSAMFLTTEAVIADKPEPA--GAPAMPD 534
>gi|83630233|gb|ABC26732.1| GroEL [Streptococcus pasteurianus] (532 aa)
Score = 1398, Expect = 1.7e-152, Identities = 312/522 (59%), Positives = 404/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+      +  LGQA  V +DKD++ IV+G G  S I  R++ IK+ +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L L GDE  G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARASMMRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIESAVAVAVDELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLDLKDANMTALGQAAKVTVDKDSTVIVEGAGEASAIANRVNVIKSQLEATTSEFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVISK--VAELELDGDEATGRNIVLRALEEPVRQIAFNAGYEGSVII-EHLKNSEVGTGFNAANGEWVNMVEAGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|70780023|gb|AAZ08333.1| GroEL [Streptococcus ratti] (531 aa)
Score = 1398, Expect = 1.7e-152, Identities = 312/524 (59%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+ L   ++ ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  V IDKD + IV+G G +  I+ R++ IK+ IE T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V ++  V  L+L  D   G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAA G++VDM + GIIDPVKVTR ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSAMVRGVDTLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVATAVDGLKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKNATMDALGQAARVTIDKDTTVIVEGSGSKEAIENRVALIKSQIETTTSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTALINVIEK--VAALDLEDDAATGRNIVLRALEEPVRQIAKNAGYEGSVVIDK-LKNSPVGTGFNAANGEWVDMIKEGIIDPVKVTRSALQNAASVASLILTTEAVVAD 520
>gi|119897265|ref|YP_932478.1| chaperonin GroEL [Azoarcus sp. BH72] >gi|187470734|sp|A1K436|CH601_AZOSB 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|119669678|emb|CAL93591.1| chaperonin GroEL [Azoarcus sp. BH72] (549 aa)
Score = 1398, Expect = 1.8e-152, Identities = 299/528 (56%), Positives = 411/528 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DSAR ++  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A + EL K SK  +   EI QV +ISANSD  IG +IA AMEKVG +GVITVE+ K +N+EL VVEGMQFDRGY+SPYF+ + +K +A LENP++L+ DKK+S+I+D+LP+LE++ K GRPLLIIA+DVDGEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG  + +++G++ +K TLQDLGQA+ + I K+N+ I+ G G  S+I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+    R   +   L G   D+  G +IV+ A+  P+ +IV+NAG +  VV+N++++ +  + G+NAATG+Y DM + G++DP KVTR ALQNA SV+S++LTT+ ++ ++ +DK
  S:     3 AKEVKFGDSARERMVAGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVVATIEELKKLSKPCSTNKEIAQVGSISANSDADIGGIIAQAMEKVGKEGVITVEDGKSLNNELDVVEGMQFDRGYLSPYFINNPDKQVAILENPFVLLFDKKISNIRDLLPVLEQVAKAGRPLLIIAEDVDGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGQVIAEEVGLTLEKATLQDLGQAKRIEIGKENTIIIDGAGEASRIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL----RARASLAGLKGDNHDQDAGIKIVLRAMEQPLREIVANAGDEASVVVNKVVEGSG-NFGYNAATGEYGDMVEMGVLDPTKVTRTALQNAASVASLMLTTDCMVGELAEDK 528
>gi|51598904|ref|YP_073092.1| chaperonin GroEL [Borrelia garinii PBi] >gi|59797701|sp|Q660M1|CH60_BORGA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|51573475|gb|AAU07500.1| heat shock protein [Borrelia garinii PBi] (545 aa)
Score = 1398, Expect = 1.8e-152, Identities = 303/541 (56%), Positives = 417/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  VN    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LGI+ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVNLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGITLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|116249307|ref|YP_765148.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841] >gi|118597102|sp|Q1M3H2|CH603_RHIL3 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|115253957|emb|CAK12352.1| putative 60 kDa chaperonin [Rhizobium leguminosarum bv. viciae 3841] (542 aa)
Score = 1398, Expect = 2.0e-152, Identities = 303/536 (56%), Positives = 409/536 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AKEIKFS  AR K+  GV  L +AVK T+GP+GRNV+I++S+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V AIV EL  +++KI+   EI QV TISAN D +IG  +A AME+VG+DGVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E+PYILI +KK+S+++ +LP+LE ++++ +PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ +++DLGI  + VTL  LG+A+ V I+K+N+TIV G G +S I+ R+++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K + NV T N  GD+++G  IV  A+ +P  QI  NAG +  V++ ++ + +    G+NA TG+Y D++  G+IDP KV R ALQ+A S++ +L+TTEA+I   +  ++D+ P MP
  S:     3 AKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDNVETAN--GDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMI--AEKPRKDAPPPMP 535
>gi|196041107|ref|ZP_03108403.1| chaperonin GroL [Bacillus cereus NVH0597-99] >gi|196028042|gb|EDX66653.1| chaperonin GroL [Bacillus cereus NVH0597-99] (544 aa)
Score = 1397, Expect = 2.3e-152, Identities = 309/538 (57%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M +TGI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|193215324|ref|YP_001996523.1| chaperonin GroEL [Chloroherpeton thalassium ATCC 35110] >gi|193088801|gb|ACF14076.1| chaperonin GroEL [Chloroherpeton thalassium ATCC 35110] (550 aa)
Score = 1397, Expect = 2.3e-152, Identities = 312/529 (58%), Positives = 401/529 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVH-VSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           AKEI F    RN L  GV +L DAVKVT+GP GRNV+I K +GAP +TKDGV+VAKEV+L +P+ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GANP+++KRG+DK V  ++ EL K S+ IA K EI QV  ISAN+D +IG+LIA AMEKVG DGVITVEEAKG   EL VVEGMQFDRGY+SPYFVT+ + M A L+ PYILI DKK+S++K++LPILE+  ++GRPLLIIA++++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA SV IDKDNSTIV+GKG E  IK RI++IK  +E   SDYDK+ L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV GGG AL+  V+   NV   N   D+K G +I+  A+  P+ QIV+N G   G V+   +K      GFNA T  + +M   G+IDP  VTR AL+NA SV+ +LLTTEAVI +  +D++
  S:     3 AKEIHFDAEGRNALKRGVDKLADAVKVTLGPAGRNVIIDKKFGAPTVTKDGVTVAKEVELEDPVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVTAGANPMDLKRGIDKAVTGVIIELKKISRPIADKKEIAQVGCISANNDSEIGDLIAEAMEKVGKDGVITVEEAKGTETELKVVEGMQFDRGYLSPYFVTNADSMEAVLDEPYILIYDKKISNMKELLPILEKTAQSGRPLLIIAEEIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATIGYLGQAGSVTIDKDNSTIVEGKGTEDDIKARINEIKNQVEKATSDYDKEKLQERLAKLSGGVAVLNIGATTEVEMKEKKARVEDALHATRAAVQEGIVAGGGVALIRAVTGLENVQVEN--EDQKTGLEIIRRALEEPLRQIVANTGTVDGSVVVMKVKEGKDDFGFNARTETFENMIAAGVIDPTMVTRTALENAASVAGLLLTTEAVISEKPEDEK 530
>gi|53803988|ref|YP_114145.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath] >gi|68566273|sp|Q607Q3|CH602_METCA 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|53757749|gb|AAU92040.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath] (542 aa)
Score = 1397, Expect = 2.3e-152, Identities = 309/544 (56%), Positives = 409/544 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           AKE++FSD AR+++  GV  L DAVK T+GP+GRNV+++KS+GAPV+TKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EGL++V +GANP++IKRG+D+ V  +V EL K SK       I QV TISANSD+ IG++IA AM+ VG +GVITVEE  G+ +EL VVEGMQFDRGY+SPYF+   + M  +LENPY+L+ DKK+SSI+D+LP+LE+  K GR LLIIA+DVDGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTGG  ++++LG+S +KV L DLGQA+ + I+K+ +TIV G G    IK R+ +I+  IE T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+   + +      L G   D+ +G  I+  AI  P+ QIV+NAG +  VV+ ++ + T    G+NA T +Y DM + GI+DP KVTR ALQNA SV+ ++LTTEA++ ++   ++  +PA    GM  MM
  S:     3 AKEVRFSDDARHRMLAGVNILADAVKQTLGPKGRNVVLEKSFGAPVVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGLKSVAAGANPMDIKRGIDQAVGVVVEELKKLSKPCTDSKAIAQVGTISANSDESIGQIIAQAMDTVGKEGVITVEEGSGLQNELDVVEGMQFDRGYLSPYFINKQDTMGVELENPYVLLHDKKISSIRDLLPVLEKTAKAGRSLLIIAEDVDGEALATLVVNNMRGILKVCAVKAPGFGDRRKAMLEDIAILTGGQVISEELGLSLEKVELTDLGQAKKIQINKETTTIVDGAGSADAIKARVEQIRKQIEDTTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRAQQALK----TLEGKNHDQTVGIAILRRAIEEPLRQIVANAGEEPSVVLAKVQEGTGT-FGYNAGTAEYGDMIEMGILDPTKVTRSALQNAASVAGLMLTTEAMVAEMPKKEKGGMPA--GGGMDDMM 542
>gi|35187728|gb|AAQ84338.1| GroEL [Enterococcus faecium] (524 aa)
Score = 1397, Expect = 2.4e-152, Identities = 312/524 (59%), Positives = 407/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKE+KF++ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QVA +S+ SDK +G LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I+ R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V+ +   GD   G +IV+ A+  PI QI  NAG++  V++++ LK      GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISTVVDSKETIAQVAAVSSGSDK-VGHLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDATIENLGNASKVVVDKDNTTIVEGSGEKEAIEARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVISK--VSAVEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVELGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|58040332|ref|YP_192296.1| chaperonin GroEL [Gluconobacter oxydans 621H] >gi|68566253|sp|Q5FPQ6|CH60_GLUOX 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|58002746|gb|AAW61640.1| Chaperonin GroEL [Gluconobacter oxydans 621H] >gi|77539353|dbj|BAE46549.1| GroEL [Gluconobacter oxydans] (543 aa)
Score = 1397, Expect = 2.6e-152, Identities = 305/543 (56%), Positives = 408/543 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AK++KF   AR ++  GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V  +V++L  ++KKI   +EI QV TISAN + +IGE+IA+AM+KVGS+GVITVEEAKG++ EL VVEGMQFDRGYISPYFVT+  KM A L++PYILI +KK+SS++ +LP+LE ++++GRPL+IIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG  +++D+GI  + VTL+ LG+A+ + I+K+N+TIV+G G    IK R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL   S  +   T +   D+++G +IV  A+ +P+ QI  NAG D  V+  ++L+      GF+A  G+Y D+   GIIDP KV R ALQ+A SV  +L+TTEA+   V +  E   PA    GMG M
  S:     3 AKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGIDKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSPYILIHEKKLSSLQPMLPLLESVVQSGRPLVIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEDIGIKLESVTLEMLGRAKKIHIEKENTTIVEGAGNSDDIKGRCNQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALARASSALKGLTFD-NDDQRVGGEIVRKALQAPLRQIAFNAGEDGAVIAGKVLENEGYVFGFDAQKGEYKDLVAAGIIDPTKVVRTALQDAASVGGLLITTEAM---VAERPEKKAPAAAPGGMGDM 541
>gi|194335946|ref|YP_002017740.1| chaperonin GroEL [Pelodictyon phaeoclathratiforme BU-1] >gi|194308423|gb|ACF43123.1| chaperonin GroEL [Pelodictyon phaeoclathratiforme BU-1] (547 aa)
Score = 1397, Expect = 2.7e-152, Identities = 306/530 (57%), Positives = 409/530 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L++P ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D  IG+LIA+AM+KVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT++  M A+LE+P ILI DKK+S++K++LPILE+  ++GRPLLII++D++GEAL T+VVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA  V +DKDN+TIV+GKG   +IK RI++IK  +E + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K ++   +    D+K G +I+  A+  P+ QIV+N G   G V+ E +KA     GFNA T +Y ++ + G++DP KVTR AL+NA SV+S+LLTTEA I DVK++K D
  S:     3 AKDILFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELSDPFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVQELRNISRSISGKKEIAQVGTISANNDPVIGDLIADAMDKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNSETMDAELEDPLILIYDKKISNMKELLPILEKSAQSGRPLLIISEDIEGEALATIVVNKLRGTLRVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATISYLGQAGRVTVDKDNTTIVEGKGGAEEIKARINEIKGQVEKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGLD-RAIADNEDQKTGIEIIRRALEEPLRQIVANTGTTDGAVVLERVKAGTGDFGFNARTEQYENLVEAGVVDPTKVTRSALENAASVASILLTTEAAITDVKEEKSD 531
>gi|158714745|gb|ABW80159.1| GroEL [Streptococcus sinensis] (540 aa)
Score = 1396, Expect = 2.8e-152, Identities = 316/545 (57%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V+ L +++  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD+ KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DK+++ IV+G G    I  R+  IK+ IE T S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ +  +    +    P+M MGGMM
  S:     1 MAKDIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVSALKETAIPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLDNPYILITDKKISNIQEILPLLESILKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKESTVIVEGSGNPEAIANRVVVIKSQIESTTSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVSVLGA--VAALELTGDEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEAGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPAPAAPAMDPSM-MGGMM 540
>gi|116250|sp|P26209|CH60_BACP3 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat shock 61 kDa protein) (538 aa)
Score = 1396, Expect = 2.8e-152, Identities = 313/545 (57%), Positives = 415/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I+RG++K V   V EL   SK I  K+ I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY+SP  +TDT KM A LENPYILITDKKVSSI+++LP LE++++ GRPLLIIA+DV+GEAL TLVVNK+RG FN V VKAP FGD+RK +LEDIAILTGG  ++++LG      T+  LG+A  VV+ K+ +TIV+G G   +IK  I++I+  ++ T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGI  GGG AL+++  +  V  +   GDE  G +IV+ AI  P+ QI  NAG + G +I E LK   P +GFNAATG++VDM + GI+DP KVTR ALQNA SV++M+LTTEA + D K ++      MP+  MGGMM
  S:     1 MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPNMITDTEKMEAVLENPYILITDKKVSSIQELLPALEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVRVKAPGFGDRRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRASKVVVTKETTTIVEGAGDSKRIKAAINQIRAQLKETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIGAGGGTALMNIHNK--VAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE-GSIIVERLKNEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEACVAD-KPEENKGNNNMPD--MGGMM 538
>gi|47567508|ref|ZP_00238220.1| chaperonin, 60 kDa [Bacillus cereus G9241] >gi|122063314|sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|47555910|gb|EAL14249.1| chaperonin, 60 kDa [Bacillus cereus G9241] (544 aa)
Score = 1396, Expect = 3.0e-152, Identities = 309/538 (57%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M +TGI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGIGNTQQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|189499745|ref|YP_001959215.1| chaperonin GroEL [Chlorobium phaeobacteroides BS1] >gi|189495186|gb|ACE03734.1| chaperonin GroEL [Chlorobium phaeobacteroides BS1] (550 aa)
Score = 1396, Expect = 3.1e-152, Identities = 312/530 (58%), Positives = 407/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F  SAR KL  GV +L DAVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L +  ENMGAQ+V++V+SKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+DK V  ++ EL   S  I+ K EI QV TISAN+D +IG+LIA+AMEKVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT++ KM A+LE+PYILI DKK+S++KD+LPILE+  ++GRPL+II++D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA +V +DKDN+TIV+GKG    IK RI++IK  I+ + SDYD + L+ RLAKL+ GVAVI +GA +EVE+KEKK RV+DAL AT+AA++EGIV GGG AL+  +K + NV   N   D+K G +IV  A+  P+ QIV+N G   G V+ E +K      GFNA T +Y  M + G++DP KVTR AL+NA SV+ +LLTTEA I D+K++  D
  S:     3 AKDILFDASARAKLKVGVDKLADAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELEDSFENMGAQMVREVSSKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDKAVKEVIGELRTISNDISGKIEIAQVGTISANNDPEIGQLIADAMEKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNSEKMDAELEDPYILIHDKKISNMKDLLPILEKTAQSGRPLMIISEDIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATISYLGQAATVTVDKDNTTIVEGKGQADDIKARINEIKNQIDASTSDYDTEKLQERLAKLSGGVAVINIGASTEVEMKEKKARVEDALHATRAAVQEGIVAGGGVALIRAAKGLDNVQPEN--EDQKTGVEIVRRALEEPLRQIVANTGTTDGAVVVERVKQGEGDFGFNARTEEYEKMTEAGVVDPTKVTRTALENAASVAGILLTTEAAITDIKEEGGD 531
>gi|86160012|ref|YP_466797.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C] >gi|119366196|sp|Q2IFK0|CH602_ANADE 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|85776523|gb|ABC83360.1| chaperonin Cpn60, GroEL [Anaeromyxobacter dehalogenans 2CP-C] (547 aa)
Score = 1396, Expect = 3.1e-152, Identities = 306/534 (57%), Positives = 402/534 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AKEI F   AR+ +  GV  L DAVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG + V +G NP+++KRG+DK V AIV EL K SK      EI QV  ISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  +M A LE+ YILI +KK+S++KD+LP+LE+I ++G+PL+I+A++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK +LEDIAILTGG  + ++LG+  ++VTL+DLG+A+ V +DKDN+TIV G G +  I+ R+  I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +   K +    +N    EK+G  IV  AI  P+ QI  N G++  +V+N++ +A     GFNAATG+Y D+ + G+IDP KV+R ALQNA SV+S++LTT A++ + K  +E + PA
  S:     3 AKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGIDKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQIARSGKPLIIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRMIAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRCVKALEGVKVN--EGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNAATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMVAE-KPKEESAAPA 533
>gi|171778902|ref|ZP_02919964.1| hypothetical protein STRINF_00825 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282548|gb|EDT47972.1| hypothetical protein STRINF_00825 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (542 aa)
Score = 1396, Expect = 3.1e-152, Identities = 317/543 (58%), Positives = 411/543 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG---MGG 543
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTG + +T+DLG+      +  LGQA  V +DKD++ IV+G G    I  RI+ IK+ +  T S++D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L L GDE  G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ +   +   S PA P M    MGG
  S:     1 MAKDIKFSSDARASMMRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAAVKVAVDELKSIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGATVITEDLGLELKDANMAALGQAAKVTVDKDSTVIVEGAGDADAIANRINVIKSQLVSTTSEFDREKLQERLAKLAGGVAVIKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVISK--VAELELDGDEATGRNIVLRALEEPVRQIAFNAGYEGSVII-ERLKNSEVGTGFNAANGEWVNMVEAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-HPEPAASTPAAPGMDPSMMGG 541
>gi|49479104|ref|YP_034593.1| chaperonin GroEL [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52144977|ref|YP_081854.1| chaperonin GroEL [Bacillus cereus E33L] >gi|118476013|ref|YP_893164.1| chaperonin GroEL [Bacillus thuringiensis str. Al Hakam] >gi|166985473|ref|ZP_02256756.1| chaperonin GroEL [Bacillus cereus AH187] >gi|166995258|ref|ZP_02261718.1| chaperonin GroEL [Bacillus cereus AH820] >gi|168164068|ref|ZP_02599301.1| chaperonin GroEL [Bacillus cereus H3081.97] >gi|196036857|ref|ZP_03104245.1| chaperonin GroL [Bacillus cereus W] >gi|196046195|ref|ZP_03113422.1| chaperonin GroL [Bacillus cereus 03BB108] >gi|166198434|sp|A0R8W4|CH60_BACAH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59797687|sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59797762|sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68566271|sp|Q73ER9|CH60_BACC1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|49330660|gb|AAT61306.1| 60 kDa chaperonin (Protein Cpn60) (class I heat-shock protein) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978446|gb|AAU19996.1| 60 kDa chaperonin (Protein Cpn60) (class I heat-shock protein) [Bacillus cereus E33L] >gi|118415238|gb|ABK83657.1| 60 kDa chaperonin [Bacillus thuringiensis str. Al Hakam] >gi|195990539|gb|EDX54519.1| chaperonin GroL [Bacillus cereus W] >gi|196022940|gb|EDX61620.1| chaperonin GroL [Bacillus cereus 03BB108] (544 aa)
Score = 1396, Expect = 3.3e-152, Identities = 310/538 (57%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A V EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M +TGI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|15594994|ref|NP_212783.1| chaperonin GroEL [Borrelia burgdorferi B31] >gi|167931923|ref|ZP_02519010.1| chaperonin GroEL [Borrelia burgdorferi 156a] >gi|167933404|ref|ZP_02520479.1| chaperonin GroEL [Borrelia burgdorferi ZS7] >gi|167943581|ref|ZP_02530655.1| chaperonin GroEL [Borrelia burgdorferi Bol26] >gi|168526032|ref|ZP_02719671.1| chaperonin GroEL [Borrelia burgdorferi 118a] >gi|168579689|ref|ZP_02723685.1| chaperonin GroEL [Borrelia burgdorferi 72a] >gi|168692379|ref|ZP_02725171.1| chaperonin GroEL [Borrelia burgdorferi 94a] >gi|195941469|ref|ZP_03086851.1| chaperonin GroEL [Borrelia burgdorferi 80a] >gi|195949284|ref|ZP_03090384.1| chaperonin GroEL [Borrelia burgdorferi WI91-23] >gi|195951033|ref|ZP_03092130.1| chaperonin GroEL [Borrelia burgdorferi 29805] >gi|195955091|ref|ZP_03093784.1| chaperonin GroEL [Borrelia burgdorferi CA-11.2a] >gi|195959319|ref|ZP_03095528.1| chaperonin GroEL [Borrelia sp. SV1] >gi|195960389|ref|ZP_03096594.1| chaperonin GroEL [Borrelia burgdorferi 64b] >gi|3915632|sp|P27575|CH60_BORBU 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|39374|emb|CAA46269.1| 60 kDa heat shock protein [Borrelia burgdorferi] >gi|2688576|gb|AAC66995.1| heat shock protein (groEL) [Borrelia burgdorferi B31] (545 aa)
Score = 1396, Expect = 3.4e-152, Identities = 302/541 (55%), Positives = 417/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  VN    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVNLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVNFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|108758906|ref|YP_632638.1| chaperonin GroEL [Myxococcus xanthus DK 1622] >gi|118597089|sp|Q1D3Y5|CH601_MYXXD 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|45720242|emb|CAG17587.1| chaperonin GroEL [Myxococcus xanthus] >gi|108462786|gb|ABF87971.1| chaperonin GroEL [Myxococcus xanthus DK 1622] (547 aa)
Score = 1396, Expect = 3.5e-152, Identities = 302/521 (57%), Positives = 400/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEI F  SAR  +  GV+ L DAV VT+GP+GRNV+I+KS+G+P ITKDGV+VAKE+DL N  ENMGAQ+VK+VASKT+D+AGDGTTTATVLA  +++EGL+ V +G +P+++KRG+DK V  +V EL   SK  A K  I QV TISAN D+ IG +IA+AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVT+  +M A LE+PYILI++KKVSS++D++P+LE++ ++G+PL+IIADD++GEAL TLVVNK+RGV NV AVKAP FGD+RK++L+DIA+LTGG+ V++DLG  F+ +TL DLG+A+ V +DKDN+T+V G G ++ I+ RI  I+T I+   SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +    L   G++  G  I+  A+  P+ +I SNAG +  VVIN++ + T    G+NA T  Y D+ + G+IDP KV R ALQNA SV+S+LLTTEA++
  S:     3 AKEIFFHQSAREAILRGVRTLSDAVAVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIDLENKFENMGAQMVKEVASKTSDKAGDGTTTATVLARAIYEEGLKLVAAGHSPMDLKRGIDKAVEVVVGELKSLSKPTADKKAITQVGTISANGDETIGAIIADAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYVSPYFVTNRERMEAVLEDPYILISEKKVSSMQDMIPLLEQVARSGKPLIIIADDIEGEALATLVVNKIRGVLNVCAVKAPGFGDRRKEMLQDIAVLTGGTVVSEDLGHKFETLTLTDLGRAKRVTVDKDNTTVVDGVGTKAAIEGRIKLIRTQIDSVTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRALPAL--EKLKPGGEQDFGVAIIRRALQEPLRKIASNAGVEGAVVINKVREGTGA-FGYNARTEVYEDLEKAGVIDPTKVERTALQNAASVASLLLTTEAMV 520
>gi|86143882|ref|ZP_01062250.1| chaperonin, 60 kDa [Flavobacterium sp. MED217] >gi|85829589|gb|EAQ48052.1| chaperonin, 60 kDa [Leeuwenhoekiella blandensis MED217] (547 aa)
Score = 1396, Expect = 3.6e-152, Identities = 317/528 (60%), Positives = 405/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+I F  SAR+ +  GV  L +AVKVT+GP+GRNV+I KS+G P +TKDGVSVAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+++KRG+DK V AI  +L K +K++    E I QVA ISAN+D  IGELIA A  KVG +GVITVEEAKG    + VVEGMQFDRGY+SPYFVTD+ KM  +LENPYIL+ DKK+SS+KD+LP+LE + ++G+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G S D  T+  LG AE+V IDKDN+TIV G G    IK R+++IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  +KR+  +  +L  DE  G +IV  AI SP+  IV+NAG +  VVI ++++    + G++A T +YV+M   GIIDP KVTR+AL+NA SVS M+LTTE  + D+ ++
  S:     1 MAKDITFDISARDGIKRGVDALANAVKVTLGPKGRNVIISKSFGGPQVTKDGVSVAKEIELQDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVQEGLKNVAAGANPMDLKRGIDKAVEAITKDLEKQTKEVGSSSEKIKQVAAISANNDDVIGELIAEAFGKVGKEGVITVEEAKGTETYVDVVEGMQFDRGYLSPYFVTDSEKMQTELENPYILLFDKKISSMKDLLPVLEPVAQSGKPLLIIAEDVDGEALATLVVNKLRGALKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFSLDNATIDMLGTAENVTIDKDNTTIVNGSGSSDDIKARVNQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVR-AKRVLESLESLNADEATGVKIVAKAIESPLRTIVANAGGEGSVVIAKVIEGDEDY-GYDAKTDRYVNMLAEGIIDPKKVTRVALENAASVSGMILTTECALTDIPEE 527
>gi|15607130|ref|NP_214512.1| GroEL [Aquifex aeolicus VF5] >gi|6225112|sp|O67943|CH60_AQUAE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|2984379|gb|AAC07897.1| GroEL [Aquifex aeolicus VF5] (545 aa)
Score = 1395, Expect = 3.7e-152, Identities = 309/532 (58%), Positives = 409/532 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEIL---KATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSV 533
           AK I +++ AR KL  GV +L +AVKVT+GP+GR V++ K++G PV+TKDGV+VAKE++L +  EN+GAQLVK+VASKTAD AGDGTTTATVLA  +F EGLR   SGAN +E+KRG+DK V  IV EL K SK +  + EI QVATISAN+D +IG++IA+AME+VG DGVITVEE+K     L VV+GMQFDRGY+SPYFVTD  KM   LENPYILI +KK++++K++LPILE+++++GRPLL+IA+DV+GEAL TLVVN ++GV    AVKAP FG +RK  L DIA+LTGG  +T+DLGI  + VTL  LGQAE VV+DK+++TI+ GKG   QIK RI +IK  I+ T SDYD++ L+ RLAKL+ GVA+I+VGA +E ELKEKK RV+DA+ ATKAA+EEGIV GGG ALV  S+ +     +L G   D+++G  I+  A+ +P+ QI  NAG+D  VV+ +++   K      GFNAATG+YVDM++ GIIDP KV R A++NA SV+  +LT EA+I D+ ++K+  +
  S:     3 AKAIIYNEEARAKLKAGVDKLANAVKVTLGPKGREVILGKNWGTPVVTKDGVTVAKEIELKDKFENIGAQLVKEVASKTADVAGDGTTTATVLAQAIFHEGLRVAASGANVMEVKRGIDKAVKKIVEELKKLSKDVKERKEIEQVATISANNDPEIGKIIADAMEEVGKDGVITVEESKSAETTLEVVKGMQFDRGYLSPYFVTDPEKMECVLENPYILIYEKKITNVKELLPILEQVVRSGRPLLVIAEDVEGEALATLVVNHIKGVLKACAVKAPGFGQRRKDYLGDIAVLTGGQAITEDLGIKLESVTLDMLGQAEKVVVDKEHTTIIGGKGDPEQIKARIEQIKRQIQETTSDYDREKLQERLAKLSGGVAIIRVGAATEAELKEKKYRVEDAVHATKAAVEEGIVPGGGVALVRASEALE----DLKGDNHDQQLGIDIIKKAVRTPLKQIAYNAGYDGSVVLEKVIELGKEKGVSWGFNAATGEYVDMYEAGIIDPTKVVRTAIENAASVAGTMLTAEALIADLPEEKKKDI 536
>gi|153006553|ref|YP_001380878.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5] >gi|187470681|sp|A7HGP8|CH602_ANADF 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|152030126|gb|ABS27894.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5] (547 aa)
Score = 1395, Expect = 4.0e-152, Identities = 303/534 (56%), Positives = 406/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           +KEI F   AR+ +  GV  L DAVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG + V +G NP+EIKRG+DK V  IV EL K SK    + EI QV  ISAN D+ IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  +M+A LE+ YILI +KK+S++KD+LP+LE+I ++G+PLLI+A++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK +LEDIAILTGG  + ++LG+  ++V+L+DLG+A+ + IDKDN+TIV G G ++ I+ R+  I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +   K +    + +   EK G  IV  A+  P+ QI  N G++  +V+N++ ++ + + GFNAATG Y D+ ++G+IDP KV+R ALQNA SV+S++LTT A++ + K  +E + PA
  S:     3 SKEIIFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQALYREGSKLVAAGHNPMEIKRGIDKAVEIIVGELKKLSKPTKDQKEIAQVGIISANGDETIGNIIAEAMEKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDAERMVANLEDAYILIHEKKISNMKDLLPLLEQIARSGKPLLIVAEEVEGEALATLVVNKLRGTLHVAAVKAPGFGDRRKAMLEDIAILTGGRMIAEELGLKLEQVSLKDLGRAKRISIDKDNTTIVDGAGQKADIEARVKTIRAQIEETTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRAVKAL--EGVKVSEGEKFGLDIVRRALEEPLRQIAGNGGYEASIVVNKVKESKDTNFGFNAATGDYEDLVKSGVIDPTKVSRSALQNASSVASLMLTTMALVAE-KPKEESAAPA 533
>gi|167456849|ref|ZP_02323065.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416672|gb|EDR83383.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1] (547 aa)
Score = 1395, Expect = 4.5e-152, Identities = 306/534 (57%), Positives = 402/534 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AKEI F   AR+ +  GV  L DAVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG + V +G NP+++KRG+DK V AIV EL K SK      EI QV  ISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  +M A LE+ YILI +KK+S++KD+LP+LE+I ++G+PL+I+A++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK +LEDIAILTGG  + ++LG+  ++VTL+DLG+A+ V +DKDN+TIV G G +  I+ R+  I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +   K +    +N    EK+G  IV  AI  P+ QI  N G++  +V+N++ +A     GFNAATG+Y D+ + G+IDP KV+R ALQNA SV+S++LTT A++ + K  +E + PA
  S:     3 AKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGIDKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQIARSGKPLIIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRMIAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRCVKALEGVKVN--EGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNAATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMVAE-KPKEEAAAPA 533
>gi|91216876|ref|ZP_01253840.1| chaperonin GroEL [Psychroflexus torquis ATCC 700755] >gi|91185037|gb|EAS71416.1| chaperonin GroEL [Psychroflexus torquis ATCC 700755] (543 aa)
Score = 1395, Expect = 4.7e-152, Identities = 314/528 (59%), Positives = 401/528 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIA-RKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK I F   ARN +  GV  L +AVKVT+GP+GRNV+I KS+GAP++TKDGVSVAKE++L +P+ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EGL+NV SGANP+ +KRG+DK V A+V EL K +K +    +EI QVA+ISAN+D+KIGELIA A  KVG +GVITVEEAKG    + VVEGMQFDRGY+SPYFVTD+ KM   LENPYILI DKK++S+KD+LP+LE   ++G+PLLIIA+D++GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  TL  LG AE+V +DKDN+TIV G G +  I  R+++IK  +E T SDYDK+ L+ RLAKL+ G+ V+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG A +   K ++        DE+ G  I+  AI SP+  IV NAG +  VVIN++L+     LG++A T  YVDM + GIIDP KV RIAL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKNIIFDIEARNGVKRGVDALANAVKVTLGPKGRNVIIGKSFGAPMVTKDGVSVAKEIELADPLENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVHEGLKNVASGANPLGLKRGIDKAVEAVVAELTKQAKSVGDTSEEIKQVASISANNDEKIGELIAEAFGKVGKEGVITVEEAKGTETYMEVVEGMQFDRGYLSPYFVTDSEKMTVDLENPYILIVDKKINSMKDLLPVLEPAAQSGKPLLIIAEDIEGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENATLDMLGTAENVTLDKDNTTIVNGGGEKENITNRVNQIKAQVESTTSDYDKEKLQERLAKLSGGIGVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVAFIRALKALS-KLKGDDADEQTGINIIAKAIESPMRTIVENAGGEGSVVINKVLEGD---LGYDAKTNTYVDMIKAGIIDPKKVARIALENAASVAGMILTTECALVDIKED 525
>gi|21673365|ref|NP_661430.1| chaperonin GroEL [Chlorobium tepidum TLS] >gi|25452832|sp|Q8KF02|CH60_CHLTE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|21646461|gb|AAM71772.1| chaperonin, 60 kDa [Chlorobium tepidum TLS] (545 aa)
Score = 1394, Expect = 4.9e-152, Identities = 309/530 (58%), Positives = 407/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L +P+ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG+  EL VVEGMQFDRGY+SPYFVT++  M A+L+   ILI DKK+S++K++LPILE+  ++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA  + IDKDN+TIV+GKG + +IK RI++IK  IE + SDYD + L+ RLAKL+ GVAV+K+GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+  +K +    +    D+K G +I+  A+  P+ QIV+N G   G V+ E +K      GFNA T +Y ++ + G++DP KVTR AL+NA SV+S+LLTTEA I DVK+DK D
  S:     3 AKDILFDAEARTKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELVDPVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVTAGARPIDLKRGIDRAVKEVVAELRNISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMETELKVVEGMQFDRGYLSPYFVTNSETMEAELDEALILIHDKKISNMKELLPILEKAAQSGRPLLIIAEDIEGEALATLVVNKLRGTLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATMAYLGQAARITIDKDNTTIVEGKGKQEEIKARINEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVLKIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAAKGL-AKAVADNEDQKTGIEIIRRALEEPLRQIVANTGTTDGAVVLEKVKNAEGDYGFNARTEQYENLIEAGVVDPTKVTRSALENAASVASILLTTEAAITDVKEDKAD 531
>gi|167939703|ref|ZP_02526778.1| chaperonin GroEL [Bacillus cereus AH1134] >gi|168138593|ref|ZP_02581822.1| chaperonin GroEL [Bacillus cereus B4264] (544 aa)
Score = 1394, Expect = 5.0e-152, Identities = 308/538 (57%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M ++GI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|89100205|ref|ZP_01173072.1| chaperonin GroEL [Bacillus sp. NRRL B-14911] >gi|89085055|gb|EAR64189.1| chaperonin GroEL [Bacillus sp. NRRL B-14911] (543 aa)
Score = 1394, Expect = 5.0e-152, Identities = 306/538 (56%), Positives = 415/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAKEIKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++G++K V A V EL   SK I  K+ I QVA ISA +D ++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LENPYILITDKK++SI++ILP+LE++++ G+PLL++A+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIA+LTGG  +T++LG      T+  LG+A  VV+ K+N+TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V  +  V +L   GDE  G  IV+ A+  P+  I  NAG +  V+++  LK  +   GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D    +E++ PAMP+
  S:     1 MAKEIKFSEEARRAMLRGVDSLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVTAAVEELKSISKPIEGKESIAQVAAISA-ADNEVGQLIAEAMERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITSIQEILPVLEQVVQQGKPLLLVAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVITEELGRDLKSATIDSLGRASKVVVSKENTTIVEGSGDSAQIAGRVNQIRVQLEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGVALLNVYNK--VASLEAEGDEATGINIVLRAMEEPVRTIAHNAGLEGSVIVDR-LKREDVGTGFNAATGEWVNMIEAGIVDPTKVTRSALQNAGSVAAMFLTTEAVVAD--KPEENAGPAMPD 532
>gi|88804971|ref|ZP_01120491.1| chaperonin GroEL [Robiginitalea biformata HTCC2501] >gi|88785850|gb|EAR17019.1| chaperonin GroEL [Robiginitalea biformata HTCC2501] (544 aa)
Score = 1394, Expect = 5.0e-152, Identities = 317/528 (60%), Positives = 406/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+I F   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+GAPV+TKDGV+VAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV  L K +KK+    E I QVA IS+N+D+ IGELIA A  KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVTD+ KMI++L+NPYIL+ DKK+S++KD+LP+LE + ++G+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  +L  LG  E V IDKDN+TIV G G    IK R+++IK+ IE T SDYD++ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV     ++ V T N   DE  G QIV  AI SP+  IV NAG +  VV+ ++ +      G++A + KYV+M + GIIDP KVTRIAL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKDITFDIEARDGLKRGVDALANAVKVTLGPKGRNVIISKSFGAPVVTKDGVTVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQSIVKEGLKNVAAGANPMDLKRGIDKAVEAIVENLAKQAKKVGDSSEKIKQVAAISSNNDETIGELIAEAFNKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGYLSPYFVTDSEKMISELDNPYILLFDKKISTMKDLLPVLEPVAQSGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENASLDMLGTCEKVSIDKDNTTIVNGSGSAKDIKARVNQIKSQIETTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAFSVLSKVKTEN--ADEATGLQIVARAIESPLRTIVENAGGEGSVVVAKVHEGKG-DFGYDAKSEKYVEMMKAGIIDPKKVTRIALENAASVAGMILTTECALTDIKED 527
>gi|23451129|gb|AAN32669.1|AF417582_2 GroEL [Enterococcus faecium] (531 aa)
Score = 1394, Expect = 5.1e-152, Identities = 312/524 (59%), Positives = 407/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKE+KF++ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QVA +S+ SDK +G LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I+ R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V+ +   GD   G +IV+ A+  PI QI  NAG++  V++++ LK      GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISTVVDSKEAIAQVAAVSSGSDK-VGHLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDATIENLGNASKVVVDKDNTTIVEGSGEKEAIEARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVISK--VSAVEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVELGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|30260443|ref|NP_842820.1| chaperonin GroEL [Bacillus anthracis str. Ames] >gi|47525527|ref|YP_016876.1| chaperonin GroEL [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183285|ref|YP_026537.1| chaperonin GroEL [Bacillus anthracis str. Sterne] >gi|167634199|ref|ZP_02392521.1| chaperonin GroL [Bacillus anthracis str. A0442] >gi|170687790|ref|ZP_02879005.1| chaperonin GroL [Bacillus anthracis str. A0465] >gi|177655757|ref|ZP_02937032.1| chaperonin GroL [Bacillus anthracis str. A0174] >gi|190567350|ref|ZP_03020264.1| chaperonin GroL [Bacillus anthracis Tsiankovskii-I] >gi|41016866|sp|Q81VE1|CH60_BACAN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|30253764|gb|AAP24306.1| chaperonin, 60 kDa [Bacillus anthracis str. Ames] >gi|47500675|gb|AAT29351.1| chaperonin, 60 kDa [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177212|gb|AAT52588.1| chaperonin, 60 kDa [Bacillus anthracis str. Sterne] >gi|167530513|gb|EDR93228.1| chaperonin GroL [Bacillus anthracis str. A0442] >gi|170668317|gb|EDT19065.1| chaperonin GroL [Bacillus anthracis str. A0465] >gi|172079986|gb|EDT65088.1| chaperonin GroL [Bacillus anthracis str. A0174] >gi|190561477|gb|EDV15448.1| chaperonin GroL [Bacillus anthracis Tsiankovskii-I] (544 aa)
Score = 1394, Expect = 5.4e-152, Identities = 310/538 (57%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A V EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M +TGI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLVGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|195962386|ref|ZP_03098591.1| chaperonin GroEL [Borrelia spielmanii A14S] (545 aa)
Score = 1394, Expect = 5.8e-152, Identities = 302/541 (55%), Positives = 416/541 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  VN    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M  +GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVNLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIDSGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKSTSGGGGYPMDPGMGM 544
>gi|195947660|ref|ZP_03088846.1| chaperonin GroEL [Borrelia garinii PBr] (545 aa)
Score = 1394, Expect = 6.0e-152, Identities = 302/541 (55%), Positives = 417/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  V+    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGGA L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVSLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGATLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|120437915|ref|YP_863601.1| protein Cpn60 (GroEL protein) [Gramella forsetii KT0803] >gi|166198463|sp|A0M7D9|CH60_GRAFK 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|117580065|emb|CAL68534.1| protein Cpn60 (GroEL protein) [Gramella forsetii KT0803] (546 aa)
Score = 1393, Expect = 6.2e-152, Identities = 315/528 (59%), Positives = 406/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   ARN +  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGV+VAKE++L +P+ENMGAQ+VK+VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+++KRG+DK V A+  +L K +K++    E I QVA+ISAN+D  IG+LIA A  KVG +GVITVEEAKG    + VVEGMQFDRGY+SPYFVT++ KM A LE+PYIL+ DKK+SS+KD+LP+LE + ++G+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G S +  T+  LG AE V IDKDN+T+V G G +  IKER+++IK  IE T SDYD++ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+     ++ + T N   DE  G +IV  AI SP+  IV NAG +  VVIN++L+      G++A T  YVDM + GIIDP KVTR+AL+NA SV+ M+LTTE  + D+ +D
  S:     1 MAKDIKFDIQARNGIKRGVDALANAVKVTLGPKGRNVIISKSFGAPTVTKDGVTVAKEIELEDPLENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVQEGLKNVAAGANPMDLKRGIDKAVEALTADLAKQTKEVGDSSEKIKQVASISANNDDMIGDLIAQAFGKVGKEGVITVEEAKGTETHVDVVEGMQFDRGYLSPYFVTNSEKMTADLEDPYILLFDKKISSMKDLLPVLEPVAQSGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFSLENATIDMLGTAEKVAIDKDNTTVVNGAGDDKAIKERVNQIKAQIESTTSDYDREKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQVVLSKIKTEN--PDEATGVKIVSKAIESPLRTIVENAGGEGSVVINKVLEGKK-DFGYDAKTETYVDMLKAGIIDPKKVTRVALENAASVAGMILTTECALTDIPED 527
>gi|34499469|ref|NP_903684.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472] >gi|68566281|sp|Q7NQX1|CH602_CHRVO 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|34105321|gb|AAQ61676.1| chaperonin 60kD subunit [Chromobacterium violaceum ATCC 12472] (546 aa)
Score = 1393, Expect = 6.3e-152, Identities = 299/528 (56%), Positives = 414/528 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF DSAR+K+  GV  L DAVKVT+GP+GRNV++ +S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V ++V E+ K +K  A   EI QV +ISANSD  IGE+IANAMEKVG +GVITVE+ K +N+EL VVEGMQFDRGY+SPYF+ + +K IA L+NP+IL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+  VVAVKAP FGD+RK +L DIA+LTGG  + +++G++ +K TL  LGQA+ V + K+N+TI+ G G  + I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+     + N+ T N   +++ G +IV+ AI +P+ QIV NAG +  VV+N++L+    + G+NAA+G+Y DM + G++DP KVTR ALQ+A SV+ ++LTT+ +I ++ +DK
  S:     3 AKDVKFGDSARSKMVAGVNILADAVKVTLGPKGRNVVLDRSFGAPTITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVQEGMKFVAAGMNPMDLKRGIDKAVVSLVGEIAKIAKPCATSKEIAQVGSISANSDSDIGEIIANAMEKVGKEGVITVEDGKSLNNELDVVEGMQFDRGYLSPYFINNQDKQIAALDNPFILLFDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLTDIAVLTGGEVIAEEVGLTLEKATLDQLGQAKRVEVGKENTTIIDGAGEAATIQARVGEIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALLRARATLENLKTDN--AEQEAGVKIVLRAIEAPLRQIVKNAGDEPSVVVNKVLEGKG-NFGYNAASGEYGDMLEMGVLDPAKVTRSALQHAASVAGLMLTTDCMIAELPEDK 528
>gi|24380300|ref|NP_722255.1| chaperonin GroEL [Streptococcus mutans UA159] >gi|29839299|sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|24378314|gb|AAN59561.1|AE015019_6 putative chaperonin GroEL [Streptococcus mutans UA159] (542 aa)
Score = 1393, Expect = 6.4e-152, Identities = 312/545 (57%), Positives = 418/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD-VKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ ++ K+ I QVA +S+ S+K +GE ++ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPY+LITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+     T+  LGQA  V +DKD++ IV+G G +  +  R++ IK+ IE   SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V ++  V  L+L  D   G  +V+ A+  P+ QI  NAG++  V+I++ LK ++   GFNAA G++VDM   GIIDPVKVTR ALQNA SV+S++LTTEAV+ D    +   + PAM    MGGMM
  S:     1 MAKDIKFSADARSSMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVATAVDELKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYVSEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYLLITDKKISNIQDVLPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLELKDTTIDALGQAARVTVDKDSTVIVEGSGGKEAVANRVNLIKSQIETATSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALINVIEK--VAALDLTDDAATGRNLVLRALEEPVRQIAKNAGYEGSVIIDK-LKNSSAGTGFNAANGEWVDMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVADHPAPEAPAAAPAMDPSMMGGMM 542
>gi|89210572|ref|ZP_01188960.1| Chaperonin Cpn60/TCP-1 [Halothermothrix orenii H 168] >gi|89159834|gb|EAR79494.1| Chaperonin Cpn60/TCP-1 [Halothermothrix orenii H 168] (547 aa)
Score = 1393, Expect = 6.4e-152, Identities = 306/532 (57%), Positives = 412/532 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS 532
           MAKE+KFS+ AR  L  GV  L +AVKVT+GP+GRNV+++KS+GAP IT DGVS+A+E++L N  ENMGAQ VK+VA+KT D AGDGTTTATVLA  +FKEGL+NV +GANP+ +KRG++K V  +V E+ + SK +  K+ + QVA ISA +D+++G+LIA AMEKVG DGVI+VEE+K +   L VVEGMQFDRGY+SPY VTDT+ M A LE+PYILITDKK+S+I++ILP+LE++ ++G+PLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  +T+DLG+  +   +  LG+A  V + K+++TIV+G G   +I+ RI +I+T IE TDSD+D++ L+ RLAKL  GVAVIKVGA +E ELKEKK R++DALSAT+AA+EEG+V GGG  L+     +  + LNL GDE  G  IV  A+ +P+  I  NAG++ G VI E +K+ +  +GF+A  G++V+M ++GI+DP KVTR ALQNA S ++MLLTTE ++ D ++D + +
  S:     1 MAKELKFSEDARRALERGVDTLANAVKVTLGPKGRNVVLEKSFGAPTITNDGVSIAREIELENHYENMGAQTVKEVATKTNDVAGDGTTTATVLAQAIFKEGLKNVAAGANPMILKRGIEKAVQKLVEEIKELSKPVEGKEAVSQVAAISAGNDEEVGKLIAEAMEKVGQDGVISVEESKSMGTSLDVVEGMQFDRGYLSPYMVTDTDAMEASLEDPYILITDKKISNIQEILPLLEKVAQSGKPLLIIAEDVEGEALATLVVNKIRGTFNCVAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLKLENADISMLGRAHKVTVTKEDTTIVEGAGDSKEIQNRIKQIRTQIENTDSDFDREKLQERLAKLAGGVAVIKVGAATETELKEKKHRIEDALSATRAAVEEGLVAGGGTTLIDAIPAL--DELNLEGDEATGVDIVRKALEAPVRLIADNAGYE-GSVIVEKVKSEDKGIGFDAYNGEFVNMIESGIVDPAKVTRSALQNAASAAAMLLTTECLVADKEEDNDSN 529
>gi|15639024|ref|NP_218470.1| chaperonin GroEL [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025264|ref|YP_001933036.1| heat shock protein GroEL [Treponema pallidum subsp. pallidum SS14] >gi|4033706|sp|P23033|CH60_TREPA 60 kDa chaperonin (Protein Cpn60) (groEL protein) (TPN60) (TP4 antigen) (TP-4) (Common antigen) (CA) >gi|3322286|gb|AAC65026.1| heat shock protein (groEL) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017839|gb|ACD70457.1| heat shock protein GroEL [Treponema pallidum subsp. pallidum SS14] (544 aa)
Score = 1393, Expect = 6.7e-152, Identities = 311/544 (57%), Positives = 412/544 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLN-LIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGM 544
           MAK++ F++ AR KL +GV+Q+  AVKVT+GP+GRNVL++K YGAP +TKDGVSVAKEV+L +P ENMGAQL+K+VA+KT D AGDGTTTATVLAY + +EGL+ V +G  P+E+KRGMDK V   V+++ ++SK I   +E+  VA++SAN+DK+IG ++A+A+EKVG+DGVI V+EA+ +      VEGMQFDRGYIS YFVTD ++M    ENPYILI DK +S++KD+LP+LE+I +TGRPLLIIA+DV+GEAL TLVVN +RG     AVKAP FGD+RK++LEDIAIL+GG  +++DLG+  +   +  LGQA+SV +DK+N+TI+ G G    IK+RI +IK  IE + SDYD + L+ RLAKL+ GVAVIK+GAV+EVE+KEKK RV+DAL+AT+AAIEEGIV GGG AL+  +  +    L+ L  DE +G++IV  A+  PI QI  NAG D  VV  +  +     +GF+A+  ++VDM + GIIDP KVTR ALQNA SVS +LLTTE  I  +  +K  S P  P+M GMGGM
  S:     1 MAKQLLFNEEARKKLLSGVEQISSAVKVTLGPKGRNVLLEKGYGAPTVTKDGVSVAKEVELEDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVREGLKAVAAGMTPLELKRGMDKAVAIAVDDIKQNSKGIKSNEEVAHVASVSANNDKEIGRILASAIEKVGNDGVIDVDEAQTMETVTEFVEGMQFDRGYISSYFVTDRDRMETVYENPYILIYDKSISTMKDLLPLLEKIAQTGRPLLIIAEDVEGEALATLVVNSLRGTLKTCAVKAPGFGDRRKEMLEDIAILSGGQVISEDLGLKLESADIALLGQAKSVKVDKENTTIIDGSGKSKDIKDRIEQIKKQIEASTSDYDSEKLKERLAKLSGGVAVIKIGAVTEVEMKEKKHRVEDALNATRAAIEEGIVAGGGLALIQAAAALEKADLSGLTPDEAVGFKIVRRALEEPIRQISENAGIDGAVVAEKAKEKRG--IGFDASKMEWVDMIKVGIIDPAKVTRSALQNAASVSGLLLTTECAIAAIP-EKSSSTPPAPDMGGMGGM 543
>gi|42521743|ref|NP_967123.1| 60 kDa chaperonin [Bdellovibrio bacteriovorus HD100] >gi|59797773|sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|39574273|emb|CAE77777.1| 60 KDA chaperonin [Bdellovibrio bacteriovorus HD100] (546 aa)
Score = 1393, Expect = 7.3e-152, Identities = 303/537 (56%), Positives = 404/537 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           M+K I FS+ AR  +  GV  L +AVKVT+GP+GRNV+I KS+G+P+ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT DEAGDGTTTATVLA  +++EG + V +G NP+ IKRG+DK V  I+ EL   SK +   +E+ QV  ISAN+DK+IG+++A+AM+KVG +GVIT+EE+K    E+TVVEGMQFDRGY+SPYFVT+  +M A LEN Y+L+ DKK+SS+KD++ ILE + K GR LLIIA+DV+GEAL TLVVNK+RG  ++ AVKAP FGD+RK +LEDIAILTG   +++D+G+  +  T+ DLG A+ +V+DKDN+TI+ G G ++ I  R+ +IK  IE T SDYDK+ L+ RLAKL  GVAVI VGA SEVE+KEKK RV+DAL+AT+AA+EEGIV GGG AL+  S +I+ +  +   +E+ G  I+  A   PI QI +NAG D  +V++ IL+  +   GFNA + +Y D+ + G+IDPVKV R AL NA SVSS++LTTE +I +    KE + PAMP
  S:     1 MSKVITFSEDARTHILKGVNTLANAVKVTLGPKGRNVVIDKSFGSPLITKDGVTVAKEIELENKFENMGAQMVKEVASKTNDEAGDGTTTATVLAQAIYREGAKLVSAGHNPMSIKRGIDKAVGIIIEELKSMSKPVKGSNEVAQVGAISANNDKEIGQMLADAMDKVGREGVITIEESKTAKTEVTVVEGMQFDRGYLSPYFVTNAERMEAVLENAYVLVYDKKISSMKDMIGILEGVAKQGRQLLIIAEDVEGEALATLVVNKLRGTLHIAAVKAPGFGDRRKAMLEDIAILTGAKVISEDVGLKLEAATVADLGVAKRIVVDKDNTTIIDGAGKKNDINGRVGQIKAQIEETSSDYDKEKLKERLAKLAGGVAVIHVGAPSEVEMKEKKHRVEDALNATRAAVEEGIVAGGGTALLRASTKIDKSKFS--EEEQFGATIIKRACEEPIRQIAANAGLDGAIVLDRILQNKSTTWGFNAYSDEYTDLIKDGVIDPVKVVRCALTNAASVSSLMLTTETMIAEAP-KKESAAPAMP 534
>gi|38422329|emb|CAE45331.1| unnamed protein product [Magnetospirillum gryphiswaldense] >gi|144898661|emb|CAM75525.1| 60 kDa chaperonin 5 [Magnetospirillum gryphiswaldense MSR-1] (547 aa)
Score = 1393, Expect = 8.0e-152, Identities = 305/521 (58%), Positives = 400/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE+KFS  AR K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L++  ENMGAQ+V++VASKTAD  GDGTTTATVLA  + +EG + V +G NP+++KRG+D  V A+V ++   +KK++  +EI QV TISAN ++ IG  IA AM KVG++GVITVEEAKG   EL VVEGMQFDRGY SPYFVT+  KM  +L++PYIL+ +KK+S ++ +LP+LE ++++GRPLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + VTL+ LG A+ V I K+++TIV G G    I+ R  +I+  IE T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++  + ++ +   N   D+K+G  IV  A+ SP+ QI  NAG D  VV  ++L+AT+ + GF+A TG YVDM + GIIDPVKV R ALQ+A SV+ +L+TTEA+I
  S:     3 AKEVKFSTEARAKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVREVASKTADLVGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGIDLAVEAVVADVKSRAKKVSTNEEIAQVGTISANGERDIGAKIAEAMSKVGNEGVITVEEAKGFETELDVVEGMQFDRGYSSPYFVTNAEKMTCELDSPYILLFEKKLSGLQPLLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVTLEMLGTAKRVTITKEDTTIVDGAGARGDIEARCKQIRAQIEETTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYSVRALDGIAVAN--NDQKVGIDIVRRALQSPVRQIAENAGHDGAVVAGKLLEATDTNFGFDAQTGTYVDMIKAGIIDPVKVVRTALQDAASVAGLLITTEAMI 522
>gi|30018515|ref|NP_830146.1| chaperonin GroEL [Bacillus cereus ATCC 14579] >gi|41016863|sp|Q814B0|CH60_BACCR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|29894055|gb|AAP07347.1| 60 kDa chaperonin GROEL [Bacillus cereus ATCC 14579] (544 aa)
Score = 1392, Expect = 8.3e-152, Identities = 307/538 (57%), Positives = 415/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GV VIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M ++GI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVPVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|23451145|gb|AAN32677.1|AF417586_2 GroEL [Enterococcus hirae] (531 aa)
Score = 1392, Expect = 9.4e-152, Identities = 311/524 (59%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKE+KF++ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QVA +S+ S+K +G LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G ++ I+ R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V+ +   GD   G +IV+ A+  PI QI  NAG++  V++++ LK      GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISTVVDSKEAIAQVAAVSSGSEK-VGHLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDATIENLGNASKVVVDKDNTTIVEGSGDKTAIEARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVINK--VSAVEAQGDVATGVKIVVGALEEPIRQIAENAGYEGSVIVDK-LKNVELGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|46446814|ref|YP_008179.1| chaperonin GroEL [Candidatus Protochlamydia amoebophila UWE25] >gi|67462201|sp|Q6MBZ5|CH602_PARUW 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|46400455|emb|CAF23904.1| probable 60 kDa chaperonin GroEL [Candidatus Protochlamydia amoebophila UWE25] (540 aa)
Score = 1392, Expect = 9.6e-152, Identities = 301/536 (56%), Positives = 405/536 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AK IKF + AR K+  GV+ L DAVKVT+GP+GRNV+I KSYG P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRGM+K V  IV EL K SK +  ++EI QVATISAN+D +IGE+IA A+EKVG DG ITVEE KG   EL VV+GM+FDRGY+S YF+T++      LE+ Y+LI +KK+S+IK+I+P+L+ +++TGRPLLIIA+DV+GEAL TLVVN++R    V AVKAP FGD+RK +L+DIAILTGG  +++++G+  +  T++ LG+ +  V+ KD +T+V+G G ++ I +R S+IK  IE + SDYDK+ L+ RLAKL  GVAVI VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG A +     +N    +L GDEK G +I+  ++ +P+ QI  NAG  +G +I + ++      G+NA TG+YVDM   GI+DP KV R AL+NAVSV++MLLTTEA++ D+ ++K    PA P
  S:     3 AKIIKFKEDARQKILKGVRTLADAVKVTLGPKGRNVVIDKSYGTPHITKDGVTVAKEIELEDKFENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVAAGANPLDLKRGMEKAVKVIVQELKKRSKTVDDRNEIAQVATISANNDAEIGEMIAQAIEKVGRDGTITVEEGKGFETELDVVKGMKFDRGYLSAYFMTNSESQECILEDAYVLIYEKKISAIKEIIPLLQAVVETGRPLLIIAEDVEGEALATLVVNRLRAGLKVCAVKAPGFGDRRKAMLQDIAILTGGELISEEIGLKLETTTIEQLGRVKKAVLTKDETTLVEGAGTKAAILDRASQIKRQIEESTSDYDKEKLQERLAKLVGGVAVIHVGAATEIEMKEKKDRVDDAQRATAAAVEEGILPGGGTAFIRCIPAVNSLADSLEGDEKTGAKIMARSLSAPLRQIAENAG-QEGAIILQAVEKMKEKEGYNALTGEYVDMITAGILDPTKVVRCALENAVSVAAMLLTTEAIVADIPEEK--PAPAAP 535
>gi|163938258|ref|YP_001643142.1| chaperonin GroEL [Bacillus weihenstephanensis KBAB4] >gi|163860455|gb|ABY41514.1| chaperonin GroEL [Bacillus weihenstephanensis KBAB4] (544 aa)
Score = 1392, Expect = 9.6e-152, Identities = 306/538 (56%), Positives = 416/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA IS+ +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  +V+ K+N+T+V+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M ++GI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKAISKPIEGKSSIAQVAAISS-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKIVVTKENTTVVEGIGNSQQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|91762709|ref|ZP_01264674.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002] >gi|91718511|gb|EAS85161.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002] (554 aa)
Score = 1392, Expect = 9.7e-152, Identities = 302/530 (56%), Positives = 411/530 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           MAK +KF   AR  +  GV  L + VKVT+GP+GRNV+I KSYGAP ITKDGVSVAKE+DL +  ENMGAQ+VK+VASKT +EAGDGTTTAT+LA  + KEG++ V +G NP+++KRG+D  V+ +   L  S+KK+   DEI QV TISAN DK+IG +IA AM+KVG++GVITVEEAKG+  EL VVEGMQFDRGY+SPYF+T+ +KM  +LENP+IL+ +KK+++++ ++P+LE +++ GRPL+II++DV+GEAL TLVVNK+RG   VVAVKAP FGD+RK +L+DIAILTGG  +++D+G+  + V L DLG  + V +DKDNSTI+ G G +S+I+ R ++IK  +  T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRV+DAL+AT+AA EEGIV+GGG AL++ S+  +++TL + G D+K G  +V  A+ +PI QI  NAG D  VV+ ++L+    ++G++A   +YVDMF  GIIDPVKV R ALQ+A S++ +L+TTEA+I D  DDK+
  S:     1 MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGIDSAVDHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAVVQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQVISEDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALLYASQ--SLDTLKVKGDDQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYDAQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPDDKD 529
>gi|168144368|ref|ZP_02587597.1| chaperonin GroEL [Bacillus cereus G9842] (544 aa)
Score = 1392, Expect = 1.0e-151, Identities = 308/538 (57%), Positives = 415/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V A + EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T++LG      T++ LG+A  VV+ K+N+T+V+G G   QI  RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M ++GI+DP KVTR ALQNA SV++M LTTEAV   V D  E + PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGIGNTEQIAARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYTK--VASIVAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEPNAPAMPD 531
>gi|70780029|gb|AAZ08337.1| GroEL [Streptococcus mutans] (528 aa)
Score = 1391, Expect = 1.2e-151, Identities = 304/524 (58%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ ++ K+ I QVA +S+ S+K +GE ++ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPY+LITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+     T+  LGQA  V +DKD++ IV+G G +  +  R++ IK+ IE   SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V ++  V  L+L  D   G  +V+ A+  P+ QI  NAG++  V+I++ LK ++   GFNAA G++VDM   GIIDPVKVTR ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSSMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVATAVDELKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYVSEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYLLITDKKISNIQDVLPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLELKDTTIDALGQAARVTVDKDSTVIVEGSGGKEAVANRVNLIKSQIETATSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALINVIEK--VAALDLTDDAATGRNLVLRALEEPVRQIAKNAGYEGSVIIDK-LKNSSAGTGFNAANGEWVDMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVAD 520
>gi|25452896|sp|Q9XCA9|CH60_RHOMR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|5020010|gb|AAD37976.1|AF145252_2 heat shock protein GroEL [Rhodothermus marinus] (540 aa)
Score = 1391, Expect = 1.2e-151, Identities = 307/538 (57%), Positives = 410/538 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AK+I F+  AR  L  GV +L DAVKVT+GP+GRNV+I+K +GAP +TKDGV+VAKE++L + +EN+GAQ+VK+VASKT+D AGDGTTTATVLA  +   GL++V +GANP+++KRG+DK V  +V EL K S+++  K+ I QVATISAN DK IG+LIA+A EKVG DGVITVEEAKG    L VVEGMQFDRGY+SPYFVT+ + M A LE+ YILI DKK+S++KD+LPILE++++TGRPLLIIA+DV+GEAL TLVVNK+RGV  V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LGQAE +++DKDN+TIV GKG  +QIK R ++I+  IE T SDYD++ L+ RLAKL  GVAV+K+GA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     ++ V   N   D+KIG QIV  A+  P+ QI +NAG++  +V+  + K      GFNA T ++ ++ + G+IDP KV R AL+NA SV+ +LLTTEAV+ +  + ++ + P+  +M
  S:     3 AKQITFNADARMALKRGVDKLADAVKVTLGPKGRNVIIEKKFGAPTVTKDGVTVAKEIELEDKLENVGAQMVKEVASKTSDVAGDGTTTATVLAQAILTAGLKSVTAGANPMDLKRGIDKAVEVVVAELRKMSQEVQDKNRIAQVATISANGDKAIGQLIADAFEKVGKDGVITVEEAKGTETTLEVVEGMQFDRGYLSPYFVTNPDTMEAVLEDAYILIHDKKISAMKDLLPILEKVVQTGRPLLIIAEDVEGEALATLVVNKLRGVLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYRLENATLDYLGQAERIIVDKDNTTIVGGKGDPAQIKARANQIRQQIEETTSDYDREKLQERLAKLAGGVAVLKIGAATEPEMKEKKARVEDALHATRAAVEEGIVPGGGVAYIRAIAALDKVEVEN--EDQKIGVQIVQRALEEPLRQIAANAGWEGSIVVQRV-KEGQGDFGFNAQTEEFGNLLEQGVIDPTKVARTALENAASVAGLLLTTEAVVAEKPEKEKAAAPSPGDM 538
>gi|75519418|sp|Q6W163|CH601_RHISN 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|36959080|gb|AAQ87505.1| 60 kDa chaperonin GroEL [Rhizobium sp. NGR234] (542 aa)
Score = 1391, Expect = 1.2e-151, Identities = 298/540 (55%), Positives = 416/540 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AKE++F   AR K+  GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGV+VAKEV+L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+DK V+AIV EL  +++++ + DEI QV TISAN D +IG  +A A+EKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  +LE PY+LI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL T VVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ VV++K+N+TIV G G +S+I+ R+++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEG++ GGG AL+   K ++ + T N   D+K G +IV  A+ +P+ QI  NAG +  +++ ++ + T    G+NA T ++ D++  G+IDPVKV R ALQ+A SV+ +L+TTEA++ + K  K+  +P MP  GM
  S:     3 AKEVRFHTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEVELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVDAIVEELKTNARRVTKNDEIAQVGTISANGDIEIGRFLAEAVEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYLLIHEKKLSNLQALLPVLESVVQSGKPLLIIAEDVEGEALATPVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLNMLGRAKKVVVEKENTTIVDGAGSKSEIQGRVAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALLRAVKALDSIRTEN--ADQKHGIEIVRRALEAPVRQIAENAGAEGSIIVGKLREKTEFGFGWNAQTNEFGDLYDQGVIDPVKVVRTALQDAASVAGLLITTEAMVAE-KPKKDAPLPPMPGGGM 540
>gi|111115482|ref|YP_710100.1| chaperonin GroEL [Borrelia afzelii PKo] >gi|167942368|ref|ZP_02529442.1| chaperonin GroEL [Borrelia afzelii ACA-1] >gi|123145654|sp|Q0SMK4|CH60_BORAP 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|110890756|gb|ABH01924.1| heat shock protein [Borrelia afzelii PKo] (545 aa)
Score = 1391, Expect = 1.2e-151, Identities = 301/541 (55%), Positives = 417/541 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  V+    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+SPYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVSLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|70780032|gb|AAZ08339.1| GroEL [Streptococcus mutans] (526 aa)
Score = 1391, Expect = 1.2e-151, Identities = 304/524 (58%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ ++ K+ I QVA +S+ S+K +GE ++ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPY+LITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+     T+  LGQA  V +DKD++ IV+G G +  +  R++ IK+ IE   SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V ++  V  L+L  D   G  +V+ A+  P+ QI  NAG++  V+I++ LK ++   GFNAA G++VDM   GIIDPVKVTR ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSSMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVATAVDELKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYVSEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYLLITDKKISNIQDVLPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLELKDTTIDALGQAARVTVDKDSTVIVEGSGGKEAVANRVNLIKSQIETATSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALINVIEK--VAALDLTDDAATGRNLVLRALEEPVRQIAKNAGYEGSVIIDK-LKNSSAGTGFNAANGEWVDMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVAD 520
>gi|42526685|ref|NP_971783.1| chaperonin GroEL [Treponema denticola ATCC 35405] >gi|59797819|sp|Q73NH7|CH60_TREDE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|41817000|gb|AAS11694.1| chaperonin, 60 kDa [Treponema denticola ATCC 35405] (544 aa)
Score = 1390, Expect = 1.4e-151, Identities = 308/544 (56%), Positives = 410/544 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVH-VSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           MAK++ F++ AR  L  GV+Q+ +AVKVT+GP+GRNVLI KS+GAP +TKDGVSVA+EV+L N  ENMGAQL+K+VA+KT D AGDGTTTATVLAY + KEGL+ V +G  P+E+KRG+DK V   V ++ K+SK+I   +E+  VA++SAN+D +IG++IA+A+ KVG DGVI V EA+ +      VEGMQFDRGYIS YFVTD ++M    ENPYILI DK +S++KD+LP+LE++ ++GRPLLIIA+DV+GEAL TLVVN +RG     AVKAP FGD+RK++LEDIA+LTGG  V+++LG   +   +  LGQA+S+ IDKDN+ I+ G G    IK+R+++IK  ++ TDS+YD + LR RLAKL+ GVAVIK+GAV+EVE+KEKK RV+DALSAT+AAIEEGIV GGG A++  ++     +  +L  DEK+G++IV  A+  PI QI  NAG D G VI E  K     +GF+AA  ++ DM + GIIDP KVTR ALQNA S++S+LLTTE  I D+ + +  + PAMP+  MGGM
  S:     1 MAKQLLFNEEARKSLLAGVEQISNAVKVTLGPKGRNVLIDKSFGAPTVTKDGVSVAREVELENKFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVKEGLKAVAAGMTPLELKRGIDKAVAIAVEDIQKNSKEIKGSEEVAHVASVSANNDAEIGKIIADAIAKVGKDGVIDVGEAQTMETVTDYVEGMQFDRGYISSYFVTDRDRMETVFENPYILIYDKSISTMKDLLPLLEQVAQSGRPLLIIAEDVEGEALATLVVNSLRGALKTCAVKAPGFGDRRKEMLEDIAVLTGGQVVSEELGFKLEAAQISMLGQAKSIKIDKDNTMIIDGAGKSKDIKDRVTQIKAQLDATDSEYDSEKLRERLAKLSGGVAVIKIGAVTEVEMKEKKHRVEDALSATRAAIEEGIVAGGGLAMIQAIAALEKADMSSLTEDEKVGFKIVKRALEEPIRQIAENAGLD-GAVIAEKAKEKK-GVGFDAAKMEWTDMVKAGIIDPAKVTRSALQNAASIASLLLTTECAITDIPEKQ--AGPAMPSPDMGGM 541
>gi|86135276|ref|ZP_01053857.1| chaperonin GroEL [Tenacibaculum sp. MED152] >gi|85819449|gb|EAQ40606.1| chaperonin GroEL [Polaribacter dokdonensis MED152] (545 aa)
Score = 1390, Expect = 1.4e-151, Identities = 323/528 (61%), Positives = 410/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARK-DEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I K++GAP +TKDGVSVAKEV+L N +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV++L K ++K+    D+I QVA+ISAN+D  IG+LIA A +KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVTD +KMIA LENPY+L+ DKK+S++++ILPILE + ++GRPLLIIA+DVDG+AL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G S +  TL  LG AE + IDKDN+TIV G G    IK R+++IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   K +   T + + DE  G QIV  AI +P+  IV NAG +  VVIN++L+      G++A T  YVDM + GIIDP KVTR+AL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKDIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIISKAFGAPTVTKDGVSVAKEVELENELENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVEAIVSDLEKQTQKVGNSSDKIQQVASISANNDSVIGDLIAKAFDKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGYLSPYFVTDADKMIADLENPYVLLFDKKISNLQEILPILEPVSQSGRPLLIIAEDVDGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFSLENATLDLLGTAEGITIDKDNTTIVNGSGDAEAIKARVNQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKKVLEALTTDNL-DETTGVQIVNKAIEAPLRTIVENAGGEGSVVINKVLEGKK-DFGYDAKTETYVDMLEAGIIDPKKVTRVALENAASVAGMILTTECALVDIKED 527
>gi|15613125|ref|NP_241428.1| chaperonin GroEL [Bacillus halodurans C-125] >gi|12643236|sp|O50305|CH60_BACHD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|2119971|pir||JC6063 chaperonin groEL - Bacillus sp >gi|10173175|dbj|BAB04281.1| class I heat-shock protein (chaperonin) [Bacillus halodurans C-125] (544 aa)
Score = 1390, Expect = 1.5e-151, Identities = 308/530 (58%), Positives = 411/530 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           MAK+IKFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV SGANP+ I++G++K     V EL+K SK I  KD I QVA IS+ +D ++G++IA AME+VG+DGVIT+EE+KG + EL VVEGMQFDRGY SPY VTD++KM A L+NPY+LITDKK+S+I+++LP+LE++++ G+P+LIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   +I  R+++IK  IE T SD+DK+ L+ RLAKL  GVAV+KVGA +E E+KE+K R++DAL++T+AA+EEGIV GGG ALV+V K   V+++   GDE  G  IV+ A+  P+ QI  NAG + G VI E LK      GFNAATG++V+M + GI+DP KVTR ALQ+A SVS+M LTTEAVI D  ++ E
  S:     1 MAKDIKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMVIRKGIEKATQVAVEELSKISKPIEGKDSIAQVAAISS-ADDEVGKIIAEAMERVGNDGVITIEESKGFSTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYVLITDKKISNIQEVLPVLEQVVQQGKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGEVITEDLGLDLKSANITQLGRASKVVVTKENTTIVEGAGESDKIAARVNQIKAQIEETTSDFDKEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVIKA--VSSIGAEGDEATGVNIVLRALEEPVRQIAHNAGLE-GSVIVERLKKEEAGFGFNAATGEWVNMVEAGIVDPTKVTRSALQHAASVSAMFLTTEAVIADKPEENE 526
>gi|53747888|emb|CAF05633.1| hypothetical protein [Angiococcus disciformis] (547 aa)
Score = 1390, Expect = 1.5e-151, Identities = 300/523 (57%), Positives = 401/523 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AKEI F  SAR  +  GV+ L DAV VT+GP+GRNV+I+KS+G+P ITKDGV+VAKE+DL N  ENMGAQ+VK+VASKT+D+AGDGTTTATVLA  +++EGL+ V +G +P+++KRG+DK V  +V EL K SK  A K  I QV TISAN D+ IG +IA+AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVT+  +M   +++P+ILI++KKVSS++D++PILE++ ++G+PLLIIADD++GEAL TLVVNK+RGV NV AVKAP FGD+RK++L+DIA LTGG  V+++LG  ++ +TL DLG+++ + +DKDN+TIV G G +S+I+ RI  I++ I+   SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +    L L G++  G +I+  A+  P+ +I SNAG +  VVIN++ +      G+NA T  Y D+ + G+IDP KV R ALQNA SV+S+LLTTEA+I D
  S:     3 AKEIFFHQSAREAILRGVRTLADAVAVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIDLDNKFENMGAQMVKEVASKTSDKAGDGTTTATVLARAIYEEGLKLVAAGHSPMDLKRGIDKAVEVVVEELKKLSKPTADKKAITQVGTISANGDETIGSIIADAMEKVGKEGVITVEEAKGLETNLDVVEGMQFDRGYVSPYFVTNRERMEVVMDDPFILISEKKVSSMQDMIPILEQVARSGKPLLIIADDIEGEALATLVVNKIRGVLNVAAVKAPGFGDRRKEMLKDIATLTGGMVVSEELGHKYENLTLNDLGRSKRITVDKDNTTIVDGAGTKSEIEGRIKLIRSQIDTVTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAFLRCLPAL--EKLKLGGEQDFGVEIIRRALQEPLRKIASNAGVEGAVVINKVREGQGA-FGYNARTEVYEDLEKAGVIDPTKVERTALQNAASVASLLLTTEAMIAD 522
>gi|55820302|ref|YP_138744.1| chaperonin GroEL [Streptococcus thermophilus LMG 18311] >gi|55822192|ref|YP_140633.1| chaperonin GroEL [Streptococcus thermophilus CNRZ1066] >gi|116627146|ref|YP_819765.1| chaperonin GroEL [Streptococcus thermophilus LMD-9] >gi|122268251|sp|Q03MK3|CH60_STRTD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68566260|sp|Q5M1M9|CH60_STRT1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68566261|sp|Q5M670|CH60_STRT2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|55736287|gb|AAV59929.1| heat shock protein, chaperonin, 60 kDa [Streptococcus thermophilus LMG 18311] >gi|55738177|gb|AAV61818.1| heat shock protein, chaperonin, 60 kDa [Streptococcus thermophilus CNRZ1066] >gi|116100423|gb|ABJ65569.1| Chaperonin GroEL (HSP60 family) [Streptococcus thermophilus LMD-9] (539 aa)
Score = 1390, Expect = 1.5e-151, Identities = 311/542 (57%), Positives = 414/542 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMG 542
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V A V EL   ++ +A K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPYIL+TDKK+S+I+DILP+LEE++KT RPLLIIADDV GEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTG + +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ +E T S++D++ L+ RLAKL+ GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L+L GD+  G  IV+ A+  P+ QI  NAG++  V+I++ LK +    GFNAA G++VDM ++GIIDPVKVTR ALQNA SV+S++LTTEAV+ D  + K  + PA     MG
  S:     1 MAKDIKFSSDARAAMVRGVDTLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAAVAAAVEELKVIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILVTDKKISNIQDILPLLEEVLKTSRPLLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGATVITEDLGLELKDATMESLGQASKVTVDKDSTVIVEGAGSAEAIANRVNLIKSQLETTTSEFDREKLQERLAKLSGGVAVIKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIAK--VAELDLEGDDATGRNIVLRALEEPVRQIAYNAGYEGSVIIDK-LKNSPVGTGFNAANGEWVDMVESGIIDPVKVTRSALQNAASVASLILTTEAVVADKPEQKAPAAPATDPGMMG 538
>gi|163766488|ref|ZP_02173513.1| chaperonin GroEL [Anaeromyxobacter sp. K] >gi|196173900|gb|ACG74873.1| chaperonin GroEL [Anaeromyxobacter sp. K] (547 aa)
Score = 1390, Expect = 1.5e-151, Identities = 302/521 (57%), Positives = 396/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEI F   AR+ +  GV  L DAVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L N  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG + V +G NP+++KRG+DK V AIV EL K SK      EI QV  ISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  +M A LE+ YILI +KK+S++KD+LP+LE+I ++G+PL+I+A++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK +LEDIAILTGG  + ++LG+  ++VTL+DLG+A+ V +DKDN+TIV G G +  I+ R+  I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +   K ++   +N    EK+G  IV  AI  P+ QI  N G++  +V+N++ +A     GFNAATG+Y D+ + G+IDP KV+R ALQNA SV+S++LTT A++
  S:     3 AKEIVFDQKARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIYREGSKLVAAGHNPMDVKRGIDKAVEAIVGELKKLSKPTKDHKEIAQVGIISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTDAERMEAVLEDAYILINEKKISNMKDLLPLLEQIARSGKPLVIVAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKAMLEDIAILTGGRMIAEELGLKLEQVTLKDLGRAKRVTVDKDNTTIVDGAGKKEDIEARVKTIRAQIEETTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRCVKALDGVKVN--EGEKVGLDIVRRAIEEPLRQISGNGGYEGSIVVNKVKEAKEAAFGFNAATGEYEDLVKAGVIDPTKVSRSALQNAASVASLMLTTMAMV 521
>gi|119357732|ref|YP_912376.1| chaperonin GroEL [Chlorobium phaeobacteroides DSM 266] >gi|166198448|sp|A1BHS5|CH60_CHLPD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|119355081|gb|ABL65952.1| chaperonin GroEL [Chlorobium phaeobacteroides DSM 266] (547 aa)
Score = 1390, Expect = 1.7e-151, Identities = 305/530 (57%), Positives = 407/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L + +ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT+   M A+LE+P ILI DKK+S++K++LPILE+  ++GRPLLII++D++GEAL TLVVN++RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LGQA  + +DKDN+T+V+GKG   +IK RI++IK  IE + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K ++ N +    D+K G +I+  A+  P+ QIV+N G   G V+ E +K      GFNA T +Y ++ + G++DP KVTR AL+NA SV+S+LLTTEA I D+K++K D
  S:     3 AKDIIFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELADAVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVLELRNISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNPENMEAELEDPLILIHDKKISNMKELLPILEKSAQSGRPLLIISEDIEGEALATLVVNRLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATLTYLGQAGRITVDKDNTTVVEGKGKPEEIKARINEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGLD-NAVADNEDQKTGIEIIRRALEEPLRQIVANTGTTDGAVVLEKVKNGEGDFGFNARTEQYENLVEAGVVDPTKVTRSALENAASVASILLTTEAAITDIKEEKSD 531
>gi|189346041|ref|YP_001942570.1| chaperonin GroEL [Chlorobium limicola DSM 245] >gi|189340188|gb|ACD89591.1| chaperonin GroEL [Chlorobium limicola DSM 245] (547 aa)
Score = 1390, Expect = 1.7e-151, Identities = 308/530 (58%), Positives = 406/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L + +ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT+   M A++E+P ILI DKK+ ++K++LPILE+  ++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LGQA  V IDKDN+TIV+GKG +  IK RI++IK  I+ + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K +  N +    D+K G +I+  A+  P+ QIV+N G   G V+ E +KA     GFNA T +Y ++ + G++DP KVTR AL+NA SV+S+LLTTEA I D+K++K D
  S:     3 AKDIIFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELADAVENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVAELRNISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNPETMEAEIEDPLILIHDKKIGNMKELLPILEKSAQSGRPLLIIAEDIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATLAYLGQAGRVNIDKDNTTIVEGKGTQEDIKARINEIKGQIDKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGL-ANAVADNEDQKTGIEIIRRALEEPLRQIVANTGTTDGAVVLEKVKAAEGDFGFNARTEQYENLVEAGVVDPTKVTRSALENAASVASILLTTEAAITDIKEEKSD 531
>gi|71082868|ref|YP_265587.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062] >gi|119366256|sp|Q4FPA5|CH60_PELUB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|71061981|gb|AAZ20984.1| 60 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062] (554 aa)
Score = 1390, Expect = 1.8e-151, Identities = 302/530 (56%), Positives = 410/530 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           MAK +KF   AR  +  GV  L + VKVT+GP+GRNV+I KSYGAP ITKDGVSVAKE+DL +  ENMGAQ+VK+VASKT +EAGDGTTTAT+LA  + KEG++ V +G NP+++KRG+D  V  +   L  S+KK+   DEI QV TISAN DK+IG +IA AM+KVG++GVITVEEAKG+  EL VVEGMQFDRGY+SPYF+T+ +KM  +LENP+IL+ +KK+++++ ++P+LE +++ GRPL+II++DV+GEAL TLVVNK+RG   VVAVKAP FGD+RK +L+DIAILTGG  +++D+G+  + V L DLG  + V +DKDNSTI+ G G +S+I+ R ++IK  +  T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRV+DAL+AT+AA EEGIV+GGG AL++ S+  +++TL + G D+K G  +V  A+ +PI QI  NAG D  VV+ ++L+    ++G++A   +YVDMF  GIIDPVKV R ALQ+A S++ +L+TTEA+I D  DDK+
  S:     1 MAKVVKFDSEARAAMIRGVDILANTVKVTLGPKGRNVVIDKSYGAPRITKDGVSVAKEIDLEDKFENMGAQMVKEVASKTNEEAGDGTTTATILAQAIVKEGVKYVTAGMNPMDVKRGIDAAVEHVKASLIASAKKVKDTDEIAQVGTISANGDKEIGNMIAKAMQKVGNEGVITVEEAKGVETELDVVEGMQFDRGYLSPYFITNADKMTTELENPFILLHEKKLTNLQPMVPLLEAVVQAGRPLMIISEDVEGEALATLVVNKLRGGLKVVAVKAPGFGDRRKSMLDDIAILTGGQVISEDIGVKLENVKLTDLGSCKRVKVDKDNSTIISGNGKKSEIEARCAQIKQQVGETTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVEDALNATRAAAEEGIVVGGGCALLYASQ--SLDTLKVKGDDQKAGVALVAKALQAPIRQITLNAGVDGSVVVGKLLEQNKKNMGYDAQNEEYVDMFAKGIIDPVKVVRTALQDAASIAGLLVTTEAMIADKPDDKD 529
>gi|163791611|ref|ZP_02186011.1| chaperonin, 60 kDa [Carnobacterium sp. AT7] >gi|159873131|gb|EDP67235.1| chaperonin, 60 kDa [Carnobacterium sp. AT7] (541 aa)
Score = 1389, Expect = 1.9e-151, Identities = 307/522 (58%), Positives = 404/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS+ AR  +  GV  L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGAQLV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++      V+EL   SK++  K+ I Q+A+IS+ S++  GEL+A AME+VG+DGVIT+EE+KGI  ELTVVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I++ILP+LE+I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+      +  LG A  VV+ KD +TIV+G G    I  R++ +K     T S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+A +AA+EEGIV GGG AL++V ++  V+ +   GDE  G +IV+ A+  P+ QIV+NAG + G VI E LK  +  +G+NAAT ++V+M   GIIDP KVTR ALQNA SV+++LLTTEAV+
  S:     1 MAKDIKFSEDARASMLRGVDILADIVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAQLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPVGIRRGIEMATKVAVDELLAISKQVDSKEAIAQIASISSGSNET-GELVAEAMERVGTDGVITIEESKGIETELTVVEGMQFDRGYLSQYMVTDNDKMEANLENPYILITDKKISNIQEILPLLEQILQQGRPLLIIADDVDGEALPTLVLNKLRGTFNVVAVKAPGFGDRRKSMLEDIAILTGGTVITEDLGLELKDTAIDQLGHASKVVVTKDATTIVEGAGSAESISHRVALLKAQAAETTSEFDKEKLQERLAKLSGGVAVIKVGAATETELKERKLRIEDALNAARAAVEEGIVSGGGTALINVQRK--VSEIEATGDEATGVKIVIRALEEPVRQIVTNAGLE-GSVIVEKLKGVDLGVGYNAATDEWVNMIDAGIIDPTKVTRSALQNAASVAALLLTTEAVV 518
>gi|21911301|ref|NP_665569.1| chaperonin GroEL [Streptococcus pyogenes MGAS315] >gi|28896674|ref|NP_803024.1| chaperonin GroEL [Streptococcus pyogenes SSI-1] >gi|25452829|sp|Q8K5M5|CH60_STRP3 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|21905515|gb|AAM80372.1| putative heat shock protein [Streptococcus pyogenes MGAS315] >gi|28811928|dbj|BAC64857.1| putative heat shock protein (chaperonin) [Streptococcus pyogenes SSI-1] (543 aa)
Score = 1389, Expect = 2.1e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLGGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|148261486|ref|YP_001235613.1| chaperonin GroEL [Acidiphilium cryptum JF-5] >gi|166198428|sp|A5G1G2|CH60_ACICJ 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|146403167|gb|ABQ31694.1| chaperonin GroEL [Acidiphilium cryptum JF-5] (549 aa)
Score = 1389, Expect = 2.1e-151, Identities = 299/528 (56%), Positives = 405/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK+++FS  AR +L  GV  L +AVKVT+GP+GRNV+I+KS+G+P ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK VNAIV+EL K +KKI    E  QV TISAN + +IG++I+ AM+KVG++GVITVEEAKGI  EL VVEGMQFDRGY+SPYF+T+  KM+A L+NPYILI +KK+S ++ +LP+LE I+++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + VTL  LG+A+ V+I+K+N+TIV+G G ++ I  R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  SE E+KE+KDRVDDAL AT+AA+EEGIV GGG AL   S  IN    +   D++ G  I+  A+++P+ QI  NAG D  V+  ++L   +   GF+A +G++ DM + GIIDP KV R ALQ+A SV+ +L+TTEA++ +  + K
  S:     3 AKDVRFSADARERLIRGVDLLANAVKVTLGPKGRNVVIEKSFGSPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVNAIVDELKKRTKKITTPSETAQVGTISANGEAEIGKMISEAMQKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNPEKMVADLDNPYILIHEKKLSGLQPMLPLLESIVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLETVTLNMLGRAKKVLIEKENTTIVEGAGKKADITGRCNQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGASETEVKERKDRVDDALHATRAAVEEGIVPGGGVALARASLAINKLKAD-NDDQRFGIDIIRKAVLAPMRQIAENAGEDGAVISGKVLDNDDYSFGFDAQSGEFKDMVKAGIIDPTKVVRTALQDAASVAGLLITTEAMVAERPEKK 529
>gi|21666296|gb|AAM73646.1|AF389516_2 GroEL [Streptococcus mutans] (536 aa)
Score = 1389, Expect = 2.2e-151, Identities = 304/524 (58%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ ++ K+ I QVA +S+ S+K +GE ++ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPY+LITDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +T+DLG+     T+  LGQA  V +DKD++ IV+G G +  +  R++ IK+ IE   SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL++V ++  V  L+L  D   G  +V+ A+  P+ QI  NAG++  V+I++ LK ++   GFNAA G++VDM   GIIDPVKVTR ALQNA SV+S++LTTEAV+ D
  S:     1 MAKDIKFSADARSSMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIETAVATAVDELKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYVSEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYLLITDKKISNIQDVLPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITEDLGLELKDTTIDALGQAARVTVDKDSTVIVEGSGGKEAVANRVNLIKSQIETATSDFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALINVIEK--VAALDLTDDAATGRNLVLRALEEPVRQIAKNAGYEGSVIIDK-LKNSSAGTGFNAANGEWVDMIDAGIIDPVKVTRSALQNAASVASLILTTEAVVAD 520
>gi|297123|emb|CAA38048.1| heat shock protein [Treponema pallidum] (544 aa)
Score = 1389, Expect = 2.3e-151, Identities = 311/544 (57%), Positives = 410/544 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLN-LIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGM 544
           MA E+ F++ AR KL +GV+Q+  AVKVT+GP+GRNVL++K YGAP +TKDGVSVAKEV+L +P ENMGAQL+K+VA+KT D AGDGTTTATVLAY + +EGL+ V +G  P+E+KRGMDK V   V+++ ++SK I   +E+  VA++SAN+DK+IG ++A+A+EKVG+DGVI V+EA+ +      VEGMQFDRGYIS YFVTD ++M    ENPYILI DK +S++KD+LP+LE+I +TGRPLLIIA+DV+GEAL TLVVN +RG     AVKAP FGD+RK++LEDIAIL+GG  +++DLG+  +   +  LGQA+SV +DK+N+TI+ G G    IK+RI +IK  IE + SDYD + L+ RLAKL+ GVAVIK+GAV+EVE+KEKK RV+DAL+AT+AAIEEGIV GGG AL+  +  +    L+ L  DE +G++IV  A+  PI QI  NAG D  VV  +  +     +GF+A+  ++VDM + GIIDP KVTR ALQNA SVS +LLTTE  I  +   K  S P  P+M GMGGM
  S:     1 MANELLFNEEARKKLLSGVEQISSAVKVTLGPKGRNVLLEKGYGAPTVTKDGVSVAKEVELEDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVREGLKAVAAGMTPLELKRGMDKAVAIAVDDIKQNSKGIKSNEEVAHVASVSANNDKEIGRILASAIEKVGNDGVIDVDEAQTMETVTEFVEGMQFDRGYISSYFVTDRDRMETVYENPYILIYDKSISTMKDLLPLLEKIAQTGRPLLIIAEDVEGEALATLVVNSLRGTLKTCAVKAPGFGDRRKEMLEDIAILSGGQVISEDLGLKLESADIALLGQAKSVKVDKENTTIIDGSGKSKDIKDRIEQIKKQIEASTSDYDSEKLKERLAKLSGGVAVIKIGAVTEVEMKEKKHRVEDALNATRAAIEEGIVAGGGLALIQAAAALEKADLSGLTPDEAVGFKIVRRALEEPIRQISENAGIDGAVVAEKAKEKRG--IGFDASKMEWVDMIKVGIIDPAKVTRSALQNAASVSGLLLTTECAIAAI-GQKSSSTPPAPDMGGMGGM 543
>gi|15793474|ref|NP_283296.1| chaperonin GroEL [Neisseria meningitidis Z2491] >gi|121635631|ref|YP_975876.1| chaperonin GroEL [Neisseria meningitidis FAM18] >gi|166201734|sp|A1KW52|CH60_NEIMF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|9910654|sp|P57006|CH60_NEIMA 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63) (HSP60) >gi|120867337|emb|CAM11108.1| chaperonin 60kD subunit [Neisseria meningitidis FAM18] >gi|121051461|emb|CAM07754.1| chaperonin 60kD subunit [Neisseria meningitidis Z2491] (544 aa)
Score = 1388, Expect = 2.4e-151, Identities = 295/537 (54%), Positives = 413/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +L+DIAILTGG+ +++++G+S +K TL DLGQA+ + I K+N+TI+ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM + G++DP KVTR ALQ+A S++ ++LTT+ +I ++ +DK    PAMP+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGTVISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEDK----PAMPD 533
>gi|169825741|ref|YP_001695899.1| 60 kDa chaperonin (protein Cpn60) (groEL protein) [Lysinibacillus sphaericus C3-41] >gi|168990229|gb|ACA37769.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Lysinibacillus sphaericus C3-41] (544 aa)
Score = 1388, Expect = 2.6e-151, Identities = 298/534 (55%), Positives = 413/534 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           MAK+IKFS+ AR+ +  GV +L +AVK+T+GP+GRNV+++K +G+P+IT DGV++AKE++L NP ENMGA+LV +VASKT + AGDGTTTATVLA  + +EGL+NV +GANP+ I++G+DK V A + EL+  S+ ++ KDEI QVA ISA +D ++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY S Y VTDT+KM A L+NPYILITDKK+++I+++LP+LE++++ GRPLLIIA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  +T++LG+      +  LG+A  VV+ KDN+TIV+G G    I+ RI +I+  +  T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V   +   + +  GD   G +IV+ A+  P+ QI +NAG +  ++++  LK     +GFNAATG++V+M + G++DP KVTR ALQNA SV+++ LTTEAV+ D+ +     +P
  S:     1 MAKDIKFSEDARSLMLQGVDKLANAVKITLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELENPYENMGAKLVAEVASKTNEIAGDGTTTATVLAQAIIREGLKNVTAGANPVGIRKGIDKAVAAALTELHTISRPVSNKDEIAQVAAISA-ADDEVGQLIAEAMERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASHYMVTDTDKMEAVLDNPYILITDKKITNIQEVLPLLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGQVITEELGLDLKSADISSLGRAAKVVVTKDNTTIVEGVGGADAIEARIGQIRAQLAETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALLNVYAAVEKVSESEEGDVATGVKIVLRALEEPVRQIANNAGLEGSIIVDR-LKREEIGIGFNAATGEWVNMMEAGVVDPAKVTRSALQNAASVAALFLTTEAVVADIPEPAGAGMP 532
>gi|194333514|ref|YP_002015374.1| chaperonin GroEL [Prosthecochloris aestuarii DSM 271] >gi|194311332|gb|ACF45727.1| chaperonin GroEL [Prosthecochloris aestuarii DSM 271] (549 aa)
Score = 1388, Expect = 2.6e-151, Identities = 309/530 (58%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKEV+L +  ENMGAQ+V++V+SKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D  V  +V EL + S+ I  K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG++ ELTVVEGMQFDRGY+SPYFVT++ KM A LE+PYILI DKK+S++K++LP+LE+  ++GRPL+IIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA S+ +DKDN+TIV GKG    IK RI +IK  IE + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV GGG AL+  +K ++  N  N   D+K G  I+  A+  P+ QIV+N G   G V+ E +K +    GFNA T +Y+++ + G++DP KVTR AL+NA SV+ +LLTTEA I D+K+D  D
  S:     3 AKDILFDAEARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEVELEDAFENMGAQMVREVSSKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDLAVKDVVAELREISRDITGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMDTELTVVEGMQFDRGYLSPYFVTNSEKMDADLEDPYILIYDKKISNMKELLPVLEKTAQSGRPLMIIAEDIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATISYLGQAASITVDKDNTTIVDGKGQADDIKARIGEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVAGGGVALIRAAKALDATNPEN--EDQKTGVDIIRRALEEPLRQIVANTGTTDGAVVVEKVKNSEGDYGFNARTEEYMNLIEAGVVDPTKVTRTALENAASVAGILLTTEAAITDIKEDGSD 531
>gi|78357516|ref|YP_388965.1| chaperonin GroEL [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|119366239|sp|Q30YH6|CH60_DESDG 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78219921|gb|ABB39270.1| Chaperonin Cpn60/TCP-1 [Desulfovibrio desulfuricans G20] (548 aa)
Score = 1388, Expect = 2.8e-151, Identities = 308/534 (57%), Positives = 398/534 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           +KEI F   AR +L  GV +L +AVKVT+GP+GRNV+I+KS+GAPVITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTAT+LA  ++KEG++ V +G NP+ IKRG+DK V A+V EL   +K    + EI QV TISANSD  IG +IA AM KVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVTD  KM+ +++ P ILI +KK+SS+KD+LP+LE++ K  RPL+IIA+DVDGEAL TLVVNK+RG   VVAVKAP FG++RK +LEDIA LTGG  +++++GI  +  T+ DLG A+ +V+DK+N+TIV G G    IK R+  I+  IE T SDYD++ L+ RLAK+  GVAVI VGA +E E+KEKKDRV+DAL+AT+AA+EEGIV GGG ALV   K ++ +      DE  G  I+  AI  P+ QI +NAGF+ G +I E +K      GFNAATG++ D+   G+IDP KV+RIALQNA SV+S+LLTTE  I +   +   + PA
  S:     3 SKEIVFDTKARERLARGVDKLANAVKVTLGPKGRNVVIEKSFGAPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIYKEGVKLVAAGRNPMAIKRGVDKAVEALVKELGNLAKPTRDQKEIAQVGTISANSDTTIGNIIAEAMSKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDPEKMVCEMDEPLILINEKKISSMKDMLPVLEQVAKMNRPLVIIAEDVDGEALATLVVNKLRGTLQVVAVKAPGFGERRKAMLEDIATLTGGRVISEEMGIKLENATVADLGNAKRIVVDKENTTIVDGAGESEAIKARVKMIRAQIEETSSDYDREKLQERLAKIVGGVAVINVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTALVRCCKVLD-DVKPADDDEAAGVTIIRRAIEEPLRQIAANAGFE-GSIICEKVKEGKDAFGFNAATGEFEDLIAAGVIDPKKVSRIALQNAASVASLLLTTECAIAEKPKEDAPAAPA 534
>gi|118597125|sp|Q1J9G4|CH60_STRPB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|118597240|sp|Q1JJL5|CH60_STRPC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|118597375|sp|Q1J4D1|CH60_STRPF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|119366273|sp|Q48R03|CH60_STRPM 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|50904180|gb|AAT87895.1| 60 kDa chaperonin GROEL [Streptococcus pyogenes MGAS10394] >gi|71803504|gb|AAX72857.1| 60 kDa chaperonin [Streptococcus pyogenes MGAS6180] >gi|94542909|gb|ABF32958.1| 60 kDa chaperonin GROEL [Streptococcus pyogenes MGAS9429] >gi|94546800|gb|ABF36847.1| 60 kDa chaperonin GROEL [Streptococcus pyogenes MGAS2096] >gi|94548759|gb|ABF38805.1| 60 kDa chaperonin GROEL [Streptococcus pyogenes MGAS10750] (545 aa)
Score = 1388, Expect = 3.0e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     3 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 520
>gi|139474521|ref|YP_001129237.1| chaperonin GroEL [Streptococcus pyogenes str. Manfredo] >gi|161761299|ref|YP_061078.2| chaperonin GroEL [Streptococcus pyogenes MGAS10394] >gi|162139073|ref|YP_597502.2| chaperonin GroEL [Streptococcus pyogenes MGAS9429] >gi|162139122|ref|YP_601391.2| chaperonin GroEL [Streptococcus pyogenes MGAS2096] >gi|162139174|ref|YP_603349.2| chaperonin GroEL [Streptococcus pyogenes MGAS10750] >gi|162139391|ref|YP_281212.2| chaperonin GroEL [Streptococcus pyogenes MGAS6180] >gi|166201755|sp|A2RGR1|CH60_STRPG 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|56748643|sp|Q5X9L8|CH60_STRP6 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|134272768|emb|CAM31043.1| 60 kDa chaperonin [Streptococcus pyogenes str. Manfredo] (543 aa)
Score = 1388, Expect = 3.0e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|15675832|ref|NP_270006.1| chaperonin GroEL [Streptococcus pyogenes M1 GAS] >gi|71911574|ref|YP_283124.1| chaperonin GroEL [Streptococcus pyogenes MGAS5005] >gi|56749807|sp|P69883|CH60_STRP1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|13623062|gb|AAK34727.1| heat shock protein (chaperonin) [Streptococcus pyogenes M1 GAS] >gi|71854356|gb|AAZ52379.1| 60 kDa chaperonin [Streptococcus pyogenes MGAS5005] (543 aa)
Score = 1388, Expect = 3.0e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|162139097|ref|YP_599438.2| chaperonin GroEL [Streptococcus pyogenes MGAS10270] (543 aa)
Score = 1387, Expect = 3.1e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGAVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|118597374|sp|Q1JEL5|CH60_STRPD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|94544846|gb|ABF34894.1| 60 kDa chaperonin GROEL [Streptococcus pyogenes MGAS10270] (545 aa)
Score = 1387, Expect = 3.2e-151, Identities = 308/522 (59%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     3 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGAVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 520
>gi|150026025|ref|YP_001296851.1| 60 kDa chaperonin GroEL [Flavobacterium psychrophilum JIP02/86] >gi|166198458|sp|A6H125|CH60_FLAPJ 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|61967802|gb|AAX56915.1| 60 kDa chaperonin [Flavobacterium psychrophilum] >gi|149772566|emb|CAL44049.1| 60 kDa chaperonin GroEL [Flavobacterium psychrophilum JIP02/86] (542 aa)
Score = 1387, Expect = 3.3e-151, Identities = 311/528 (58%), Positives = 407/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+G P +TKDGV+VAKE++L +P+ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV +L K +K +    E I Q+A+ISAN+D+ IGELIANA  KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVT+  KM A+LENPYIL+ DKKVSS+K++LP+LE + ++G+PLLIIA+DVDGEAL+TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  T++ LG A+ V IDKDN+TIV G G    IK R+++IK  +E + SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  +K +  +      DE  G QIV  A+ +P+  IV NAG +  VV+ ++ + +    G+NA T +YVDM + GIIDP KVTR+AL+NA SV+ M+LTTE  + ++K++
  S:     1 MAKNIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIIGKSFGGPTVTKDGVTVAKEIELQDPLENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVEAIVADLTKQAKVVGSDSEKIKQIASISANNDEVIGELIANAFAKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGYLSPYFVTNPEKMDAELENPYILLYDKKVSSLKELLPVLEPVAQSGKPLLIIAEDVDGEALSTLVVNKLRGALKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENTTIEMLGTAKRVTIDKDNTTIVSGAGEADMIKNRVNQIKGQMEASTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALLR-AKNVLKDIKADNADEATGIQIVSRAVEAPLRTIVENAGLEGSVVVAKVAEGSG-DFGYNAKTDEYVDMLKAGIIDPKKVTRVALENAASVAGMILTTECALVEIKEE 527
>gi|190894865|ref|YP_001985158.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] >gi|190700526|gb|ACE94608.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] (542 aa)
Score = 1387, Expect = 3.5e-151, Identities = 307/540 (56%), Positives = 409/540 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AKE+KF+  AR KL  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V AIV EL  +++ I+   EI QV TISAN D +IG  +A AMEKVG+DGVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E+PYILI +KK+S+++ +LPILE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIA+LT G+ +++DLGI  + VTL  LG+A+ V ++K+N+TIV G G +S I+ RI++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K + NV T N   D+++G  IV  A+ +P  QI  NAG +  VV+ ++ + T    G+NA TG++ D++  G+IDP KV R ALQ+A S++ +L+TTEA++ + K  K+ + P  P  GM
  S:     3 AKEVKFNVEAREKLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVAAIVAELKANARNISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTAGTVISEDLGIKLESVTLDMLGRAKKVSVEKENTTIVDGSGAKSDIEGRIAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALENVQTAN--SDQRVGVDIVRRALEAPARQIAENAGAEGSVVVGKLREKTEFSYGWNAQTGEFGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMVAE-KPKKDAAPPLPPGAGM 540
>gi|89898172|ref|YP_515282.1| chaperonin GroEL [Chlamydophila felis Fe/C-56] >gi|119366233|sp|Q255A1|CH60_CHLFF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|89331544|dbj|BAE81137.1| heat shock protein HSP60 subunit [Chlamydophila felis Fe/C-56] (544 aa)
Score = 1387, Expect = 3.5e-151, Identities = 299/540 (55%), Positives = 403/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK IK+++ AR K+  GV+ L +AVKVT+GP+GR+V+I KS+G+P +TKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRG+DK V  +V+E+ K SK +    EI QVATISAN+D +IG LIA AMEKVG +G ITVEEAKG    L VVEGM F+RGY+S YF T+       LE   +LI DKK+S IKD LP+L+++ ++GRPLLIIA+D++GEAL TLVVN++R  F V AVKAP FGD+RK +LEDIAILTGG  ++++LG+  +  TL  LG+A+ V++ K+++TIV+G G +  I+ R   IK  IE + SDYDK+ L+ RLAKL+ GVAVI+VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG ALV     +      L   DE+IG +IV+ A+ +P+ QI +NAG +  ++  ++L A + + G++A    Y DM + GI+DP KVTR AL++A SV+ +LLTTEA+I D+ +DK  S PAMP  GM
  S:     3 AKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDEIKKISKPVQHHKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFTTNPETQECVLEESLVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAILTGGQLISEELGMKLENTTLSMLGKAKKVIVSKEDTTIVEGLGNKEDIEARCENIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALVRCIPTLEAFIPILTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVL-ARSSNEGYDALRDAYTDMIEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEDKSSSAPAMPGAGM 542
>gi|25452889|sp|Q9L690|CH603_RHILE 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|7578869|gb|AAF64162.1|AF239164_2 GroEL [Rhizobium leguminosarum] (544 aa)
Score = 1387, Expect = 3.6e-151, Identities = 303/543 (55%), Positives = 405/543 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AKEI+FS+ AR++L  GV+ L +AVKVT+GP+GRNV+I K+YGAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  +F+EG + V +G NP++++RG+D  V A+V E+   + K+    EI QV TI+AN D  IGE+IA AM+KVG++GVITVEEA+    EL VVEGMQFDRGY+SPYFVT+  KM  +LE+PYIL+ +KK+ S++ +LPILE +++TG+PLL+I++DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIA+LT G  +++DLGI  D VTL  LG A+ V+IDK+++TI+ G G ++ I+ RI +IK  IE T SDYDK+ L+ RLAKL  GVAVI+VG  +E E+KEKKDR+DDAL+AT+AA+EEGIV GGG AL+     +   T     D   G  IV+ A+ +PI QI  NAGF+  +V+ ++  + N + GF+A T  YVDM + GI+DP KV R ALQ+A S++++L+T E +I D+     DS PA  N GMG M
  S:     3 AKEIRFSNDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGIDLGVTAVVKEIKARAMKVKSSSEIAQVGTIAANGDAAIGEMIAKAMDKVGNEGVITVEEARTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILVHEKKLGSLQAMLPILEAVVQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTSGQMISEDLGIKLDNVTLDMLGHAKRVLIDKESTTIIDGSGEKAAIQARIQQIKAQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIDDALNATRAAVEEGIVPGGGVALLRAKSALTGLT-GENADVTAGISIVLRALEAPIRQIADNAGFEGSIVVGKLAGSNNHNQGFDAQTETYVDMIEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIP--ARDSAPAAGNGGMGDM 542
>gi|152974096|ref|YP_001373613.1| chaperonin GroEL [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189044128|sp|A7GKG0|CH60_BACCN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|152022848|gb|ABS20618.1| chaperonin GroEL [Bacillus cereus subsp. cytotoxis NVH 391-98] (542 aa)
Score = 1387, Expect = 3.6e-151, Identities = 308/538 (57%), Positives = 415/538 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V   V EL   SK I  K  I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY +TD++KM A L+NPYILITDKK+S+I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG FNVVAVKAP FGD+RK +LEDIAILT G  +T++LG      T++ LG+A  VV+ K+N+TIV+G G   QI+ RI +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG +L++V  +  V ++   GDE  G  IV+ A+  P+ QI  NAG +  VV+ E LK     +GFNAATG++V+M ++GI+DP KVTR ALQNA SV++M LTTEAV   V D  E++ PAMP+
  S:     1 MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGLRKGIEKAVATAVEELKTISKPIEGKSSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITDKKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTDGEVITEELGRDLKSATIESLGRAGKVVVTKENTTIVEGVGSTEQIEARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTSLMNVYAK--VASIAAEGDEATGINIVLRALEEPVRQIAINAGLEGSVVV-ERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV---VADKPEENKPAMPD 531
>gi|39365|emb|CAA37994.1| common antigen [Borrelia burgdorferi] (545 aa)
Score = 1387, Expect = 3.7e-151, Identities = 300/541 (55%), Positives = 416/541 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS----VPAMPNMGM 541
           MAK+I F++ AR  L +GV++L +AVKVT+GP+GRNVLI K +G+P +TKDGVSVA+E++L NP ENMGAQL+K+VA KT D AGDGTTTATVLAY + +EGL+NV SG NPI IK+G+D  V+    ++ +S+KKI  K+EI QVA+ISAN+D  IGE IA AM+KVG DGVITVEE+K  +  ++ VEGMQFDRGY+ PYF T+   M    ++ +ILI +KK+SSIK++LP+LE+++ T +PLLIIA+D++G+AL  LV+N +RG   V A+K+P FGD+RK +LEDIA+LTGG  ++++LG++ + V ++ LGQA+++ +DKDN+TI+   G + QIKER   IK  IE + S+YDK+ L+ RLAKL  GVAVI VGAV+EVELKEKK RV+DALSAT+AA+EEG+V GGG+ L+ V+  ++ ++T  L  +EK G++IV  ++  P+ QI+SNAGF+  + I++I K     LGF+A++ K+V+M ++GIIDP KVTR ALQNA S++ +LLTTE  I D+K++K  S     P  P MGM
  S:     1 MAKDIYFNEDARKSLLSGVEKLSNAVKVTLGPKGRNVLIDKKFGSPTVTKDGVSVAREIELENPFENMGAQLLKEVAIKTNDVAGDGTTTATVLAYAIAREGLKNVSSGINPIGIKKGIDHAVSLAAEKIRQSAKKITTKEEIAQVASISANNDSYIGEKIAEAMDKVGKDGVITVEESKTFDTTISYVEGMQFDRGYLXPYFSTNKENMSVSFDDAFILIYEKKISSIKELLPVLEKVLGTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKSPGFGDRRKAMLEDIAVLTGGVLISEELGLTLETVEIEQLGQAKTIKVDKDNTTIIN-TGNKEQIKERSELIKKQIEDSTSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTIDTSKLSYEEKQGFEIVKRSLEEPMRQIISNAGFEGSIYIHQI-KTEKKGLGFDASSFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTTECAITDIKEEKNTSGGGGYPMDPGMGM 544
>gi|90962186|ref|YP_536102.1| chaperonin GroEL [Lactobacillus salivarius UCC118] >gi|119366246|sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|90821380|gb|ABE00019.1| 60 kDa chaperonin GROEL [Lactobacillus salivarius UCC118] >gi|90823040|gb|ABE01047.1| 60 kDa chaperonin [Lactobacillus salivarius] (540 aa)
Score = 1387, Expect = 3.8e-151, Identities = 312/545 (57%), Positives = 416/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD-DKEDSVPAMPNMGMGGMM 545
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK  DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V  L   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D  + +  + +PA P  GMGGMM
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKATDLEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VAALEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADKPEPESNNQMPATP--GMGGMM 540
>gi|114777816|ref|ZP_01452747.1| chaperonin, 60 kDa subunit [Mariprofundus ferrooxydans PV-1] >gi|114551807|gb|EAU54347.1| chaperonin, 60 kDa subunit [Mariprofundus ferrooxydans PV-1] (546 aa)
Score = 1387, Expect = 3.8e-151, Identities = 305/525 (58%), Positives = 407/525 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV 525
           MAK+I+F + AR K+  GV +L DAVKVT+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+V+SKTAD AGDGTTTATVLA  + KEG++ V +G NP+++KRG+DK V A+V EL   SK++  +DEI QV TISAN D +IG++IA+AM+KVG +GVITVEEAKG+  EL VVEGMQ DRGY+SPYFVTDT +M A L++PYIL+ +KK+S+++++LP+LE + +TG+PLLIIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LED+AILTG   +++DLG+  + VTL+DLG A +V I KD +T+V G G ++ I+ R++ I+  IE T SDYDK+ L+ RLAKL  GVAVIKVGA +E  +KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++ +   +  DE  G  I+  A+  P+ QIV+N G +  VV+NE+      H G+NA T +Y D+ + G+IDP KVTR ALQ A S++ +L+TTEA+I D+
  S:     1 MAKDIQFGEDARAKMMVGVNKLADAVKVTLGPKGRNVVIEKSWGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVSSKTADIAGDGTTTATVLAQSIAKEGVKAVAAGMNPMDLKRGIDKAVTAVVAELANLSKEVQNQDEIAQVGTISANGDAEIGKIIADAMDKVGKEGVITVEEAKGLETELDVVEGMQIDRGYLSPYFVTDTERMEANLDHPYILLFEKKISNMRELLPVLEAVARTGKPLLIIAEDIEGEALATLVVNKVRGVVNVAAVKAPGFGDRRKAMLEDMAILTGAKVISEDLGLKLENVTLEDLGTAAAVKIAKDTTTVVDGAGEKAAIEGRVALIRKQIEDTTSDYDKEKLQERLAKLAGGVAVIKVGAATETAMKEKKDRVDDALHATRAAVEEGIVAGGGVALLRARKALD-SVKGINHDEDTGVNIIRRALEEPLRQIVANGGGEASVVVNEV-SNNKGHYGYNAQTEEYGDLVKMGVIDPTKVTRSALQYAASIAGLLITTEAMIADI 523
>gi|19746946|ref|NP_608082.1| chaperonin GroEL [Streptococcus pyogenes MGAS8232] >gi|25452845|sp|Q8NZ56|CH60_STRP8 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|19749197|gb|AAL98581.1| heat shock protein (chaperonin) [Streptococcus pyogenes MGAS8232] (543 aa)
Score = 1387, Expect = 4.0e-151, Identities = 307/522 (58%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  V+I++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVIIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|126651448|ref|ZP_01723652.1| chaperonin GroEL [Bacillus sp. B14905] >gi|126591701|gb|EAZ85797.1| chaperonin GroEL [Bacillus sp. B14905] (544 aa)
Score = 1386, Expect = 4.4e-151, Identities = 297/534 (55%), Positives = 412/534 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           MAK+IKFS+ AR+ +  GV +L +AVK+T+GP+GRNV+++K +G+P+IT DGV++AKE++L NP ENMGA+LV +VASKT + AGDGTTTATVLA  + +EGL+NV +GANP+ I++G+DK V A + EL+  S+ ++ KDEI QVA ISA +D ++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY S Y VTDT+KM A L+NPYILITDKK+++I+++LP+LE++++ GRPLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIAILTGG  +T++LG+      +  LG+A  VV+ KDN+TIV+G G    I+ RI +I+  +  T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG AL++V   +     +  GD   G +IV+ A+  P+ QI +NAG +  ++++  LK     +GFNAATG++V+M + G++DP KVTR ALQNA SV+++ LTTEAV+ D+ +     +P
  S:     1 MAKDIKFSEDARSLMLQGVDKLANAVKITLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELENPYENMGAKLVAEVASKTNEIAGDGTTTATVLAQAIIREGLKNVTAGANPVGIRKGIDKAVAAALTELHSISRPVSNKDEIAQVAAISA-ADDEVGQLIAEAMERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASHYMVTDTDKMEAVLDNPYILITDKKITNIQEVLPLLEQVVQQGRPLLMIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGQVITEELGLDLKSADISSLGRAAKVVVTKDNTTIVEGVGGADAIEARIGQIRAQLAETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALLNVYAAVEKVAESEAGDVATGVKIVLRALEEPVRQIANNAGLEGSIIVDR-LKREEIGIGFNAATGEWVNMMEAGVVDPAKVTRSALQNAASVAALFLTTEAVVADIPEPAGAGMP 532
>gi|94264998|ref|ZP_01288768.1| Chaperonin Cpn60/TCP-1 [delta proteobacterium MLMS-1] >gi|93454545|gb|EAT04826.1| Chaperonin Cpn60/TCP-1 [delta proteobacterium MLMS-1] (554 aa)
Score = 1386, Expect = 4.5e-151, Identities = 301/530 (56%), Positives = 401/530 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           +K++K+    R  + +GV  L DAVK+T+GPRGRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTAT+LA  ++ EG + V +G NP++IKRG+DKTV A+V EL   +     + EI QV TISAN+D  IG +IA AM+KVG +GVITVEEAK +   L VVEGMQFDRGY+SPYFVTD+ KM   LE+PYILI++KKVSS+KD+LPILE+I K  +PL+I+A+DVDGEAL TLVVNK+RG  NV AVKAP FGD+RK +LEDIA+LTGG  V++DLGI  + +T+ DLGQA+ VVIDKDN+TIV G G + +++ R+ +I+  IE + SDYD++ L+ RLAKL  GVAVI VGA +EVE+KEKK RV+DAL+AT+AA+EEGIV GGG A +   K +    L L  ++ +G +IV  A+  P+ QI +NAG +  V++ ++    + + GFNA T K+ D+   G+IDP KVTR ALQNA S++ +LLTTE +I +  +D +D
  S:     3 SKDLKYGTKGREAMQHGVNILADAVKITLGPRGRNVVIEKSFGAPTITKDGVTVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATLLAQAIYSEGSKLVAAGNNPMDIKRGIDKTVEAVVAELRNIANPTKTQKEIAQVGTISANNDPTIGNIIAEAMDKVGKEGVITVEEAKSMETSLDVVEGMQFDRGYLSPYFVTDSEKMETNLEDPYILISEKKVSSMKDLLPILEQIAKMNKPLVILAEDVDGEALATLVVNKLRGTLNVAAVKAPGFGDRRKAMLEDIAVLTGGQVVSEDLGIKLENITVNDLGQAKRVVIDKDNTTIVDGAGQKDRLEARVKQIRAQIEESSSDYDREKLQERLAKLIGGVAVINVGAATEVEMKEKKARVEDALNATRAAVEEGIVPGGGVAYLRCLKAL--KDLKLSQEQDLGRRIVARALEEPVRQIANNAGLEGSVIVEQVKNMKDINKGFNADTEKFEDLLNAGVIDPAKVTRFALQNAASIAGLLLTTECMIAEHPEDDKD 530
>gi|91203322|emb|CAJ72961.1| stronlgy similar to 60 kDa chaperonin (GroEL protein) [Candidatus Kuenenia stuttgartiensis] (539 aa)
Score = 1386, Expect = 4.9e-151, Identities = 294/532 (55%), Positives = 400/532 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSV 533
           AK++ + + AR  L  G++QL D V+VTMGP GRNV+++K +GAP +TKDGV+VAKEV+L NP ENMGA++V +VASKT+D AGDGTTTAT+LA  +F EG++ V +GANP+ +KRG+DK V+ +V EL + S  I  + EI QV TISAN+D  IG L+A+AM+KVG DGVITVEEAKGI   L +VEGMQFD+GY+SPYF+TD   M   LEN YILI +KK+SS++D+LP+LE+I  +G+P LII++DV+GEAL TLVVNK+RGV +  AVKAP FGD+RK +LEDIAILT G  +T+DLG+  + + ++DLG A+ + I+KDN+TI++G   +  I+ RI +IK  IE T S+YDK+ L  RLAKL  GVAVI VGA +EVE+ EKK RV+DAL AT+AA+EEGIV GGG A +     +   + N  GDEKIG  ++   + +P+ QI +N G D  VV  E+ K  + ++G+NA TG+YVDMF  GI+DP KV+R+ALQN+ SV+ +LLTTE ++ + K+D+++ +
  S:     3 AKQLIYDEIARGSLRKGIRQLADVVRVTMGPTGRNVILEKGFGAPSVTKDGVTVAKEVELKNPFENMGAKMVCEVASKTSDIAGDGTTTATILAEAIFNEGMKYVTAGANPMALKRGIDKAVDVVVAELKQLSIPIKGRAEIAQVGTISANNDASIGNLLADAMDKVGKDGVITVEEAKGIETTLEIVEGMQFDKGYLSPYFITDAQNMEVVLENAYILIHEKKISSMRDLLPLLEKIAGSGKPFLIISEDVEGEALATLVVNKLRGVLSCAAVKAPGFGDRRKAMLEDIAILTNGKAITEDLGLKLENIGIEDLGVAKRITINKDNTTIIEGAATKENIQARIRQIKNQIEQTTSNYDKEKLSERLAKLAGGVAVIHVGAATEVEMNEKKARVEDALHATRAAVEEGIVPGGGIAYIRTIPALKEASKNANGDEKIGMDLIAKVLEAPLRQIANNTGADGSVVFEEV-KGLSANMGYNANTGEYVDMFVAGIVDPAKVSRVALQNSASVAGLLLTTETMVTEYKEDEDEKI 533
>gi|149369942|ref|ZP_01889793.1| chaperonin GroEL [unidentified eubacterium SCB49] >gi|149356433|gb|EDM44989.1| chaperonin GroEL [unidentified eubacterium SCB49] (542 aa)
Score = 1386, Expect = 5.0e-151, Identities = 315/528 (59%), Positives = 410/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKI-ARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ +  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L + +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV +L K + K+ +  D+I QVA+ISAN+D +IG+LIA A  KVG +GVITVEEAKG +  + VVEGMQFDRG++SPYFVT++ KM  +LENP IL+ DKK+SS+KD+LPILE + + G+ LLIIA+D+DGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  T+  LG AE+V IDKDN+TIV G G ++ I+ R+ +IK+ IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV     ++  T + + DE  G QIV  AI +P+  IVSNAG +  VVIN++ +    + G++A + +YVDM + GIIDP KVTRIAL+NA SVS M+LTTE  + D+K+D
  S:     1 MAKDIKFDLEARDGIKRGVDALANAVKVTLGPKGRNVIIGKSFGAPQVTKDGVSVAKEIELEDALENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVEAIVKDLEKQATKVGSDSDKIKQVASISANNDDQIGDLIAQAFGKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGFLSPYFVTNSEKMTTELENPMILLCDKKISSMKDLLPILEPVAQQGKSLLIIAEDLDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENATIDLLGTAETVTIDKDNTTIVNGAGEKNNIQARVGQIKSQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKAVLSKITTDHL-DETTGVQIVAKAIEAPLRTIVSNAGGEGSVVINKVSEGKK-NFGYDAKSDQYVDMIKAGIIDPKKVTRIALENAASVSGMILTTECALIDIKED 527
>gi|110601397|ref|ZP_01389586.1| chaperonin GroEL [Geobacter sp. FRC-32] >gi|110547906|gb|EAT61143.1| chaperonin GroEL [Geobacter sp. FRC-32] (549 aa)
Score = 1385, Expect = 5.7e-151, Identities = 304/524 (58%), Positives = 392/524 (74%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK IKF    RN    GV  L DAVKVT+GP+GRNV+I+KS+GAP+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+DK V  +V EL   SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A LEN  ILI DKK+S++KD+LP+LE+  K+GRPL+IIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIA+LTGG  +++++G   +  T+  LGQA+ + IDKDN+TI+ G G E  I  R+  I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA++EGIV GGG A +       ++ LNL  +++ G  ++  A+  PI QI  NAG D  +V++++ K      G+NAA  +YVDM Q GIIDP KV+R ALQNA S++ ++LTTEA+I D
  S:     1 MAKVIKFDQEGRNAFLKGVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGIDKAVETLVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEANLENANILIHDKKISNMKDLLPVLEQTAKSGRPLVIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAVLTGGKVISEEVGFKLENTTMDMLGQAKKITIDKDNTTIIDGAGAEGDIAGRVKMIRAQIEETSSDYDREKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVDEGIVPGGGVAYLRAMS--TLDALNLPTEQQFGVNVIKRALEEPIRQIAQNAGVDGSIVVDKV-KNGKDAFGYNAADDEYVDMIQAGIIDPTKVSRSALQNASSIAGLMLTTEAMIAD 521
>gi|89891824|ref|ZP_01203326.1| 60 kDa chaperonin GroEL HSP60 heat shock protein [Flavobacteria bacterium BBFL7] >gi|89515979|gb|EAS18644.1| 60 kDa chaperonin GroEL HSP60 heat shock protein [Flavobacteria bacterium BBFL7] (545 aa)
Score = 1385, Expect = 5.8e-151, Identities = 313/528 (59%), Positives = 409/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAKEIKF   AR+ +  GV  L +AVKVT+GP+GRNV+I KS+GAPV+TKDGVSVAKE++L + +ENMGAQ+VK+VAS+T D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AI  +L+K SKK+    E+I QVA+ISAN+D+ +G+LIA A  KVG +GVITVEEAKG    + VVEGMQFDRGY+SPYFVT++ KM  +L+NPYIL+ DKK+S++K+++P+LE + +TG+PLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G + +  TL+ LG AE V I+KDN+T+V G G  + IK R+ +IK+ IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  +K +      +  DE+ G  IV  AI +P+  IV NAG +  VVI++IL++     G++A    YVDM + GIIDP KVTR+AL+NA SVS M+LTTE  + D+K++
  S:     1 MAKEIKFDLEARDGIKRGVDALANAVKVTLGPKGRNVIIGKSFGAPVVTKDGVSVAKEIELADELENMGAQMVKEVASRTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVEAITADLDKQSKKVGDSSEMIKQVASISANNDEVVGDLIAKAFGKVGKEGVITVEEAKGTETYVDVVEGMQFDRGYLSPYFVTNSEKMTTELDNPYILLFDKKISTMKELMPVLEPVAQTGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFTLENATLEMLGTAEKVDINKDNTTVVNGSGKAADIKSRVGQIKSQIENTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVR-AKAVLGKLKAVNADEETGISIVTRAIEAPLRTIVENAGGEGSVVISKILESKGSQ-GYDAKNDSYVDMLEAGIIDPKKVTRVALENAASVSGMILTTECALVDIKEE 527
>gi|83630239|gb|ABC26736.1| GroEL [Streptococcus lutetiensis] (533 aa)
Score = 1385, Expect = 6.3e-151, Identities = 311/537 (57%), Positives = 406/537 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTG + +T+DLG+      +  LGQA  V +DKD++ +V+G G    I  R++ IK+ +  T S++D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L L GDE  G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ +   +   S PA P
  S:     1 MAKDIKFSSDARASMMRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAAVKVAVDELKSIARPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVADLENPYILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGATVITEDLGLELKDANMAALGQAAKVTVDKDSTVLVEGAGDADAIANRVNVIKSQLVSTTSEFDREKLQERLAKLAGGVAVIKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVISK--VAELELDGDEATGRNIVLRALEEPVRQIAFNAGYEGSVII-ERLKNSEVGTGFNAANGEWVNMVEAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-HPEPAASTPAAP 532
>gi|75519427|sp|Q6W1D5|CH602_RHISN 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|36959008|gb|AAQ87433.1| 60 kDa chaperonin GroEL [Rhizobium sp. NGR234] (542 aa)
Score = 1385, Expect = 6.8e-151, Identities = 295/521 (56%), Positives = 409/521 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE++F   AR K+  GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+DK V+A+V EL ++++K+ + DEI QV TISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  +LE PY+LI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ VV++K+N+TIV G G +++I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEG++ GGG AL+   K ++ V T N   D++ G +IV  AI +P+ QI  NAG +  +++ ++ + T    G+NA T ++ D+F+ G+IDPVKV R ALQ+A SV+ +L+TTEA++
  S:     3 AKEVRFHTEAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGVDKAVDAVVEELRRNARKVTKNDEIAQVGTISANGDTEIGRFLAEAMEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEPYVLIHEKKLSNLQALLPVLESVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTAISEDLGIKLENVTLDMLGRAKKVVVEKENTTIVDGAGSKTEIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDAMHATRAAVEEGVLPGGGVALLRAVKALDRVQTEN--PDQRHGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFGYGWNAQTNEFGDLFEQGVIDPVKVVRTALQDAASVAGLLITTEAMV 522
>gi|56552825|ref|YP_163664.1| chaperonin GroEL [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802829|sp|P48220|CH60_ZYMMO 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|56544399|gb|AAV90553.1| 60 kDa chaperonin, GroEL [Zymomonas mobilis subsp. mobilis ZM4] (546 aa)
Score = 1384, Expect = 6.9e-151, Identities = 298/528 (56%), Positives = 403/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KFS  AR ++  GV  L DAVKVT+GP+GRNV++ K++GAP ITKDGVSVAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVLA  + +EG+++V +G NP+++KRG+D     +V  L   SK ++  +E+ QV  ISAN D+++G  IA AMEKVG +GVITVEEAKG + EL VVEGMQFDRGY+SPYF+T+  KM+A+L +PYILI +KK+S+++ ILPILE ++++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  +++DLGI  + VTL  LG A+ V I K+N+TIV G G +S IK+R+  I++ IE T SDYD++ L+ R+AKL  GVAVIKVG  +EVE+KE+KDRVDDAL AT+AA++EGIV GGG AL++ +K +  +N +N   D++ G  IV  A+ +P+ QI  NAGFD  VV  +++   +  +GFNA T KY D+  TG+IDP KV R ALQ+A SV+ +L+TTEA + D+ +DK
  S:     3 AKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVLDKAFGAPRITKDGVSVAKEIELKDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGIDLAATKVVESLRSRSKPVSDFNEVAQVGIISANGDEEVGRRIAEAMEKVGKEGVITVEEAKGFDFELDVVEGMQFDRGYLSPYFITNPEKMVAELADPYILIYEKKLSNLQSILPILESVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGELISEDLGIKLENVTLNMLGSAKRVSITKENTTIVDGAGDQSTIKDRVEAIRSQIEATTSDYDREKLQERVAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVQEGIVPGGGTALLYATKTLEGLNGVN--EDQQRGIDIVRRALQAPVRQIAQNAGFDGAVVAGKLIDGNDDKIGFNAQTEKYEDLAATGVIDPTKVVRTALQDAASVAGLLITTEAAVGDLPEDK 529
>gi|37701743|gb|AAR00647.1| GroEL [Enterococcus faecalis] (524 aa)
Score = 1384, Expect = 7.2e-151, Identities = 310/524 (59%), Positives = 405/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKF++ AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++      V EL+  S  +  K+ I QVA +S+ S+K +G+LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I  R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V  L   GD   G +IV+ A+  PI QI  NAG++  V++++ LK  +  +GFNAA G++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFAEDARAAMLRGVDVLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKTAVEELHNISSVVDSKEAIAQVAAVSSGSEK-VGQLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDTTIENLGNASKVVVDKDNTTIVEGAGSKEAIDARVHLIKNQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVIGK--VAALEAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVDLGIGFNAANGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|23451141|gb|AAN32675.1|AF417585_2 GroEL [Enterococcus durans] (531 aa)
Score = 1384, Expect = 7.5e-151, Identities = 310/524 (59%), Positives = 408/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKE+KFS+ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QVA +S+ SDK +G LIA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV++K+RG FNVVAVKAP FGD+RK +LEDIAILTG + +TDDLG+     T+++LG A  VV+DK+N+TIV+G G ++ I+ R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  +  V+ ++  GD   G +IV+ A+  PI QI  NAG++  V++++ LK      GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKELKFSEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISTVVDSKEAIAQVAAVSSGSDK-VGHLIADAMEKVGNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLDKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGSTVITDDLGLELKDATIENLGNASKVVVDKENTTIVEGSGEKTAIEARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVIGK--VSAVDAEGDVATGIKIVVRALEEPIRQIAENAGYEGSVIVDK-LKNVELGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|150396499|ref|YP_001326966.1| chaperonin GroEL [Sinorhizobium medicae WSM419] >gi|187470755|sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|150028014|gb|ABR60131.1| chaperonin GroEL [Sinorhizobium medicae WSM419] (542 aa)
Score = 1384, Expect = 8.2e-151, Identities = 301/539 (55%), Positives = 415/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AKE+KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVLA  + +EG + + SG NP+++KRG+D  V+A+V EL  +++KI++  EI QV TISAN D +IG  +A AMEKVG++GVITVEEAK  + EL VVEGMQFDRGY+SPYFVT+ +KM  +LE+PYILI +KK+S+++ ILP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ V++DLGI  + VTL+ LG+A+ V I+K+N+TI+ G G +++I+ R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+     ++ + T N   D+++G +IV  AI +P+ QI  NAG +  +++ ++ +      G+NA T +Y D++  G+IDPVKV R ALQ+A SV+ +L+TTEA+I   +  K++S PA+P  G
  S:     3 AKEVKFQADARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAIASGMNPMDLKRGIDLAVDAVVKELKSNARKISQNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTSDTELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSILPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIMLENVTLEMLGRAKKVSIEKENTTIIDGAGSKTEIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGIALLRAVNALDGLKTAN--DDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKVEFSYGWNAQTNEYGDLYTMGVIDPVKVVRTALQDAASVAGLLVTTEAMI--AEKPKKESTPALPAGG 538
>gi|88801438|ref|ZP_01116966.1| chaperonin GroEL [Polaribacter irgensii 23-P] >gi|88782096|gb|EAR13273.1| chaperonin GroEL [Polaribacter irgensii 23-P] (544 aa)
Score = 1384, Expect = 8.2e-151, Identities = 320/528 (60%), Positives = 408/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L N +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V AIV +L K +KK+    E I Q+A ISAN+D  IGELIA A  KVG +GVITVEEAKG+   + VVEGMQFDRGY+SPYFVTD +KMIA LENPYIL+ DKK+S++++ILPILE + + GRPLLIIA+DVDG+AL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++ G S +  TL  LG AE++ +DKDN+TI+ G G    IK R+++IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   + +  ++TLN+  DE  G QI+  AI +P+  IV NAG +  V++N++L+      G++A    YVDM + GIIDP KVTR+AL+NA SV+ M+LTTE  + D+K+D
  S:     1 MAKDIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIISKSFGAPTVTKDGVSVAKEIELENELENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVAAIVADLEKQAKKVGNSSEKIKQIAAISANNDNTIGELIATAFTKVGKEGVITVEEAKGMETYVDVVEGMQFDRGYLSPYFVTDADKMIADLENPYILLFDKKISNLQEILPILEPVSQAGRPLLIIAEDVDGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFSLENATLDLLGTAETITVDKDNTTIINGAGNAEAIKTRVNQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKRALEKIDTLNI--DESTGVQIINKAIEAPLRIIVENAGKEGSVILNKVLEGKK-DFGYDAKNDVYVDMLEAGIIDPKKVTRVALENAASVAGMILTTECALIDIKED 527
>gi|154248184|ref|YP_001419142.1| chaperonin GroEL [Xanthobacter autotrophicus Py2] >gi|154162269|gb|ABS69485.1| chaperonin GroEL [Xanthobacter autotrophicus Py2] (543 aa)
Score = 1384, Expect = 8.4e-151, Identities = 311/540 (57%), Positives = 415/540 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK++KFS  AR+K+  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L +  EN+GAQLV++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+D  V+AIV +L  +S+K+   DEI QV TISAN D ++G+ +A AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E PYILI +KK+S ++++LP+LE ++++ RPLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DIAILTGG+ ++DDLGI  D V L  LG+A+ VVI+K+N+TIV G G +++I+ RI++I+  IE T SDYD++  + RLAKL  GVAV++VG  +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K +    ++   D+K G +IV  AI +P  QIV NAG D  VV+ +IL++++   G+NA TG+YVDM + GIIDP KV R ALQ+A SVS +L+TTEA+I ++      + PAMP  GM
  S:     3 AKDVKFSVDARDKVLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVDAIVKDLASNSRKVTSNDEIAQVGTISANGDAEVGKFLAEAMKKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNADKMRVEFEEPYILINEKKLSGLQELLPVLEAVVQSARPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGTVISDDLGIKLDSVNLSMLGRAKKVVIEKENTTIVDGSGEKAEIEARIAQIRAQIETTTSDYDREKAQERLAKLAGGVAVVRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALLRSIKALEGLKVD-NADQKTGIEIVRRAIQAPARQIVLNAGDDGSVVVGKILESSDYSFGYNAQTGEYVDMVKAGIIDPTKVVRTALQDAASVSGLLITTEALIAELPKKNAPAAPAMPGGGM 541
>gi|85709559|ref|ZP_01040624.1| chaperonin GroEL [Erythrobacter sp. NAP1] >gi|85688269|gb|EAQ28273.1| chaperonin GroEL [Erythrobacter sp. NAP1] (550 aa)
Score = 1384, Expect = 8.8e-151, Identities = 308/537 (57%), Positives = 401/537 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK++KFS  AR  +  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGV+VAKE++L +  ENMGAQ++K+VASKT D AGDGTTTATVL   + +EG+  V +G NP+++KRG+D     +V  L   SK ++  +EI QV  ISAN D+++GE IA AMEKVG +GVITVEEAKG+  EL VVEGMQFDRGY+SPYF+T+ +KM  +L+NPYILI +KK+S+++ +LP+LE  +++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DIAILT G  +++DLGI  + VTL  LG+A+ V IDKDN+TIV G G E  IK R+ +I+T I+ T SDYD++ L+ RLAKL  GVAVIKVG  SEVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++ +K +      L G   D+  G  IV  AIM+P+ QI  NAG D  VV   +L+  N   GFNAAT  Y D+ + G+IDP KV R ALQ+A SV+ +L+TTEA I D  +D + + PAMP+
  S:     3 AKDVKFSREAREGILKGVDTLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELKDKFENMGAQMLKEVASKTNDLAGDGTTTATVLGQAIAREGMTAVAAGMNPMDLKRGIDLATTKVVENLKARSKDVSGSEEIAQVGVISANGDREVGEKIAEAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPDKMQVELDNPYILIHEKKLSNLQAMLPVLEAAVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEMISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVGEIRTQIDNTTSDYDREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYATKVLE----GLKGDNDDQTRGIDIVRRAIMAPVRQIAQNAGHDGAVVSGNLLREDNESQGFNAATDTYEDLVKAGVIDPTKVVRTALQDAASVAGLLITTEAAITDAPED-DKAAPAMPD 537
>gi|116333267|ref|YP_794794.1| chaperonin GroEL [Lactobacillus brevis ATCC 367] >gi|122270045|sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116098614|gb|ABJ63763.1| Chaperonin GroEL (HSP60 family) [Lactobacillus brevis ATCC 367] (541 aa)
Score = 1383, Expect = 9.0e-151, Identities = 308/545 (56%), Positives = 411/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKE+KFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG P IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++K   A V+ L+K S  +  KD+I Q+A+IS+ S K+ G+LIA+AMEKVG+DGVIT+EE++G++  L VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+++I+DILP+L+ +++  R LLIIADD+ GEAL TLV+NKMRG FNVVAVKAP FGD+RK  L+DIA+LTGG+ +TDDLG++    T+  LGQA+ V + KD++T+V+G G + QI  R+++IK  IE T SD+D+D L+ RLAKL+ GVAV++VGA +E ELKE+K R++DAL+AT+AA+EEG V GGG AL++V    +V  L   GDEK G  IV+ A+  P+ QI  NAG +  VV+ E LK   P +G+NAA  KY DM   GI DP KVTR ALQNA SVS++LLTTEAV+ +  +D         N GMGGMM
  S:     1 MAKELKFSEDARSKMLAGVDKLANTVKTTLGPKGRNVVLEQSYGNPTITNDGVTIAKAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIEKATGAAVDALHKMSHDVKTKDDIAQIASISSAS-KETGKLIADAMEKVGNDGVITIEESRGVDTSLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIANIQDILPLLQSVVEQSRSLLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKAQLQDIAVLTGGTVITDDLGLNLKDTTIDQLGQAQKVNVTKDDTTVVEGAGSKDQIAARVAEIKGQIEDTTSDFDRDKLKERLAKLSGGVAVVRVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTALINVIG--DVAKLEAEGDEKTGINIVLRALEEPVRQIAQNAGVEGSVVV-EHLKGEKPGVGYNAADNKYEDMVAAGITDPTKVTRSALQNAASVSALLLTTEAVVAEKPEDNPAPAAPAANPGMGGMM 541
>gi|86361060|ref|YP_472947.1| chaperonin GroEL [Rhizobium etli CFN 42] >gi|123508568|sp|Q2JYW6|CH604_RHIEC 60 kDa chaperonin 4 (Protein Cpn60 4) (groEL protein 4) >gi|86285162|gb|ABC94220.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (542 aa)
Score = 1383, Expect = 9.2e-151, Identities = 303/536 (56%), Positives = 412/536 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AKE+KFS  AR K+  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V+AIV EL  +++KI+   EI QV TISAN D +IG  +A A++KVG+DGVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E+PYILI +KK+S+++ +LPILE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ +++DLGI  + VTL  LG+A+ + ++K+N+TI+ G G + +I  RI++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K + N+ T N   D+++G +IV  A+ +P  QI  NAG +  VV+ ++ + ++   G+NA TG++ D++  G+IDP KV R ALQ+A S++ +L+TTEA+I   +  K+D+ PAMP
  S:     3 AKEVKFSVEAREKMLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVSAIVEELKANARKISNNAEIAQVGTISANGDAEIGRFLAEAVQKVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPILEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLENVTLNMLGRAKKITVEKENTTIIDGVGSKEEISGRIAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDNIKTAN--DDQRVGVEIVRRALEAPARQIAENAGAEGSVVVGKLREKSDFSYGWNAQTGEFGDLYAQGVIDPAKVVRTALQDASSIAGLLVTTEAMI--AEKPKKDAPPAMP 535
>gi|62185227|ref|YP_220012.1| chaperonin GroEL [Chlamydophila abortus S26/3] >gi|34391392|gb|AAL14265.1| GroEL [Chlamydophila abortus] >gi|62148294|emb|CAH64061.1| 60 kDa chaperonin [Chlamydophila abortus S26/3] (544 aa)
Score = 1383, Expect = 1.0e-150, Identities = 297/540 (55%), Positives = 404/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK IK+++ AR K+  GV+ L +AVKVT+GP+GR+V+I KS+G+P +TKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRG+DK V  +V+++ K SK +    EI QVATISAN+D +IG LIA AMEKVG +G ITVEEAKG    L VVEGM F+RGY+S YF T+       LE   +LI DKK+S IKD LP+L+++ ++GRPLLIIA+D++GEAL TLVVN++R  F V AVKAP FGD+RK +LEDIAILTGG  ++++LG+  +  TL  LG+A+ V++ K+++TIV+G G +  I+ R   IK  IE + SDYDK+ L+ RLAKL+ G+AVI+VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG ALV     +      L   DE+IG +IV+ A+ +P+ QI +NAG +  ++  ++L A + + G++A    Y DM + GI+DP KVTR AL++A SV+ +LLTTEA+I D+ ++K  SVPAMP  GM
  S:     3 AKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDQIKKISKPVQHHKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFTTNPETQECVLEEALVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAILTGGQLISEELGMKLENTTLSMLGKAKKVIVSKEDTTIVEGLGNKEDIEARCENIKKQIEDSTSDYDKEKLQERLAKLSGGIAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALVRCIPTLEAFIPVLTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVL-ARSSNEGYDALRDAYTDMIEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEEKSSSVPAMPGAGM 542
>gi|15677802|ref|NP_274966.1| chaperonin GroEL [Neisseria meningitidis MC58] >gi|9911060|sp|P42385|CH60_NEIMB 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63) (HSP60) >gi|7227233|gb|AAF42301.1| chaperonin, 60 kDa [Neisseria meningitidis MC58] (544 aa)
Score = 1383, Expect = 1.1e-150, Identities = 294/537 (54%), Positives = 413/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V+EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+TI+ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM + G++DP KVTR ALQ+A S++ ++LTT+ +I ++ +DK    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVDELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEDK----PAVPD 533
>gi|56807977|ref|ZP_00365789.1| COG0459: Chaperonin GroEL (HSP60 family) [Streptococcus pyogenes M49 591] (543 aa)
Score = 1383, Expect = 1.1e-150, Identities = 307/522 (58%), Positives = 402/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANPI I+RG++      V  L   ++ ++ K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+ILITDKKVS+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG F+VVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T+  LGQA  + +DKD++ IV+G G    I  RI+ IK+ +E T SD+D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG AL+ V ++  V  L L GD+  G  IV+ A+  P+ QI  NAG++  VVI++ LK +    GFNAATG++VDM +TGIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSADARAAMVRGVDMLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVHEGLKNVTAGANPIGIRRGIETATATAVEALKAIAQPVSGKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITDKKVSNIQDILPLLEEVLKTNRPLLIIADDVDGEALPTLVLNKIRGTFSVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATMTALGQAAKITVDKDSTVIVEGSGSSEAIANRIALIKSQLETTTSDFDREKLQERLAKLAGGVAVIKVGAPTETALKEMKLRIEDALNATRAAVEEGIVAGGGTALITVIEK--VAALELEGDDATGRNIVLRALEEPVRQIALNAGYEGSVVIDK-LKNSPAGTGFNAATGEWVDMIKTGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|29839339|sp|Q8GBD2|CH60_ACEAC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|23096062|dbj|BAC16232.1| groEL [Acetobacter aceti] (546 aa)
Score = 1382, Expect = 1.2e-150, Identities = 300/528 (56%), Positives = 398/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG------DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF   AR ++  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V  ++ EL K++KK+    E  QV TISAN + +IG++I+ AM+KVGS+GVITVEEAK    EL VVEGMQFDRGYISPYFVT+  KM A LENPYILI +KK+SS++ +LP+LE ++++GRPLLIIA+DVDGEAL TLVVNK+RG   + AVKAP FGD+R  +LEDIAILTGG  +++DLGI  + VTL  LG A+ V IDK+N+TIV G G    IK R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL          TL L G      D+++G  I+  A+ +P+ QI  NAG D  V+ N++L+ ++ + GF+A  G+Y ++ + GIIDP KV R ALQ+A SV+ +L+TTEA++ +  + K
  S:     3 AKDVKFGADARQRMRAGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGIDKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEAKHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESVVQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRNVMLEDIAILTGGQVISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALARA-------TLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFDAQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKK 529
>gi|163850181|ref|YP_001638224.1| chaperonin GroEL [Methylobacterium extorquens PA1] >gi|163661786|gb|ABY29153.1| chaperonin GroEL [Methylobacterium extorquens PA1] (548 aa)
Score = 1382, Expect = 1.2e-150, Identities = 300/533 (56%), Positives = 407/533 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK+++FS  AR+K+  GV+ L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASK++D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+D  V A+V ++ + ++K+A  +EI QV TISAN DK+IGE+IA+AMEKVG +GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+  KMIA+LE+PYILI +KK+ S++ +LPILE +++ G+PLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIA+LT G  + +DLGI  + VTL+ LG A+ V IDK+ +TI+ G G ++ I+ R+++IK  IE T SDYD++ L+ R AKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  +K       N   D + G +IV+ A+ +PI QI  N+G +  +V+ +IL  ++   GFNA T +YVDM Q GI+DP KV R ALQ A SV+ +L+TTEA+I +    +   +P
  S:     3 AKDVRFSVEARDKMLRGVELLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADRFENMGAQMVREVASKSSDIAGDGTTTATVLAASIVREGVKYVAAGMNPMDLKRGIDLAVAAVVKDIGERARKVASSEEIAQVGTISANGDKEIGEMIAHAMEKVGKEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNAEKMIAELEDPYILIHEKKLGSLQALLPILEAVVQAGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIALLTKGQMIAEDLGIKLENVTLEMLGHAKRVRIDKETTTIIDGAGDKADIEARVAQIKAQIEETTSDYDREKLQERQAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALLR-AKAAAQGLTNENPDVQAGIKIVLKALEAPIRQIAQNSGVEGSIVVGKILANSSATYGFNAQTEEYVDMLQAGIVDPAKVVRAALQGAASVAGLLVTTEAMISEAPRKEAPQMP 534
>gi|83630236|gb|ABC26734.1| GroEL [Streptococcus infantarius subsp. infantarius] (529 aa)
Score = 1382, Expect = 1.2e-150, Identities = 309/522 (59%), Positives = 401/522 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V+EL   ++ +A K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I+DILP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTG + +T+DLG+      +  LGQA  V +DKD++ IV+G G    I  RI+ IK+ +  T S++D++ L+ RLAKL  GVAVIKVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L L GDE  G  IV+ A+  P+ QI  NAG++  V+I E LK +    GFNAA G++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSSDARASMMRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAAVKVAVDELKSIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGATVITEDLGLELKDANMAALGQAAKVTVDKDSTVIVEGAGDADAIANRINVIKSQLVSTTSEFDREKLQERLAKLAGGVAVIKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVISK--VAELELDGDEATGRNIVLRALEEPVRQIAFNAGYEGSVII-ERLKNSEVGTGFNAANGEWVNMVEAGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|167358216|ref|ZP_02292874.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074888|gb|EDR78706.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325] (544 aa)
Score = 1382, Expect = 1.4e-150, Identities = 303/543 (55%), Positives = 405/543 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AKEI+FS  AR++L  GV+ L +AVKVT+GP+GRNV+I K+YGAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  +F+EG + V +G NP++++RG+D  V A+V E+   + K+    EI QV TI+AN D  IGE+IA AM+KVG++GVITVEEA+    EL VVEGMQFDRGY+SPYFVT+  KM  +LE+PYIL+ +KK+ S++ +LPILE +++TG+PLL+I++DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIA+LT G  +++DLGI  D VTL  LG+A+ V+IDK+++TI+ G G ++ I+ RI +IK  IE T SDYDK+ L+ RLAKL  GVAVI+VG  +E E+KEKKDR+DDAL+AT+AA+EEGIV GGG AL+     +   T     D   G  IV+ A+ +PI QI  NAGF+  +V+ ++  + N + GF+A T  YVDM + GI+DP KV R ALQ+A S++++L+T E +I D+     DS PA  N GMG M
  S:     3 AKEIRFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGIDLGVTAVVKEIKARAMKVKSSGEIAQVGTIAANGDAAIGEMIAKAMDKVGNEGVITVEEARTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILVHEKKLGSLQAMLPILEAVVQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAVLTSGQMISEDLGIKLDNVTLDMLGRAKRVLIDKESTTIIDGSGEKAAIQARIQQIKAQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIDDALNATRAAVEEGIVPGGGVALLRAKSALTGLT-GENADVTAGISIVLRALEAPIRQIADNAGFEGSIVVGKLAGSNNHNQGFDAQTETYVDMIEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIP--ARDSAPAAGNGGMGDM 542
>gi|23451155|gb|AAN32683.1|AF417589_2 GroEL [Streptococcus mitis] (534 aa)
Score = 1382, Expect = 1.5e-150, Identities = 309/522 (59%), Positives = 403/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG ALV+V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK      GFNAATG++V+M   GIIDPVKV+R ALQNA SV+S++LTTEAV+
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIPA--VADLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAEVGTGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVV 518
>gi|112004977|gb|ABH85370.1| symbionin [Buchnera aphidicola] (545 aa)
Score = 1381, Expect = 1.6e-150, Identities = 304/544 (55%), Positives = 412/544 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPAMPNMGMGGMM 545
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTAT+LA  +  EGL+ V +G NP+++KRG+DK V + V EL   S   +    I QV TISAN+D+K+G LIA AMEKVG+DGVITVEE  G+ +EL VV+GMQFDRGY+SPYF+   +  I +LENPYIL+ DKK+S+++++LPILE + K+G+PLLII++D++GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DI+ILTGGS ++++L +  +K TL+DLGQA+ VVI+KD +TI+ G G +  I+ RI +I+  I+   SDYDK+ L  RLAKL+ GVAV+KVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV V+ +I+    NL G   D+ +G ++ + A+ +P+ QIVSN+G +  VV N + K    + G+NAAT +Y DM   GI+DP KVTR ALQ A SV+ +++TTE ++ D+ ++DK   V + P  GMGGMM
  S:     3 AKDVKFGNEARIKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPSITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATLLAQSIVNEGLKAVAAGMNPMDLKRGIDKAVISAVEELKNLSVPCSDSKAIAQVGTISANADEKVGALIAEAMEKVGNDGVITVEEGTGLQNELEVVKGMQFDRGYLSPYFINKPDTGIVELENPYILMADKKISNVREMLPILESVAKSGKPLLIISEDLEGEALATLVVNSMRGIVKVAAVKAPGFGDRRKAMLQDISILTGGSVISEELAMDLEKSTLEDLGQAKRVVINKDTTTIIGGSGEKQAIQSRIGQIRQEIQEAASDYDKEKLNERLAKLSGGVAVLKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALVRVAGKIS----NLRGHNEDQNVGIRVALRAMEAPLRQIVSNSGEEPSVVTNNV-KDGKGNYGYNAATDEYGDMIDFGILDPTKVTRSALQYAASVAGLMITTECMVTDLPREDKSSDVASSPAGGMGGMM 545
>gi|161869236|ref|YP_001598403.1| chaperonin GroEL [Neisseria meningitidis 053442] >gi|189082357|sp|A9M0Q6|CH60_NEIM0 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|161594789|gb|ABX72449.1| chaperonin 60kD subunit [Neisseria meningitidis 053442] (544 aa)
Score = 1381, Expect = 1.6e-150, Identities = 294/537 (54%), Positives = 412/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+TI+ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM + G++DP KVTR ALQ+A S++ ++LTT+ +I ++ +DK    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEDK----PAVPD 533
>gi|29840401|ref|NP_829507.1| chaperonin GroEL [Chlamydophila caviae GPIC] >gi|116233|sp|P15599|CH601_CHLCV 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) (57 kDa chlamydial hypersensitivity antigen) >gi|40579|emb|CAA35766.1| hypB protein [Chlamydophila caviae] >gi|29834750|gb|AAP05385.1| 60 kDa chaperonin [Chlamydophila caviae GPIC] (544 aa)
Score = 1381, Expect = 1.6e-150, Identities = 297/540 (55%), Positives = 402/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK IK+++ AR K+  GV+ L +AVKVT+GP+GR+V+I KS+G+P +TKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRG+DK V  +V+E+ K SK +    EI QVATISAN+D +IG LIA AMEKVG +G ITVEEAKG    L VVEGM F+RGY+S YF T+       LE   +LI DKK+S IKD LP+L+++ ++GRPLLIIA+D++GEAL TLVVN++R  F V AVKAP FGD+RK +LEDIAILTGG  ++++LG+  +  TL  LG+A+ V++ K+++TIV+G G +  I+ R   IK  IE + SDYDK+ L+ RLAKL+ GVAVI+VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG ALV     +      L   DE+IG +IV+ A+ +P+ QI +NAG +  ++  ++L  ++   G++A    Y DM + GI+DP KVTR AL++A SV+ +LLTTEA+I D+ ++K  S PAMP  GM
  S:     3 AKNIKYNEDARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDEIKKISKPVQHHKEIAQVATISANNDAEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFSTNPETQECVLEEALVLIYDKKISGIKDFLPVLQQVAESGRPLLIIAEDIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAILTGGQLISEELGMKLENTTLAMLGKAKKVIVSKEDTTIVEGLGSKEDIESRCESIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATLAAVEEGILPGGGTALVRCIPTLEAFIPILTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIICQQVLSRSSSE-GYDALRDAYTDMIEAGILDPTKVTRCALESAASVAGLLLTTEALIADIPEEKSSSAPAMPGAGM 542
>gi|167459910|ref|ZP_02326071.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1] >gi|167413811|gb|EDR80592.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-1] (547 aa)
Score = 1381, Expect = 1.6e-150, Identities = 295/523 (56%), Positives = 398/523 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AKEI F   AR  +  GVQ L +AV VT+GP+GRNV+I+KSYGAP ITKDGV+VAKE++L N  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +++EGL+ V +G NP+++KRG+D+ V  +V  L   S     KD+I QV TISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY SPYFVT+ ++M A LE+PY+L+T+KK++++ D++P+LE++ ++G+PLLIIA++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK++L+DIA LTGG+ V ++LGI  D++ L+DLG+A+ + +DKDN+TIV G+G +  I+ RI  ++  IE T S+YD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +    +   GD++ G QIV+ A+  P  +I  NAG+D  VV+N+IL+      GFNAAT  + D+ + G+IDP KV+R ALQNA SV+S+LLTTEA++ D
  S:     3 AKEIAFHQPAREAILRGVQTLAEAVAVTLGPKGRNVVIEKSYGAPTITKDGVTVAKEIELENKFENMGAQMVKEVASQTSDKAGDGTTTATVLARSIYEEGLKLVAAGHNPMDLKRGIDRAVEVVVAHLKSLSTPTKGKDDIAQVGTISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYSSPYFVTNPDRMEAVLEDPYVLVTEKKITAMADLVPVLEQVARSGKPLLIIAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIATLTGGTVVAEELGIKLDQLGLKDLGRAKRITVDKDNTTIVDGEGKKEDIQARIKVMRGQIEETTSEYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRALAELQKLDVGQ-GDQRFGVQIVVKALEWPARRIAENAGWDGPVVVNKILEGQGA-FGFNAATDTFEDLTKAGVIDPTKVSRTALQNAASVASLLLTTEAMVAD 523
>gi|21654715|gb|AAK71886.1| GroEL [Streptococcus oralis] (534 aa)
Score = 1381, Expect = 1.8e-150, Identities = 308/522 (59%), Positives = 403/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           M+KEIKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V A V  L  ++  +A K+ I QVA +S+ S+K +GE I+ AMEKVG DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD+ KM+A LENPYILITDKK+S+I++ILP+LE I+++ RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE T S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG AL +V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK      GFNAATG++V+M + GIIDPVKV+R ALQNA SV+S++LTTEAV+
  S:     1 MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEK-VGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSAVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPA--VADLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDR-LKNAEVGTGFNAATGEWVNMIEEGIIDPVKVSRSALQNAASVASLILTTEAVV 518
>gi|91783188|ref|YP_558394.1| chaperonin GroEL [Burkholderia xenovorans LB400] >gi|91783218|ref|YP_558424.1| chaperonin GroEL [Burkholderia xenovorans LB400] >gi|118597096|sp|Q13ZW7|CH602_BURXL 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|91687142|gb|ABE30342.1| 60 kDa chaperonin (Cpn60), groEL [Burkholderia xenovorans LB400] >gi|91687172|gb|ABE30372.1| 60 kDa chaperonin (Cpn60), groEL [Burkholderia xenovorans LB400] (540 aa)
Score = 1380, Expect = 2.1e-150, Identities = 299/534 (55%), Positives = 410/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AK++KF DSAR+++  GV  L DAVKVT+GP+GRNVLI++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL++ SK I    EI QV  ISAN+D+ IG++IA+AM+KVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D +K +A L++P IL+ DKK+SSI+D+LP+LE   K G+PLLIIA+DV+GEALTTLVVN MRGV  V AVKAP FGD+RK +LEDIAILTG + ++++ G   +K TL++LG+A+ V + K+N+ I+ G G +++I  R+  I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+     I+  T     D+  G +IV+ A+ +P+  I +NAG +  VV+ ++L     + G+NAATG+Y D+ +TG++DP KVTR ALQNA S++ ++LTT+A + +   + E +VPA
  S:     3 AKDVKFHDSARSRIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEIELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELHRLSKPIKTSREIAQVGAISANADEAIGKIIADAMDKVGKEGVITVEDGKSLENELEVVEGMQFDRGYLSPYFINDPDKQVAHLDDPLILLHDKKISSIRDLLPVLEAAAKAGKPLLIIAEDVEGEALTTLVVNSMRGVLKVAAVKAPGFGDRRKALLEDIAILTGATVISEETGKQLEKATLEELGRAKRVEVQKENTIIIDGAGDQTRIDARVKAIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRARSAISSLT-GANADQDAGIRIVLRALEAPLRVIAANAGDEPSVVVAKVLSGKGNY-GYNAATGEYGDLVETGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKE-EKAVPA 533
>gi|118595283|ref|ZP_01552630.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium HTCC2181] >gi|118441061|gb|EAV47688.1| chaperonin GroEL (Hsp60, Cpn10) [Methylophilales bacterium HTCC2181] (553 aa)
Score = 1380, Expect = 2.1e-150, Identities = 295/537 (54%), Positives = 411/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F D  R K+  GV  L +AVKVTMGP+G+NV++++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V + V EL+K SK      EI QV +ISANSD  +G++IA+AM+KVG +GVITVE+  G+++EL VVEGMQFDRGY+SPYF+ + ++ IA LE+P+IL+ DKK+SSIK++LP+LE++ K  +PLLIIA+D++GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG+ ++D++G++ + V ++DLGQA+ + + K+N+ ++ G G +  IK RI +IKT IE + SDYDK+ L+ R+AKL  GVAVIKVGA +E+E+KEKK RV+DAL +T+AA+EEGIV GGG AL+     I   T     D++ G +IV+ A+  P+ QIVSNAG +  VV+N + + T  + GFNAA   Y DM + G++DP KVTR ALQNA S++ ++LTTE +I D   D + + PAMP+
  S:     3 AKDVRFGDDVRQKMVKGVNTLANAVKVTMGPKGKNVVLERSFGAPTITKDGVSVAKEIELQDRFENMGAQMVKEVASKTSDSAGDGTTTATVLAQAIIREGMKSVAAGMNPMDLKRGIDKAVESAVAELHKLSKPCNTSKEIAQVGSISANSDTSVGQIIADAMDKVGKEGVITVEDGSGLSNELDVVEGMQFDRGYLSPYFINNQDRQIALLEDPFILLHDKKISSIKELLPVLEQVAKASKPLLIIAEDIEGEALATLVVNNIRGIIKAVAVKAPGFGDRRKAMLEDIAILTGGTVISDEVGLTLENVKIEDLGQAKKIEVGKENTIVIDGAGSQENIKTRIGQIKTQIEESSSDYDKEKLQERVAKLAGGVAVIKVGATTEIEMKEKKARVEDALHSTRAAVEEGIVPGGGVALIRAKDAI-AKTKGDNADQEAGIKIVLRAVEDPLRQIVSNAGIESSVVVNNVAEGTGNY-GFNAANETYGDMVEMGVLDPTKVTRSALQNAASIAGLMLTTECMIADQPKD-DSAAPAMPD 536
>gi|146308703|ref|YP_001189168.1| chaperonin GroEL [Pseudomonas mendocina ymp] >gi|166201741|sp|A4XYM0|CH60_PSEMY 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|145576904|gb|ABP86436.1| chaperonin GroEL [Pseudomonas mendocina ymp] (548 aa)
Score = 1380, Expect = 2.1e-150, Identities = 303/537 (56%), Positives = 408/537 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKE+KF DSAR K+  GV  L DAVK T+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQLVKDVASK  D AGDGTTTATVLA  +  EGL++V +G NP+++KRG+DK  +AIV +L   +K  A    I QV TISANSD  IG++IA AM+KVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+LE P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILTGG+ +++++G+S +  TL+ LG A+ VV++KDN+TI+ G G ++ I+ R+++I+  +E T SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I      L G   D+ +G  ++  A+ +P+ QIV+NAG +  VV++++ K  + + GFNAAT  Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ +  DDK    PAMP+
  S:     3 AKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKATSAIVAQLKDLAKPCADSKAIAQVGTISANSDNSIGDIIAEAMDKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISEEVGLSLESATLEHLGNAKRVVLNKDNTTIIDGAGAQADIEARVAQIRKQVEETSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALQAIE----GLKGDNEDQNVGIALLRRAVEAPLRQIVANAGGEPSVVVDKV-KQGSGNFGFNAATDTYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEAADDK---APAMPD 534
>gi|78186426|ref|YP_374469.1| chaperonin GroEL [Pelodictyon luteolum DSM 273] >gi|119366255|sp|Q3B5F5|CH60_PELLD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78166328|gb|ABB23426.1| Chaperonin Cpn60/TCP-1 [Pelodictyon luteolum DSM 273] (547 aa)
Score = 1380, Expect = 2.2e-150, Identities = 305/530 (57%), Positives = 403/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L + VKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L + IENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG+  EL VVEGMQFDRGY+SPYFVT++  M A+LE+  ILI DKK+ ++K++LPILE+  ++GRPLLIIA+D++GEAL TLVVN++RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA  + +DKDN+TIV+GKG + +IK RI++IK  I+ + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K ++ N +    D+K G  I+  A+  P+ QIV+N G   G V+ E +K      GFNA T +Y D+   G++DP KVTR AL+NA SV+S+LLTTEA I D+K+DK D
  S:     3 AKDILFDADARAKLKVGVDKLANTVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELDDAIENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVAELRNISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMETELKVVEGMQFDRGYLSPYFVTNSETMEAELEDALILIHDKKIGNMKELLPILEKSAQSGRPLLIIAEDIEGEALATLVVNRLRGTLKVCAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATVNYLGQAARITVDKDNTTIVEGKGTQDEIKARINEIKGQIDKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGLS-NAIADNEDQKTGIDIIRRALEEPLRQIVANTGTTDGAVVLERVKQGEGDFGFNARTEQYEDLVAAGVVDPTKVTRSALENAASVASILLTTEACITDIKEDKSD 531
>gi|167038116|ref|YP_001665694.1| chaperonin GroEL [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039172|ref|YP_001662157.1| chaperonin GroEL [Thermoanaerobacter sp. X514] >gi|166853412|gb|ABY91821.1| chaperonin GroEL [Thermoanaerobacter sp. X514] >gi|166856950|gb|ABY95358.1| chaperonin GroEL [Thermoanaerobacter pseudethanolicus ATCC 33223] (541 aa)
Score = 1380, Expect = 2.3e-150, Identities = 304/542 (56%), Positives = 407/542 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMG 542
           MAK+IK+ + AR  L  GV  + D VKVT+GPRGRNV++ K YG+P +T DGV++A+E++L +P EN GAQL+K+VA+KT D AGDGTTTAT+LA  + +EGL+N+ +GANP+ ++RG+ K V+A V  L + SK I  K+ I  VA+ISA +D++IG LIA AM+KVG DGVITVEE+K +   L VVEGMQFDRGYISPY VTD  KM A LE P ILITDKK+S+I+D+LP+LE++++ G+ LLIIADDV+GEAL TLVVNK+RG F  VAVKAP FGD+RK++L+DIAILTGG  ++++LG     V L  LG+A  V + K+N+TIV G G  ++IK+R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+ GA +E ELKEKK R++DAL+ATKAA+EEGIV GGG AL++V + +     +L GD K G +IV+ A+  P+ QI +NAG D  V++ +I  A +P+ G++A   ++ DMF+ GI+DP KVTR ALQNA S++SM+LTTEAV+ DV +       AMPN G G
  S:     1 MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIELEDPFENQGAQLLKEVATKTNDVAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIAKAVDAAVEGLKRISKPIDNKESIAHVASISA-ADEEIGNLIAEAMDKVGKDGVITVEESKTLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSNIQDLLPLLEQVVQHGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVISEELGYDLKDVRLDMLGRARQVKVTKENTTIVGGAGDAAEIKKRVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLNVIEDVQKVVDSLDGDFKTGAKIVLRALEEPVRQIAANAGVDGSVIVEKIKAAKDPNFGYDAYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAVVVDVPEKNT----AMPNPGAG 537
>gi|125717103|ref|YP_001034236.1| chaperonin GroEL [Streptococcus sanguinis SK36] >gi|166201756|sp|A3CKI1|CH60_STRSV 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|25452838|sp|Q8KJ16|CH60_STRSA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|21310102|gb|AAM46148.1|AF378197_2 GroEL [Streptococcus sanguinis] >gi|125497020|gb|ABN43686.1| 60 kDa chaperonin [Streptococcus sanguinis SK36] (540 aa)
Score = 1380, Expect = 2.4e-150, Identities = 310/536 (57%), Positives = 410/536 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM 536
           MAK+IKFS  AR+ +  GV  L + VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V  L  +S  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG+  EL VVEGMQFDRGY+S Y VTD  KM+A+L+NPYILITDKK+S+I++ILP+LE I+KT RPLLI+ADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +TDDLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE + S++D++ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A ++V     V  L L GDE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+ + + +     PAM
  S:     1 MAKDIKFSADARSSMVRGVDILANTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIEAAVATAVEALKSNSVPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELDNPYILITDKKISNIQEILPLLENILKTNRPLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITDDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGNPEAIANRVAVIKSQIESSTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAYINVLDA--VAGLELAGDEGTGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEVGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVAN-QPEPASPAPAM 531
>gi|182678711|ref|YP_001832857.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634594|gb|ACB95368.1| chaperonin GroEL [Beijerinckia indica subsp. indica ATCC 9039] (548 aa)
Score = 1380, Expect = 2.4e-150, Identities = 302/533 (56%), Positives = 411/533 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK+++FS  AR+++  GV+ L +AVKVT+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L +  EN+GAQLV++VASK  D AGDGTTTAT+LA  + KEG + V +G NP+++KRG+D  V AIV +L  +SKK+   DEI QV TISAN DK +G++I+ AM+KVG++GVITVEEAK +  EL VVEGMQFDRGY+SPYF+T+  KMIA+LE+PYIL+ +KK+SS++ +LP+LE +++TG+PL+IIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++LGI  + VTL  LG+A+ + IDK+ +TI+ G G +  I+ RIS+IK  I  T SDYD++ ++ RLAKL  GVAV++VG  +EVE+KEKKDRVDDAL+AT+AA+EEG+  GGG AL+   K + N+ T N   D+K G +IV  AI +P  QIV N+G D  VV+ ++L++     G+NA TG+Y DM + GIIDP KV R ALQ+A S++ +L+TTEA I +    KE  +P
  S:     3 AKDVRFSSDARDRMLRGVEILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELADKFENLGAQLVREVASKQNDAAGDGTTTATILAASIVKEGTKAVAAGLNPMDLKRGIDHAVEAIVADLKANSKKVTSNDEIAQVGTISANGDKSVGDMISTAMQKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILVHEKKLSSLQAMLPVLEAVVQTGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTLISEELGIKLENVTLAMLGRAKRIRIDKEATTIIDGAGNKDDIEGRISQIKAQIAETTSDYDREKMQERLAKLAGGVAVLRVGGSTEVEVKEKKDRVDDALNATRAAVEEGVSPGGGVALLRAIKALENLPTDN--SDQKAGIEIVRKAIQTPAKQIVDNSGGDGAVVVGKLLESNEYAFGYNAQTGEYGDMVKLGIIDPTKVVRTALQDAASIAGLLITTEATITEAP-KKEAPLP 533
>gi|21666293|gb|AAM73644.1|AF389515_2 GroEL [Streptococcus intermedius] (534 aa)
Score = 1380, Expect = 2.6e-150, Identities = 312/536 (58%), Positives = 407/536 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM 536
           MAK+IKFS  AR+ +  GV  L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EG++NV +GANPI I+RG++  V   V  L  +S  ++ K+ I QVA +S+ S+K +GE I+ AMEKVG+DGVIT+EE+KG++ EL VVEGMQFDRGY+S Y VTD  KM+A L+NPYILITDKK+S+I++ILP+LE I+KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     T++ LGQA  V +DKD++ IV+G G    I  R++ IK+ IE   S++DK+ L+ RLAKL+ GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEGIV GGG A V+V     V  L L  DE  G  IV+ A+  P+ QI  NAGF+  +VI+  LK +    GFNAATG++V+M + GIIDPVKVTR ALQNA SV+S++LTTEAV+   + +     PAM
  S:     1 MAKDIKFSADARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVATAVEALKANSVPVSNKEAIAQVAAVSSRSEK-VGEYISEAMEKVGNDGVITIEESKGMDTELDVVEGMQFDRGYLSQYMVTDNEKMVADLDNPYILITDKKISNIQEILPLLENILKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQASKVTVDKDSTVIVEGSGDAEAIANRVAVIKSQIESVTSEFDKEKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVSGGGTAFVNVLDA--VAALELEADEATGRNIVLRALEEPVRQIALNAGFEGSIVIDR-LKNSEVGTGFNAATGEWVNMIEAGIIDPVKVTRSALQNAASVASLILTTEAVVAS-QPEPASPAPAM 531
>gi|23451152|gb|AAN32681.1|AF417588_2 GroEL [Enterococcus raffinosus] (532 aa)
Score = 1379, Expect = 2.7e-150, Identities = 309/524 (58%), Positives = 412/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS+ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AK+++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  SK++  KD I QVA +S+ S++ +G+LIA AMEKVG+DGVIT+EE+KGI+ EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE++++  R LLI+ADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTG + +T+DLG+   + T+++LG A  VV+DKDN+TIV+G G ++ + +R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL++T+AA+EEGIV GGG ALV+V K+  V+ L+  GD   G +IV+ A+  P+ QI  NAGF+  V+I++ LK  +   GFNAA+G+YV+M   GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKDIKFSEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKDIELDDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPMGIRRGIELATKAAVEELHSISKEVDSKDAIAQVAAVSSGSEE-VGKLIAEAMEKVGNDGVITIEESKGIDTELDVVEGMQFDRGYLSQYMVTDNDKMEAALENPYILITDKKISNIQDILPLLEQVLQQSRSLLIVADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGATVITEDLGLDLKEATIENLGTAGKVVVDKDNTTIVEGAGDKAALTDRVEMIKRQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNSTRAAVEEGIVSGGGTALVNVIKK--VSDLDAEGDVATGIKIVVRALEEPVRQIAENAGFEGSVIIDK-LKNADRGTGFNAASGEYVNMIDAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|116873505|ref|YP_850286.1| chaperonin GroEL [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123461334|sp|A0AKH5|CH60_LISW6 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116742383|emb|CAK21507.1| groEL [Listeria welshimeri serovar 6b str. SLCC5334] (542 aa)
Score = 1379, Expect = 2.8e-150, Identities = 305/538 (56%), Positives = 411/538 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV QL +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ ++RG++K V   + EL   SK I  K+ I QVA IS+  D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE PYILITDKK+++I++ILP+LE++++ GRP+LIIA+DV+GEA  TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T+DLG+     T+  LG A  VV+ KD++TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV +  +  V  L   GD + G  IV+ ++  P+ QI  NAG + G VI E LK     +GFNAA G++V+M   GI+DP KVTR ALQNA SV+++LLTTEAV+ D  D  E+   A+P+
  S:     1 MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISS-GDEEVGKLIAEAMERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQISARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNK--VAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE-GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADQPD--ENGPAAVPD 532
>gi|118054048|ref|ZP_01522590.1| chaperonin GroEL [Comamonas testosteroni KF-1] >gi|117998842|gb|EAV13004.1| chaperonin GroEL [Comamonas testosteroni KF-1] (547 aa)
Score = 1379, Expect = 2.9e-150, Identities = 303/537 (56%), Positives = 408/537 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK++ F   AR ++  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L + ++NMGAQLVK+VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A+V EL K SK      EI QV +ISANSD+ +G +IA AM+KVG +GVITVEE K +++EL VVEGMQFDRGY+SPYF+ +  K  A L+NP++L+ DKK+S+I+D+LP LE + K GRPLLIIA+DV+GEAL TLVVN +RG+  VVAVKAP FGD+RK +LEDIAILTGG  + +++G+S DKVTL+DLGQA+ V I K+N+TI+ G G  ++I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+   + +  + T N   ++  G ++V+ AI +P+ +IV+NAG +  VV+N +L   N + GFNAA   Y DM + GI+DP KVTR ALQNA SV+S+LLTTE +I +    K +  PAMP+
  S:     3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGIDKAVAALVEELKKQSKATTTSKEIAQVGSISANSDESVGSIIAEAMDKVGKEGVITVEEGKSLDNELDVVEGMQFDRGYLSPYFINNPEKQAAVLDNPFVLLFDKKISNIRDLLPTLEAVAKAGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKVIAEEVGLSLDKVTLEDLGQAQRVEIGKENTTIIDGAGQAAEIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALLRAKQAVGALATGN--AEQDAGIKLVLKAIEAPLREIVANAGGEPSVVVNAVLNG-NGNYGFNAANDSYGDMLEMGILDPTKVTRTALQNAASVASLLLTTECMIAEAP--KAEGAPAMPD 535
>gi|56962656|ref|YP_174382.1| chaperonin GroEL [Bacillus clausii KSM-K16] >gi|59797661|sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|56908894|dbj|BAD63421.1| chaperonin GroEL [Bacillus clausii KSM-K16] (545 aa)
Score = 1379, Expect = 3.1e-150, Identities = 302/524 (57%), Positives = 411/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+I+FS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV SGANP+ I++G++K   A V EL   SK I  ++ I QVA IS+ +D+++G++IA AME+VG+DGVIT+EE+KG + EL VVEGMQFDRGY SPY V+D++KM A L+NPY+LITDKK+++I+++LP+LE++++  RP+LIIA+DV+GEAL TLV+NK+RG FN VAVKAP FGD+RK +LEDIAILTGG  +T+DLG+     T++ LG+A  VV+ K+N+TIV+G G   QI  R++++K  +E T S++DK+ L+ RLAKL  GVAV+KVGA +E E+KE+K R++DAL++T+AA+EEGIV GGG ALV+V K   V  ++  GDE  G  IV+ A+  P+ QI  NAG + G +I E LKA    +G+NAATG+YV+M +TGI+DPVKVTR ALQNA SVS+M LTTEAVI D
  S:     1 MAKDIQFSEEARRSMLKGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVTSGANPMGIRKGIEKATAAAVKELKAISKPIEGRESIAQVAAISS-ADEEVGQIIAEAMERVGNDGVITIEESKGFSTELEVVEGMQFDRGYASPYMVSDSDKMEAVLDNPYVLITDKKITNIQEVLPVLEQVVQQSRPVLIIAEDVEGEALATLVLNKLRGTFNAVAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLDLKSATIESLGRAAKVVVTKENTTIVEGAGDPEQISGRVNQLKAQVEETTSEFDKEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVIKA--VKAVDATGDEATGVNIVLRALEEPVRQIAHNAGLE-GSIIVEKLKAEEVGVGYNAATGEYVNMVETGILDPVKVTRSALQNAASVSAMFLTTEAVIAD 520
>gi|16804107|ref|NP_465592.1| chaperonin GroEL [Listeria monocytogenes EGD-e] >gi|46908303|ref|YP_014692.1| chaperonin GroEL [Listeria monocytogenes str. 4b F2365] >gi|47094067|ref|ZP_00231795.1| chaperone protein GroEL [Listeria monocytogenes str. 4b H7858] >gi|153167926|ref|ZP_01927996.1| chaperone protein GroEL [Listeria monocytogenes FSL N1-017] >gi|153183547|ref|ZP_01934407.1| chaperone protein GroEL [Listeria monocytogenes J0161] >gi|153191590|ref|ZP_01938780.1| chaperone protein GroEL [Listeria monocytogenes J2818] >gi|153196575|ref|ZP_01940945.1| chaperone protein GroEL [Listeria monocytogenes 10403S] >gi|153203126|ref|ZP_01944494.1| chaperone protein GroEL [Listeria monocytogenes HPB2262] >gi|167015203|ref|ZP_02277736.1| chaperonin GroEL [Listeria monocytogenes FSL J1-194] >gi|20137919|sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59797784|sp|Q71XU6|CH60_LISMF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|13507272|gb|AAK28538.1|AF335323_2 GroEL [Listeria monocytogenes] >gi|16411538|emb|CAD00146.1| class I heat-shock protein (chaperonin) GroEL [Listeria monocytogenes] >gi|46881574|gb|AAT04869.1| chaperone protein GroEL [Listeria monocytogenes str. 4b F2365] >gi|47017567|gb|EAL08372.1| chaperone protein GroEL [Listeria monocytogenes str. 4b H7858] >gi|126943838|gb|EBA21555.1| chaperone protein GroEL [Listeria monocytogenes J0161] >gi|127634036|gb|EBA23428.1| chaperone protein GroEL [Listeria monocytogenes 10403S] >gi|127765024|gb|EBA25376.1| chaperone protein GroEL [Listeria monocytogenes J2818] >gi|133726635|gb|EBA28333.1| chaperone protein GroEL [Listeria monocytogenes FSL N1-017] >gi|133734810|gb|EBA36508.1| chaperone protein GroEL [Listeria monocytogenes HPB2262] (542 aa)
Score = 1379, Expect = 3.1e-150, Identities = 305/538 (56%), Positives = 411/538 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV QL +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ ++RG++K V   + EL   SK I  K+ I QVA IS+  D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE PYILITDKK+++I++ILP+LE++++ GRP+LIIA+DV+GEA  TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG  +T+DLG+     T+  LG A  VV+ KD++TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV +  +  V  L   GD + G  IV+ ++  P+ QI  NAG + G VI E LK     +GFNAA G++V+M   GI+DP KVTR ALQNA SV+++LLTTEAV+ D  D  E+   A+P+
  S:     1 MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISS-GDEEVGKLIAEAMERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQISARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNK--VAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE-GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADKPD--ENGPAAVPD 532
>gi|15618058|ref|NP_224342.1| chaperonin GroEL [Chlamydophila pneumoniae CWL029] >gi|15835669|ref|NP_300193.1| chaperonin GroEL [Chlamydophila pneumoniae J138] >gi|16752909|ref|NP_445180.1| chaperonin GroEL [Chlamydophila pneumoniae AR39] >gi|33241470|ref|NP_876411.1| chaperonin GroEL [Chlamydophila pneumoniae TW-183] >gi|6226568|sp|P31681|CH60_CHLPN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|4376399|gb|AAD18287.1| Heat Shock Protein-60 [Chlamydophila pneumoniae CWL029] >gi|7189552|gb|AAF38453.1| 60 kDa chaperonin [Chlamydophila pneumoniae AR39] >gi|8978507|dbj|BAA98344.1| heat shock protein-60 [Chlamydophila pneumoniae J138] >gi|33235978|gb|AAP98068.1| GroEL [Chlamydophila pneumoniae TW-183] (544 aa)
Score = 1379, Expect = 3.1e-150, Identities = 299/540 (55%), Positives = 403/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK IK+++ AR K+  GV+ L +AVKVT+GP+GR+V+I KS+G+P +TKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRG+DK V  +V+EL K SK +    EI QVATISAN+D +IG LIA AMEKVG +G ITVEEAKG    L VVEGM F+RGY+S YF T+       LE+  ILI DKK+S IKD LP+L+++ ++GRPLLIIA++++GEAL TLVVN++R  F V AVKAP FGD+RK +LEDIAILTGG  V+++LG+  +  TL  LG+A+ V++ K+++TIV+G G +  I+ R   IK  IE + SDYDK+ L+ RLAKL+ GVAVI+VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG ALV     +      L   DE IG +I++ A+ +P+ QI SNAG +  ++  ++L A + + G++A    Y DM   GI+DP KVTR AL++A S++ +LLTTEA+I D+ ++K  S PAMP+ GM
  S:     3 AKNIKYNEEARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDELKKISKPVQHHKEIAQVATISANNDSEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFSTNPETQECVLEDALILIYDKKISGIKDFLPVLQQVAESGRPLLIIAEEIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAILTGGQLVSEELGMKLENTTLAMLGKAKKVIVTKEDTTIVEGLGNKPDIQARCDNIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATIAAVEEGILPGGGTALVRCIPTLEAFLPMLANEDEAIGTRIILKALTAPLKQIASNAGKEGAIICQQVL-ARSANEGYDALRDAYTDMIDAGILDPTKVTRSALESAASIAGLLLTTEALIADIPEEKSSSAPAMPSAGM 542
>gi|18028155|gb|AAL56002.1|AF325452_1 GroEL [Staphylococcus aureus] (525 aa)
Score = 1379, Expect = 3.3e-150, Identities = 296/527 (56%), Positives = 410/527 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + +
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEAGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPE 523
>gi|83582568|dbj|BAE54309.1| HSP60 [Lawsonia intracellularis] (548 aa)
Score = 1379, Expect = 3.4e-150, Identities = 306/529 (57%), Positives = 400/529 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           +KEI F   AR KL  GV +L +AVKVT+GP+GRNV+I+KS+G+PVITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG++ V +G NP+ IKRG+DK V A+  EL+  +K    + EI QV TISANSD  IG +IA AM KVG +GVITVEEAKG+   L VVEGM+FDRGY+SPYFVT+  KM+ +L+NPYIL  +KK++S+KD+LPILE++ K  RPLLIIA+DV+GEAL TLVVNK+RG   VVAVKAP FG++RK +LEDIAILTGG  + +D GI  + V+L  LG A+ VVIDK+N+TIV G G    IK R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKKDRV+DAL+AT+AA+EEGIV GGG A V   K ++ +      DE  G  I+  ++  P+ QI +NAG++  +V+ ++ +A +   GFNAA+G+Y D+ + G+IDP KVTRIALQNA SV+S+LLTTE  I +  + K+
  S:     3 SKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGIDKAVVAVTKELSDITKPTRDQKEIAQVGTISANSDTTIGNIIAEAMAKVGKEGVITVEEAKGLETTLDVVEGMKFDRGYLSPYFVTNPEKMVCELDNPYILCNEKKITSMKDMLPILEQVAKVNRPLLIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGERRKAMLEDIAILTGGGAIFEDRGIKLENVSLSSLGTAKRVVIDKENTTIVDGAGKSEDIKARVKQIRAQIEETSSDYDREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTAFVRSIKVLD-DIKPADDDELAGLNIIRRSLEEPLRQIAANAGYEGSIVVEKVREAKD-GFGFNAASGEYEDLIKAGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKK 529
>gi|125975373|ref|YP_001039283.1| chaperonin GroEL [Clostridium thermocellum ATCC 27405] >gi|196252981|ref|ZP_03151626.1| chaperonin GroEL [Clostridium thermocellum DSM 4150] >gi|1345758|sp|P48212|CH60_CLOTH 60 kDa chaperonin (Protein Cpn60) (groEL protein) (HSP-60) >gi|1103644|emb|CAA92242.1| groEL [Clostridium thermocellum] >gi|125715598|gb|ABN54090.1| chaperonin GroEL [Clostridium thermocellum ATCC 27405] >gi|196197617|gb|EDX92469.1| chaperonin GroEL [Clostridium thermocellum DSM 4150] (541 aa)
Score = 1378, Expect = 3.4e-150, Identities = 307/529 (58%), Positives = 410/529 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK+IKF + AR  L  GV QL D VKVT+GP+GRNV++ K +G+P+IT DGV++AKE++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANP+ +K+G+ K V+A V  + + S+K+  K++I +VA+ISAN D+ IGELIA+AMEKV +DGVITVEEAK +   L +VEGMQFDRGY+SPY VTDT KM A L+ PYILITDKK+S+I+DILP+LE+I++ G+ L+IIA+DV+GEAL TL+VNK+RG F  VAVKAP FGD+RK +LEDIAILTGG  +T DLG+     T++ LG+A  V + K+N+ IV G G   +I++RI+ IK+ IE T SD+D++ L+ RLAKL  GVAVI+VGA +E E+KEKK R++DAL+ATKAA+EEGIV GGG ALV+V  ++      + GDEK G QI++ A+  P+ QI  NAG + G VI E +KA+ P +GF+A   KYV+M + GI+DP KVTR ALQNA SV+SM+LTTE+V+ D+ + +
  S:     1 MAKQIKFGEEARRALERGVNQLADTVKVTLGPKGRNVVLDKKFGSPMITNDGVTIAKEIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVAAGANPMLLKKGIAKAVDAAVEGIKEISQKVKGKEDIARVASISAN-DEVIGELIADAMEKVTNDGVITVEEAKTMGTNLEIVEGMQFDRGYVSPYMVTDTEKMEAVLDEPYILITDKKISNIQDILPLLEQIVQQGKKLVIIAEDVEGEALATLLVNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGQVITSDLGLELKDTTVEQLGRARQVKVQKENTIIVDGAGDPKEIQKRIASIKSQIEETTSDFDREKLQERLAKLAGGVAVIQVGAATETEMKEKKLRIEDALAATKAAVEEGIVAGGGTALVNVIPKVAKVLDTVSGDEKTGVQIILRALEEPVRQIAENAGLE-GSVIVEKVKASEPGIGFDAYNEKYVNMIEAGIVDPAKVTRSALQNAASVASMVLTTESVVADIPEKE 527
>gi|168266422|ref|ZP_02688387.1| chaperonin GroEL [Listeria monocytogenes FSL J2-071] (544 aa)
Score = 1378, Expect = 3.7e-150, Identities = 304/538 (56%), Positives = 411/538 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV QL +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ ++RG++K V   + EL   SK I  K+ I QVA IS+  D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE PYILITDKK+++I++ILP+LE++++ GRP+LIIA+DV+GEA  TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG  +T+DLG+     T+  LG A  VV+ KD++TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV +  +  V  L   GD + G  IV+ ++  P+ QI  NAG + G VI E LK     +GFNAA G++V+M   GI+DP KVTR ALQNA SV+++LLTTEAV+ D  D  E+   A+P+
  S:     1 MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISS-GDEEVGKLIAEAMERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNIQEILPVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQISARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNK--VAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE-GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADKPD--ENGPAAVPD 532
>gi|146283472|ref|YP_001173625.1| chaperonin GroEL [Pseudomonas stutzeri A1501] >gi|166201743|sp|A4VP82|CH60_PSEU5 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|145571677|gb|ABP80783.1| GroEL protein [Pseudomonas stutzeri A1501] (546 aa)
Score = 1378, Expect = 3.8e-150, Identities = 303/537 (56%), Positives = 411/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKE+KF DSAR K+  GV  L DAVK T+GP+GRNV+++KS+GAP ITKDGVSVAKE++L +  ENMGAQLVKDVASK  DEAGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL + +K       I QV TISANSD+ IG++IA AME+VG +GVITVEE  G  +EL+VVEGMQFDRGY+SPYF+   + M+A+L+NP +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILTGG+ +++++G+S +  TL+ LG A+ VV++K+N+TI+ G G ++ I+ R+++I+  IE T SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I+     L G   D+ +G  ++  A+ +P+ QIV+NAG +  VV++++ K  + + GFNAA+  Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ +V +DK    PAMP+
  S:     3 AKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELKDRFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKQLAKPCTDSKAIAQVGTISANSDESIGQIIAEAMERVGKEGVITVEEGSGFENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEGVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISEEVGLSLETATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEDTTSDYDKEKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALQAIS----ELKGDNEDQNVGIALLRRAVEAPLRQIVANAGGEPSVVVDKV-KQGSGNYGFNAASDTYGDMIEMGILDPAKVTRSALQAAASIGGLMVTTEAMVAEVVEDK--PAPAMPD 535
>gi|94987067|ref|YP_595000.1| chaperonin GroEL [Lawsonia intracellularis PHE/MN1-00] >gi|118597116|sp|Q1MQP8|CH60_LAWIP 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|94731316|emb|CAJ54679.1| GroEL/HSP60 homolog [Lawsonia intracellularis PHE/MN1-00] (548 aa)
Score = 1378, Expect = 3.8e-150, Identities = 306/529 (57%), Positives = 400/529 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           +KEI F   AR KL  GV +L +AVKVT+GP+GRNV+I+KS+G+PVITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  +++EG++ V +G NP+ IKRG+DK V A+  EL+  +K    + EI QV TISANSD  IG +IA AM KVG +GVITVEEAKG+   L VVEGM+FDRGY+SPYFVT+  KM+ +L+NPYIL  +KK++S+KD+LPILE++ K  RPLLIIA+DV+GEAL TLVVNK+RG   VVAVKAP FG++RK +LEDIAILTGG  + +D GI  + V+L  LG A+ VVIDK+N+TIV G G    IK R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKKDRV+DAL+AT+AA+EEGIV GGG A V   K ++ +      DE  G  I+  ++  P+ QI +NAG++  +V+ ++ +A +   GFNAA+G+Y D+ + G+IDP KVTRIALQNA SV+S+LLTTE  I +  + K+
  S:     3 SKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGIDKAVVAVTKELSDITKPTRDQKEIAQVGTISANSDTTIGNIIAEAMAKVGKEGVITVEEAKGLETTLDVVEGMKFDRGYLSPYFVTNPEKMVCELDNPYILCNEKKITSMKDMLPILEQVAKVNRPLLIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGERRKAMLEDIAILTGGEAIFEDRGIKLENVSLSSLGTAKRVVIDKENTTIVDGAGKSEDIKARVKQIRAQIEETSSDYDREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTAFVRSIKVLD-DIKPADDDELAGLNIIRRSLEEPLRQIAANAGYEGSIVVEKVREAKD-GFGFNAASGEYEDLIKAGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKK 529
>gi|163787652|ref|ZP_02182099.1| hypothetical protein FBALC1_03897 [Flavobacteriales bacterium ALC-1] >gi|159877540|gb|EDP71597.1| hypothetical protein FBALC1_03897 [Flavobacteriales bacterium ALC-1] (543 aa)
Score = 1378, Expect = 3.9e-150, Identities = 326/528 (61%), Positives = 409/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEII-QVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKF   AR+ L  GV  L +AVKVT+GP+GRNV+I KS+GAP +TKDGVSVAKE++L N +ENMGAQ+VK+VASKT D AGDGTTTATVLA  + KEGL+NV +GANP+++KRG+DK V +IV +L+K S+K+    E I QVA+ISAN+D  IG+LIA A  KVG +GVITVEEAKG +  + VVEGMQFDRGY+SPYFVTD +KMIA LENPYIL+ DKK+S++++ILPILE + ++GRPLLIIA+DV+G+AL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG  ++++ G S +   L  LG AE+V IDKDN+TIV G G  + IK R+S+IK  IE T SDYDK+ L+ RLAKL  GVAV+ VGA SEVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV   K +  + T NL  DE  G QIV  AI SP+  IV NAG +  VVIN++L+      G++A +  YVDM + GIIDP KVTRIAL+NA SV+ M+LTTE  + D+K++
  S:     1 MAKDIKFDIEARDGLKRGVDALANAVKVTLGPKGRNVIIGKSFGAPQVTKDGVSVAKEIELENELENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVKEGLKNVAAGANPMDLKRGIDKAVESIVTDLDKQSQKVGNSSEKIKQVASISANNDDTIGDLIAVAFGKVGKEGVITVEEAKGTDTYVDVVEGMQFDRGYLSPYFVTDADKMIADLENPYILLFDKKISNLQEILPILEPVAQSGRPLLIIAEDVEGQALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGVVISEERGFSLENADLTMLGTAETVTIDKDNTTIVNGNGKAADIKARVSQIKAQIETTTSDYDKEKLQERLAKLAGGVAVLYVGAASEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAKKTLEKITTDNL--DETTGVQIVNKAIESPLRTIVENAGGEGSVVINKVLEGKK-DFGYDAKSETYVDMLKAGIIDPKKVTRIALENAASVAGMILTTECALVDIKEE 527
>gi|18028153|gb|AAL56001.1|AF325451_2 GroEL [Staphylococcus aureus] (525 aa)
Score = 1378, Expect = 4.0e-150, Identities = 296/526 (56%), Positives = 410/526 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVK 526
           M K++KFS+ AR  +  GV QL +AVKVT+GP+GRNV++ K + AP+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   V  L+++S+K+  K+EI QV  ISA +D++IG  I+ AMEKVG+DGVIT+EE+ G+N EL VVEGMQFDRGY SPY VTD++KM+A+LE PYIL+TDKK+SS +DILP+LE+++++ RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     ++  LG A  V + KDN+T+V G G E+ I  R+S++K+ IE T+SD+D++ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G VI E LK   P +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  ++
  S:     1 MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAISA-ADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDREKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNVYQK--VSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLE-GSVIVERLKNAEPGVGFNAATNEWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIQ 522
>gi|163797980|ref|ZP_02191922.1| putative dimethyl sulfoniopropionate demethylase [alpha proteobacterium BAL199] >gi|159176774|gb|EDP61345.1| putative dimethyl sulfoniopropionate demethylase [alpha proteobacterium BAL199] (539 aa)
Score = 1377, Expect = 4.6e-150, Identities = 290/532 (54%), Positives = 414/532 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSV 533
           AK++KFS  AR+++ +G+  L +AVKVT+GP+GRNV++ KSYGAP ITKDGV+VAKE++L++  ENMGAQ+VK+VAS+++D AGDGTTTATVLA+ + +EG + V +G NP+++KRG+D  V A+V ++ + +KK++   EI QV TISAN D++IGE+IA AM KVG++GVIT+EE+K +  EL +V+GMQF+RGY+SPYFVT+  KMI +L+ PYIL+ DKK+  ++ +LP+LE ++K+GRPLLI+A+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLG  F+ VTL  LG A+ V I+KDN+T++ G G +  I+ R ++I+  IE T SDYDK+ L+ R+AKL  GVA+I+VG  +EVELKE+KDRVDDA+ AT+AA+EEGIV GGG  L++ SK++ ++ + N   D+K G  IV  A+ +P  QI  NAG D  +++ ++L+ ++ + GF+A +G YVDM + GIIDP KV R+ALQ A S++ +L+TTEA++ + K DK D++
  S:     3 AKDVKFSTDARDRMLHGIDILANAVKVTLGPKGRNVILAKSYGAPRITKDGVTVAKEIELSDKFENMGAQMVKEVASRSSDMAGDGTTTATVLAHAIVREGAKAVAAGLNPMDLKRGIDMAVEAVVADIQRVAKKVSTNAEIAQVGTISANDDREIGEMIAKAMAKVGNEGVITIEESKSLQTELDIVDGMQFERGYLSPYFVTNAEKMICELDEPYILLHDKKLPGVQALLPLLEAVVKSGRPLLIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGTKFESVTLDMLGTAKKVRIEKDNTTVIDGGGKKKAIEARCTQIRAQIEETTSDYDKEKLQERVAKLAGGVAIIRVGGATEVELKERKDRVDDAVHATRAAVEEGIVAGGGVTLLYASKQLGSLKSEN--DDQKAGINIVRRALQAPARQIFVNAGADGSIIVGKLLEQSDANHGFDAQSGSYVDMVKAGIIDPAKVVRLALQGAASIAGLLITTEAMVAE-KVDKTDTM 532
>gi|21666300|gb|AAM73648.1|AF389517_2 GroEL [Streptococcus salivarius] (535 aa)
Score = 1377, Expect = 4.7e-150, Identities = 302/522 (57%), Positives = 404/522 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           MAK+IKFS  AR  +  GV  L D VKVT+GP+GRNV+++K++G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANPI I+RG++  V   V EL   ++ +A K+ I QVA +S+ S+K +GE I+ AME+VG+DGVIT+EE++G+  EL VVEGMQFDRGY+S Y VTD  KM+A LENP+IL+TDKK+S+I+D+LP+LEE++KT RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTG + +T+DLG+     T+  LGQA  V +DKD++ IV+G G    I  R++ IK+ +E T S++D++ L+ RLAKL+ GVAV+KVGA +E  LKE K R++DAL+AT+AA+EEGIV GGG ALV+V  +  V  L+L GD+  G  IV+ A+  P+ QI  NAG++  V+I++ LK +    GFNAA G++VDM + GIIDPVKVTR ALQNA SV+S++LTTEAV+
  S:     1 MAKDIKFSSDARAAMVRGVDTLADTVKVTLGPKGRNVVLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIEAAVATAVEELKAIAQPVANKEAIAQVAAVSSRSEK-VGEYISEAMERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILVTDKKISNIQDVLPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGATVITEDLGLELKDATMAALGQASKVTVDKDSTVIVEGAGSTEAIANRVNLIKSQLETTTSEFDREKLQERLAKLSGGVAVVKVGAATETALKEMKLRIEDALNATRAAVEEGIVAGGGTALVNVIAK--VAELDLEGDDATGRNIVLRALEEPVRQIAYNAGYEGSVIIDK-LKNSPVGTGFNAANGEWVDMVEAGIIDPVKVTRSALQNAASVASLILTTEAVV 518
>gi|144502|gb|AAA23126.1| putative GroEL protein [Chlamydophila pneumoniae] (544 aa)
Score = 1377, Expect = 4.9e-150, Identities = 299/540 (55%), Positives = 403/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK IK+++ AR K+  GV+ L +AVKVT+GP+GR+V+I KS+G+P +TKDGV+VAKE++L +  ENMGAQ+VK+VASKTAD+AGDGTTTATVLA  ++ EGLRNV +GANP+++KRG+DK V  +V+EL K SK +    EI QVATISAN+D +IG LIA AMEKVG +G ITVEEAKG    L VVEGM F+RGY+S YF T+       LE+  ILI DKK+S IKD LP+L+++ ++GRPLLIIA++++GEAL TLVVN++R  F V AVKAP FGD+RK +LEDIAILTGG  V+++LG+  +  TL  LG+A+ V++ K+++TIV+G G +  I+ R   IK  IE + SDYDK+ L+ RLAKL+ GVAVI+VGA +E+E+KEKKDRVDDA  AT AA+EEGI+ GGG ALV     +      L   DE IG +I++ A+ +P+ QI SNAG +  ++  ++L A + + G++A    Y DM   GI+DP KVTR AL++A S++ +LLTTEA+I D+ ++K  S PAMP+ GM
  S:     3 AKNIKYNEEARKKIHKGVKTLAEAVKVTLGPKGRHVVIDKSFGSPQVTKDGVTVAKEIELEDKHENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVTAGANPMDLKRGIDKAVKVVVDELKKISKPVQHHKEIAQVATISANNDSEIGNLIAEAMEKVGKNGSITVEEAKGFETVLDVVEGMNFNRGYLSSYFSTNPETQECVLEDALILIYDKKISGIKDFLPVLQQVAESGRPLLIIAEEIEGEALATLVVNRLRAGFRVCAVKAPGFGDRRKAMLEDIAILTGGQLVSEELGMKLENTTLAMLGKAKKVIVTKEDTTIVEGLGNKPDIQARCDNIKKQIEDSTSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKEKKDRVDDAQHATIAAVEEGILPGGGTALVRCIPTLEAFLPMLANEDEAIGTRIILKALTAPLKQIASNAGKEGAIICQQVL-ARSANEGYDALRDAYTDMIDAGILDPTKVTRSALESARSIAGLLLTTEALIADIPEEKSSSAPAMPSAGM 542
>gi|78221257|ref|YP_383004.1| chaperonin GroEL [Geobacter metallireducens GS-15] >gi|119366243|sp|Q39ZP5|CH60_GEOMG 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78192512|gb|ABB30279.1| chaperonin GroEL [Geobacter metallireducens GS-15] (546 aa)
Score = 1377, Expect = 5.1e-150, Identities = 305/524 (58%), Positives = 391/524 (74%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK IKF    RN +  GV  L DAVKVT+GP+GRNV+I+KS+G+P+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+D  V  IV EL K SK I    EI QV TISAN+DK IG +IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A LEN  ILI DKK+S++KD+LPILE+  K+GRPLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIA+LTGG  ++++LG   +  T   LG A+ V IDKDN+TI+ G G E+ I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +E E+KEKK RV+DAL AT+AA++EGIV GGG A  ++     +  ++L  +++ G  ++  A+  PI QI  NAG D  +V++++ K      GFNAA  +YVDM   GIIDP KV+R ALQNA SV+ ++LTTEA+I D
  S:     1 MAKIIKFDQEGRNAILKGVNTLADAVKVTLGPKGRNVIIEKSFGSPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGIDSAVETIVAELQKISKPIKDHKEIAQVGTISANNDKTIGGIIAEAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEASLENANILIHDKKISNMKDLLPILEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAVLTGGKVISEELGFKLENATFDMLGTAKRVTIDKDNTTIIDGDGSEADIQGRVKQIRAQIEETSSDYDREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVA--YIRSLGALEGISLPAEQQFGVTLIKRALEEPIRQIAQNAGVDGSIVVDKV-KNGKDAFGFNAADDEYVDMIAAGIIDPTKVSRSALQNAASVAGLMLTTEAMIAD 521
>gi|145633505|ref|ZP_01789234.1| chaperonin GroEL [Haemophilus influenzae 3655] >gi|144985874|gb|EDJ92482.1| chaperonin GroEL [Haemophilus influenzae 3655] (548 aa)
Score = 1376, Expect = 6.2e-150, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ +VI+KDN+TI+ G G ESQIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  N      ++ +G ++ + A+ +P+ QIV+N+G +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRIVINKDNTTIIDGVGDESQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAANLKGDNEEQNVGIKLALRAMEAPLRQIVTNSGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|16264754|ref|NP_437546.1| chaperonin GroEL [Sinorhizobium meliloti 1021] >gi|17380427|sp|P35471|CH605_RHIME 60 kDa chaperonin 5 (Protein Cpn60 5) (groEL protein 5) >gi|15140892|emb|CAC49406.1| putative heat shock protein groEL [Sinorhizobium meliloti 1021] (542 aa)
Score = 1376, Expect = 6.2e-150, Identities = 298/539 (55%), Positives = 412/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AKE+KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VAS+T D AGDGTTTATVLA  + +EG + V SG NP+++KRG+D  V+A+V EL  +++KI++  EI QV TISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+ +KM  +LE+PYILI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ V++DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++ I+ R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ + T N   D+++G  +V  AI +P+ QI  NAG +  +++ ++ + T    G+NA T +Y D++  G+IDP KV R ALQ+A SV+ +L+TTEA+I   +  K+++ PA+P  G
  S:     3 AKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGIDLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDGLKTAN--NDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWNAQTNEYGDLYAMGVIDPAKVVRTALQDAASVAGLLVTTEAMI--AEKPKKEAAPALPAGG 538
>gi|83591926|ref|YP_425678.1| chaperonin GroEL [Rhodospirillum rubrum ATCC 11170] >gi|119366211|sp|Q2RWV4|CH602_RHORT 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|83574840|gb|ABC21391.1| Chaperonin Cpn60/TCP-1 [Rhodospirillum rubrum ATCC 11170] (548 aa)
Score = 1376, Expect = 6.2e-150, Identities = 298/534 (55%), Positives = 410/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AK++KFS  AR++L  GV  L +AVKVT+GP+GRNV++ KSYGAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASK+AD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+D  V A+V ++ K SKKI    E+ QV TISAN D+++G++IA AMEKVG++GVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT+  KM+A LENPYIL+ +KK+S ++ +LP+LE ++++ RPLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + VT+  LG A+ V I K+ +T+V G G +  I+ R S+I+  IE T SDYD++ L+ RLAKL  GVAVIKVG  +E E+KEKKDRVDDA+ AT+AA+EEG+V GGG AL+H  + ++ +      D+ +G +IV  A+ +P+ QI  NAG D  VV  ++L+ ++   G+NA TG Y ++   G+IDP KV R ALQ A S++ +L+TTEA++ ++  +K+D++P+
  S:     3 AKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEIELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGIDLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEAKGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENPYILLHEKKLSGLQALLPVLEAVVQSSRPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLENVTIDMLGTAKKVTITKEETTLVDGAGDKKDIEARCSQIRANIEDTSSDYDREKLQERLAKLAGGVAVIKVGGATETEVKEKKDRVDDAMHATRAAVEEGVVAGGGVALLHAIRSLD-SVKGANPDQNVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLENSDTDFGYNAQTGIYENLVTAGVIDPTKVVRAALQGAASIAGLLITTEAMVAEIP-EKKDAMPS 534
>gi|115376544|ref|ZP_01463777.1| chaperonin GroL [Stigmatella aurantiaca DW4/3-1] >gi|115366477|gb|EAU65479.1| chaperonin GroL [Stigmatella aurantiaca DW4/3-1] (547 aa)
Score = 1376, Expect = 6.5e-150, Identities = 297/521 (57%), Positives = 397/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEI F  SAR  +  GV+ L DAV VT+GP+GRNV+I+KS+G+P +TKDGV+VAKE+DL N  ENMGAQ+VK+VASKT+D+AGDGTTTATVLA  +++EGL+ V +G +P+++KRG+DK V  +V EL K SK    K  I QV TISAN D+ IG +IA+AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY+SPYFVT+  +M   L++PYILI++KKVSS++D++P+LE++ ++G+PLLIIA++V+GEAL TLVVNK+RGV NV AVKAP FGD+RK++L+DIA LTGG  V+++LG  ++ ++L DLG+A+ + +DKDN+T+V G G + +I+ RI  I+  +E T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +    L L G+   G +I+  A+  P+ +I SNAG +  VVIN++   T    GFNA T  Y D+ + G+IDP KV R ALQNA SV+S+LLTTEA++
  S:     3 AKEIFFHQSAREAILRGVRILSDAVAVTLGPKGRNVVIEKSFGSPTVTKDGVTVAKEIDLENKFENMGAQMVKEVASKTSDKAGDGTTTATVLARAIYEEGLKLVAAGHSPMDLKRGIDKAVEVVVAELKKLSKSTTDKKAIAQVGTISANGDETIGHIIADAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYVSPYFVTNRERMEVVLDDPYILISEKKVSSMQDMIPLLEQVARSGKPLLIIAEEVEGEALATLVVNKIRGVLNVCAVKAPGFGDRRKELLKDIATLTGGMVVSEELGHKYETLSLSDLGRAKRITVDKDNTTLVDGAGKKGEIEGRIKLIRAQMETTTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRCLPAL--EKLKLGGELDFGVEIIKKALTEPLRKISSNAGLEGAVVINKVKDGTGA-FGFNARTEVYEDLEKAGVIDPTKVERTALQNAASVASLLLTTEAMV 520
>gi|67156122|ref|ZP_00417748.1| Chaperonin Cpn60/TCP-1 [Azotobacter vinelandii AvOP] >gi|67086452|gb|EAM05921.1| Chaperonin Cpn60/TCP-1 [Azotobacter vinelandii AvOP] (546 aa)
Score = 1376, Expect = 6.7e-150, Identities = 302/537 (56%), Positives = 410/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKE+KF DSAR K+  GV  L DAVK T+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQLVKDVASK  DEAGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL   +K  +    I QV TISANSD+ IG +IA AM KVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+L+NP +L+ DKK+S+I+++LP+LE + K+GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILTG + +++++G+S +  TL+ LG A+ VV++K+N+TI+ G G ++ I+ R+++I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I      L G   D+ +G  ++  A+ +P+ QIV+NAG +  VV++++ K  + + GFNAA+G Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ D+ +DK  + PAMP+
  S:     3 AKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELKDKFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKSLAKPCSDSKAIAQVGTISANSDESIGNIIAEAMNKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEAVAKSGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGATVISEEVGLSLESATLEHLGNAKRVVLNKENTTIIDGAGAQADIEARVAQIRKQIEETSSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALQAIE----GLKGDNEDQNVGIALLRRAVEAPLRQIVANAGDEPSVVVDKV-KQGSGNFGFNAASGVYGDMIEMGILDPAKVTRSALQAASSIGGLMITTEAMVADIVEDK--AAPAMPD 535
>gi|83596013|gb|ABC25372.1| chaperonin (groEL) [uncultured marine bacterium Ant29B7] (542 aa)
Score = 1376, Expect = 6.8e-150, Identities = 317/544 (58%), Positives = 409/544 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIAR-KDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           AKEI F  +ARN L  GV  L +AVKVT+GP+GRNV+I+KS+G+PV+TKDGV+VA+E+ L N +EN+GAQ++K+VASKTAD AGDGTTTATVLA  + K G +NV++GANP+++KRG+DK V  +V  L K S ++    D+I QVAT+SAN+D  IG+LIA AM+KV  +GVITVEE+KG    + VVEGMQFDRGY+SPYF T+T KM+A LENPYILI DKK+S++K++LP+LE + ++GRP LIIA+DVDGEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  TL  LG AE V +DKDN+T+V G G +  I  R+ +IK  IE T SDYD++ L+ RLAKL  GVAV+ VGA SEVELKEKKDRVDDALSATKAAIEEGIV GGG ALV   + ++        DE  G  I+  AI  P+ QIV NAG +  V+++++ +    + GFNA T  Y +M + GIIDP KVTR+AL+NA SV+S+LLTTEA I ++    E ++PA P+  MGGMM
  S:     3 AKEITFDVAARNGLRAGVDALANAVKVTLGPKGRNVIIEKSFGSPVVTKDGVTVAREITLENKLENLGAQMLKEVASKTADVAGDGTTTATVLAQAIIKHGHKNVMAGANPMDLKRGIDKAVAVVVKALAKMSIEVGESNDKIEQVATVSANNDPSIGKLIAEAMDKVKKEGVITVEESKGTETYVDVVEGMQFDRGYLSPYFTTNTEKMVADLENPYILIYDKKISTMKELLPVLEPVAQSGRPFLIIAEDVDGEALGTLVVNKIRGSLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEERGFKLENATLDMLGTAEKVTLDKDNTTVVNGAGNKDDISGRVGQIKAQIETTTSDYDREKLQERLAKLAGGVAVLYVGAASEVELKEKKDRVDDALSATKAAIEEGIVPGGGVALVRAIESLS-KLKGENADETTGIAIIARAIEEPLRQIVLNAGLEGSVIVSKVREGKGDY-GFNAKTDNYCNMHEAGIIDPTKVTRVALENAASVASLLLTTEATIVEIP-KPEPAMPAGPD--MGGMM 542
>gi|86158816|ref|YP_465601.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C] >gi|119366171|sp|Q2IKI2|CH601_ANADE 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|85775327|gb|ABC82164.1| chaperonin GroEL [Anaeromyxobacter dehalogenans 2CP-C] (548 aa)
Score = 1376, Expect = 7.1e-150, Identities = 294/523 (56%), Positives = 403/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNL-IGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AKEI F   AR  +  GVQ L +AV VT+GP+GRNV+I+KSYGAP ITKDGV+VAKE++L +  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +++EGL+ V +G NP+++KRG+D+ V  +V  L   S     KD+I QV TISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY SPYFVT+ ++M A LE+PY+L+T+KK++++ D++P+LE++ ++G+PLLIIA++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK++L+DIA LTGG+ V ++LGI  +++ L+DLG+A+ + +DKDN+TIV G+G ++ I+ RI  I+  IE + S+YD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A  ++    ++  L++  GD++ G QIV+ A+  P  +I  NAG+D  VV+N+IL+      GFNAAT  + D+ + G+IDP KV+R ALQNA SV+S+LLTTEA++ D
  S:     3 AKEIAFHQPAREAILRGVQTLAEAVAVTLGPKGRNVVIEKSYGAPTITKDGVTVAKEIELESKFENMGAQMVKEVASQTSDKAGDGTTTATVLARSIYEEGLKLVAAGHNPMDLKRGIDRAVEVVVAHLKSLSTPTKGKDDIAQVGTISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYSSPYFVTNPDRMEAALEDPYVLVTEKKITAMADLVPVLEQVARSGKPLLIIAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIATLTGGTVVAEELGIKLEQLGLKDLGRAKRITVDKDNTTIVDGEGKKADIEARIKVIRGQIEESTSEYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVA--YLRSLADLQKLDVGQGDQRFGVQIVVKALEWPARRIAENAGWDGPVVVNKILEGKGA-FGFNAATDTFEDLTKAGVIDPTKVSRTALQNAASVASLLLTTEAMVAD 523
>gi|191164481|ref|ZP_03026345.1| chaperonin GroEL [Geobacter sp. M21] >gi|190994372|gb|EDV69836.1| chaperonin GroEL [Geobacter sp. M21] (547 aa)
Score = 1375, Expect = 8.1e-150, Identities = 302/523 (57%), Positives = 394/523 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK IKF   ARN +  GV  L DAVKVT+GP+GRNV+I+KSYGAP+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+D+ V A+V EL   SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A ++N  ILI DKK++++KD+LP+LE+  K+GRPLLIIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LEDIAILTGG  +++++G   +  TL  LGQA+ + +DKDN+TI+ G G E+ I+ R+  I+  I+ T SDYD++ L+ RLAKL  GVAVIKVGA +E+E+KEKK RV+DAL AT+AA++EGIV GGG A +   K +    L L  +++ G  ++  A+  PI QI  NAG D  +V++++ K      G+NAA   YVDM + GIIDP KV+R ALQNA SV+ +++TTEA+I D
  S:     3 AKLIKFDQEARNCILKGVNTLADAVKVTLGPKGRNVVIEKSYGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDNVAILIHDKKIANMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPGFGDRRKAMLEDIAILTGGKVISEEVGFKLENTTLDMLGQAKKITVDKDNTTIIDGFGAEADIQGRVKMIRAQIDETSSDYDREKLQERLAKLVGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVDEGIVPGGGVAYLRAMKVL--ENLQLAPEQQFGVNVIKRALEEPIRQISQNAGVDGSIVVDKV-KNGKDAFGYNAADDVYVDMIEAGIIDPTKVSRSALQNAASVAGLMMTTEAMIAD 522
>gi|171319825|ref|ZP_02908908.1| chaperonin GroEL [Burkholderia ambifaria MEX-5] >gi|171094920|gb|EDT39949.1| chaperonin GroEL [Burkholderia ambifaria MEX-5] (546 aa)
Score = 1375, Expect = 8.2e-150, Identities = 292/527 (55%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V + V+EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++ENPYIL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I         D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + +  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +Y+   D
  S:     3 AKEILFSDVARTKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVASAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRQAIR-ELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGSG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527
>gi|116491379|ref|YP_810923.1| chaperonin GroEL [Oenococcus oeni PSU-1] >gi|122276439|sp|Q04E64|CH60_OENOB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116092104|gb|ABJ57258.1| Chaperonin GroEL (HSP60 family) [Oenococcus oeni PSU-1] (541 aa)
Score = 1375, Expect = 8.4e-150, Identities = 307/545 (56%), Positives = 411/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           MAKE++FS+ AR ++  G+ +L DAVK T+GP+GRNV++++SYG P IT DGV++AK V+L +  ENMGA+LV + ASKT D AGDGTTTATVL   +  EGL+NV +GANP+ I+ G++K   A V  LNK+S ++     I Q+A+ISA ++++IG+LIA+AMEKVG DGVIT+EE+KGI  EL VVEGMQFDRGY+S YFVTD +KM   L+NPY+LITD+K+ +I+DILP+L+ +++ GR LLIIADD+ GEAL TLV+NK+RG FNV AVKAP FGD+RK  L+DIAILTG + VT+DLG+    VT+  LGQA  V I KD +TIV+GKG ++ + +RI  I+  I+ T SD+D++ L+ RLAKL  GVAV++VGA +E ELKEKK R++DAL+AT+AA+EEG V GGG A V++   +     +L GD   G +IV+ A+  P+ QIV NAG + G VI +  K+  P +GFNAATG++V+M   GI+DP KVTR ALQNA SVS+M+LTTEAV+ ++   K+D+ PA PN  GM GMM
  S:     1 MAKEVRFSEDARTRMQAGIDKLADAVKTTIGPKGRNVVLEQSYGTPTITNDGVTIAKAVELDDHYENMGAKLVTEAASKTNDVAGDGTTTATVLTQAIVNEGLKNVTAGANPVGIRSGIEKATAAAVAGLNKNSHEVEDSSSIQQIASISA-ANEEIGKLIADAMEKVGHDGVITIEESKGIETELDVVEGMQFDRGYMSQYFVTDNDKMETNLDNPYLLITDQKIGNIQDILPVLQSVVEQGRSLLIIADDITGEALPTLVLNKLRGTFNVAAVKAPGFGDRRKAQLQDIAILTGATVVTEDLGLQLKDVTIDQLGQANRVTITKDKTTIVEGKGDKTALADRIKSIRQEIDSTTSDFDREKLQERLAKLAGGVAVVRVGAATETELKEKKYRIEDALNATRAAVEEGFVAGGGTAFVNIIPEVKKVADSLQGDVATGARIVLRALEEPLRQIVENAGLE-GSVIAQRAKSEKPEVGFNAATGEWVNMIDAGIVDPTKVTRSALQNAASVSAMILTTEAVVAELP--KKDA-PAAPNAGGMPGMM 541
>gi|85375707|ref|YP_459769.1| chaperonin GroEL [Erythrobacter litoralis HTCC2594] >gi|123293630|sp|Q2N5R9|CH602_ERYLH 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|84788790|gb|ABC64972.1| 60 kDa chaperonin, GroEL [Erythrobacter litoralis HTCC2594] (550 aa)
Score = 1375, Expect = 9.0e-150, Identities = 302/528 (57%), Positives = 402/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF   AR  +  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVL   + +EG+++V +G NP+++KRG+D  V  +V  L   SK +A  +EI QV  ISAN D+++GE IA AMEKVG +GVITV+E+KG+  EL  VEGMQFDRGY+SPYF+T+ +KM  +LENPYILI +KK+S+++ +LPILE  +++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DIAILT G  +++DLGI  + VTL  LG+A+ V IDKDN+TIV G G E+ IK R+++I+T I+ T SDYD++ L+ RLAKL  GVAVIKVG  SEVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++ +K +      L G   D+  G  IV  AI++P+ QI +NAG D  V+   +L+  N   GFNAAT  Y D+ + G+IDP KV R+ALQ+A SV+ +L+TTEA I +V +DK
  S:     3 AKDVKFGRDAREGILKGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELKDKYENMGAQMLREVASKTNDLAGDGTTTATVLGQAIVREGMKSVAAGMNPMDLKRGIDIAVTKVVENLKSRSKDVAGSEEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDESKGLEFELETVEGMQFDRGYLSPYFITNPDKMTVELENPYILIHEKKLSNLQAMLPILEAAVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDIAILTKGEMISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGDEADIKARVNEIRTQIDNTTSDYDREKLQERLAKLAGGVAVIKVGGASEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYATKVLE----GLKGENDDQTRGIDIVRKAIVAPVRQIATNAGHDGAVISGNLLREDNESQGFNAATDTYEDLVKAGVIDPTKVVRVALQDAASVAGLLITTEAAISEVPEDK 529
>gi|91778537|ref|YP_553745.1| chaperonin GroEL [Burkholderia xenovorans LB400] >gi|118597103|sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 (Protein Cpn60 4) (groEL protein 4) >gi|91691197|gb|ABE34395.1| GroEL [Burkholderia xenovorans LB400] (546 aa)
Score = 1375, Expect = 9.1e-150, Identities = 292/527 (55%), Positives = 407/527 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR++L  GV  L +AVKVT+GP+GRNV++++S+G+PV+TKDGVSVAKE++L++ ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A + EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K ++DEL VVEG+QFDRGY+SPYF+ D +K +A L+NP++L+ D+KVS+I+D+LPILE++ K GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G+S +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+T IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I+        D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + T  + G+NA TG+Y D+ Q+G++DP KVTR ALQNA SV+ +LLTT+A +++   D
  S:     3 AKEIIFSDVARSRLVEGVNILANAVKVTLGPKGRNVVLERSFGSPVVTKDGVSVAKEIELSDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVIAAIEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPFVLLHDRKVSNIRDLLPILEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLSLEKATLAELGQAKRIEVGKENTTVIDGAGDSKNIEARVKQIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVKQAIS-GLKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAQGTG-NFGYNAQTGEYGDLVQSGVLDPTKVTRTALQNASSVAGLLLTTDATVHEAPKD 527
>gi|134095720|ref|YP_001100795.1| chaperone Hsp60 (GroEL), part of GroE chaperone system [Herminiimonas arsenicoxydans] >gi|166198467|sp|A4G837|CH60_HERAR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|133739623|emb|CAL62674.1| 60 kDa chaperonin (Protein Cpn60) (groEL protein) [Herminiimonas arsenicoxydans] (546 aa)
Score = 1375, Expect = 9.2e-150, Identities = 291/528 (55%), Positives = 401/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+ F D+AR K+  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L + ++NMGAQLVK+VAS+T+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A V +L   +K      EI QV  ISANSD  IGE IA AMEKVG +GVITVE+ K +NDEL +VEGMQFDRGY+SPYF+ +  K  A LENP+IL+ DKK+S+I+D+LP+LE++ K GRPLLIIA+D++GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAIL+GG  V +++G++ +K+TL++LGQA+ + I K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+     INV   N   D++ G +IV+ A+  P+  IV NAG +  VV+ ++L+    + G+NAA G Y DM + G++DP KVTR ALQNA S++++LLTT+ ++ +V ++K
  S:     3 AKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVAATVEQLALIAKPCTTTKEIAQVGAISANSDYSIGERIAEAMEKVGKEGVITVEDGKSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQVAKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQVVAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAINIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRARANINVKGDN--SDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGKG-NFGYNAANGIYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEEK 527
>gi|103487560|ref|YP_617121.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256] >gi|118597101|sp|Q1GRD4|CH602_SPHAL 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|98977637|gb|ABF53788.1| chaperonin GroEL [Sphingopyxis alaskensis RB2256] (539 aa)
Score = 1375, Expect = 9.2e-150, Identities = 294/535 (54%), Positives = 417/535 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPAM 536
           AKE+KF+  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ++++VASK  D+AGDGTTTATVLA  + +EG + V +G NP+++KRG+D  V A+V +L   +KK++   EI QVATISAN D+++G ++A AM+KVG++GVITVEEAK +  EL  VEGMQFDRGY+SPYF+T+  K+  +L++PYILI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVN++RG   V AVKAP FGD+RK +LEDIAILTGG+ V++DLGI  + VT+  LG+A+ VVIDKDN+TIV G G  + I  RI++I+  I+ T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ +   N   D++ G  IV  A+ +P  QI  NAG D   ++ ++L++++ + GFNAATG+Y D+ + G+IDP KV R ALQ+A SV+++L+TTEA++ ++ K++K   +PAM
  S:     3 AKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGSKAVAAGMNPMDVKRGIDLAVKAVVKDLETHAKKVSANSEIAQVATISANGDEEVGRILAEAMDKVGNEGVITVEEAKSLATELETVEGMQFDRGYLSPYFITNAEKLKVELDDPYILIHEKKLSNLQAMLPLLEAVVQSGKPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGNVVSEDLGIKLENVTVNMLGRAKKVVIDKDNTTIVDGVGARTDIDARIAQIRQQIDTTTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALLRALKALDGLKAAN--DDQQSGIDIVRRALRAPARQIADNAGEDGAWIVGKLLESSDYNWGFNAATGEYEDLVKAGVIDPAKVVRTALQDAASVAALLITTEALVAELPKEEKAAPMPAM 537
>gi|23098111|ref|NP_691577.1| chaperonin GroEL [Oceanobacillus iheyensis HTE831] >gi|29839305|sp|Q8CXL3|CH60_OCEIH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|22776336|dbj|BAC12612.1| class I heat shock protein (chaperonin) [Oceanobacillus iheyensis HTE831] (545 aa)
Score = 1374, Expect = 1.0e-149, Identities = 297/524 (56%), Positives = 402/524 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK++KFS+ AR  +  GV  L DAVKVT+GP+GRNV++ K +G+P+IT DGV++AKE++L +  ENMGAQLV +VASKT D AGDGTTTATVLA  + +EGL+NV SGANP+ I+RG++K V   V EL   S+ I  K+ I Q+A +S+  D+++G+LIA AME+VG+DGVIT+EE+KG N EL VVEGMQFDRGY SPY VTD +KM A LE+PYILITDKK+ +I+++LP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIA+LTG   +T+DLG+     ++  LG+A  VV+ K+N+T+V+G G    I  R+++I+   E + SD+DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+A +EEG+V GGG ALV++ ++  V+ L L GDE  G  IV+ A+  P+ QIV NAG + G +I E LK     +G+NAAT ++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D
  S:     1 MAKDLKFSEDARRAMLRGVDTLADAVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAKEIELEDAFENMGAQLVSEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTSGANPVGIRRGIEKAVELAVQELKGISQPIESKEAISQIAAVSS-GDEEVGQLIAEAMERVGNDGVITIEESKGFNTELEVVEGMQFDRGYASPYMVTDQDKMEAVLEDPYILITDKKIGNIQEVLPVLEQVVQQGKPLLMIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGAEVITEDLGLDLKSASIDQLGRASKVVVTKENTTVVEGSGDPEAISSRVAQIRAQAEESTSDFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAGVEEGMVPGGGTALVNIHRQ--VSELTLEGDEATGASIVLRALEEPVRQIVHNAGLE-GSIIVERLKGEKVGIGYNAATDEWVNMVEAGIVDPTKVTRSALQNAASVAAMFLTTEAVVAD 520
>gi|145219401|ref|YP_001130110.1| chaperonin GroEL [Prosthecochloris vibrioformis DSM 265] >gi|189082361|sp|A4SDP9|CH60_PROVI 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|145205565|gb|ABP36608.1| chaperonin GroEL [Prosthecochloris vibrioformis DSM 265] (547 aa)
Score = 1374, Expect = 1.0e-149, Identities = 305/530 (57%), Positives = 406/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKEV+L + IENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT++  M A+L++  ILI DKK+S++K++LPILE+  ++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DIAILTGG+ ++++ G   +  T+  LGQA  V +DKDN+TIV+GKG + +IK RI++IK  I+ + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV+GGG AL+   K ++ N      D+K G +I+  A+  P+ QIV+N G   G V+ E +K      GFNA T +Y ++ + G++DP KVTR AL+NA SV+S+LLTTEA I D+K++  D
  S:     3 AKDILFDADARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEVELEDAIENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVAELRTISRSISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNSESMEAELDDALILIYDKKISNMKELLPILEKGAQSGRPLLIIAEDIEGEALATLVVNKLRGTLKVCAVKAPGFGDRRKAMLDDIAILTGGTVISEEKGYKLENATINYLGQAARVSLDKDNTTIVEGKGTQEEIKARINEIKGQIDKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVVGGGVALIRAIKGLD-NAKPDNDDQKTGIEIIRRALEEPLRQIVANTGTTDGAVVLEHVKNGEGDYGFNARTEQYENLVEAGVVDPTKVTRSALENAASVASILLTTEACITDIKENTPD 531
>gi|71736501|ref|YP_276203.1| chaperonin GroEL [Pseudomonas syringae pv. phaseolicola 1448A] >gi|119366257|sp|Q48EI5|CH60_PSE14 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|71557054|gb|AAZ36265.1| chaperonin, 60 kDa [Pseudomonas syringae pv. phaseolicola 1448A] (547 aa)
Score = 1374, Expect = 1.1e-149, Identities = 299/528 (56%), Positives = 406/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DS R K+  GV  L DAVK T+GP+GRNV+I+KS+GAP+ITKDGVSVAKE++L +  ENMGAQLVKDVAS+  D+AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL K SK       I QV TISANSD  IG++IA AMEKV  DGVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+L++P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG+ +++++G+S +  TL+ LG A+ V+++K+N+TI+ G G+++ I  RIS+I+  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I         D+ +G  ++  A+ +P+ QIV+N+G +  VV++++ K  + + G+NAA+G+Y DM + GI+DP KVTR ALQ A S++S+++TTEA+I DV +DK
  S:     3 AKEVKFGDSGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPLLLLVDKKISNIREMLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTVISEEVGLSLETTTLEHLGNAKRVILNKENTTIIDGAGVKTDIDSRISQIRQQIGDTSSDYDKEKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRSLQAIE-GLKGDNADQDVGIALLRRAVEAPLRQIVANSGDEPSVVVDKV-KQGSGNFGYNAASGEYGDMIEMGILDPAKVTRSALQAASSIASLMITTEAMIADVPEDK 528
>gi|197086009|gb|ACH37280.1| chaperonin GroEL [Geobacter bemidjiensis Bem] (547 aa)
Score = 1374, Expect = 1.1e-149, Identities = 302/523 (57%), Positives = 394/523 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK IKF   ARN +  GV  L DAVKVT+GP+GRNV+I+KSYGAP+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+D+ V A+V EL   SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A ++N  ILI DKK++++KD+LP+LE+  K+GRPLLIIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LEDIAILTGG  +++++G   +  TL  LGQA+ + +DKDN+TI+ G G E+ I+ R+  I+  I+ T SDYD++ L+ RLAKL  GVAVIKVGA +E+E+KEKK RV+DAL AT+AA++EGIV GGG A +   K +    L L  +++ G  ++  A+  PI QI  NAG D  +V++++ K      G+NAA   YVDM + GIIDP KV+R ALQNA SV+ +++TTEA+I D
  S:     3 AKIIKFDQEARNCILKGVNTLADAVKVTLGPKGRNVVIEKSYGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDNVAILIHDKKIANMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPGFGDRRKAMLEDIAILTGGKVISEEVGFKLENTTLDMLGQAKKITVDKDNTTIIDGYGAEADIQGRVKMIRAQIDETSSDYDREKLQERLAKLVGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVDEGIVPGGGVAYLRALKVL--EKLQLAPEQQFGVNVIKRALEEPIRQISQNAGVDGSIVVDKV-KNGKDAFGYNAADDVYVDMIEAGIIDPTKVSRSALQNAASVAGLMMTTEAMIAD 522
>gi|194560083|ref|YP_002095108.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184] >gi|124875599|gb|EAY65589.1| Chaperonin GroEL (HSP60 family) [Burkholderia cenocepacia PC184] (546 aa)
Score = 1374, Expect = 1.1e-149, Identities = 292/527 (55%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR+KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V + V EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++E+PYIL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I         D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + T  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +Y+   D
  S:     3 AKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVTSAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRQAIR-ELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGTG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527
>gi|28377591|ref|NP_784483.1| chaperonin GroEL [Lactobacillus plantarum WCFS1] >gi|38257531|sp|Q88YM5|CH60_LACPL 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|28270423|emb|CAD63326.1| GroEL chaperonin [Lactobacillus plantarum WCFS1] >gi|45644480|gb|AAS72990.1| GroEL [Lactobacillus plantarum] (541 aa)
Score = 1374, Expect = 1.1e-149, Identities = 307/545 (56%), Positives = 412/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKE+KFS+ AR+ +  GV QL D VK T+GP+GRNV++++SYG+P IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG+++     V+ L+  + ++  +++I Q+A++S+ S++  G+LIA AMEKVG DGVIT+EE++G++  L VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+S+I+DILP+L+ I++ G+PLLIIADD+ GEAL TLV+NKMRG FNVVAVKAP FGD+RK+ L+DIAILTGG+ +TDDLG+     T+  LGQA  V + KDN+TIV+G G +  I ER+  I+  I  T SD+DK+ L+ RLAKL  GVAV++VGA +E ELKE+K R++DAL+AT+AA+EEG V GGG AL++V K  +V  L   GD + G  IV  A+  P+ QI  NAG + G VI E +K   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ +  ++   + PA PN GMGGMM
  S:     1 MAKELKFSEDARSAMLKGVDQLADTVKSTLGPKGRNVVLEQSYGSPTITNDGVTIAKAIELDDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQSIVNEGMKNVTAGANPVGIRRGIEEATKTAVDSLHAMAHEVKTQEDIAQIASVSSASEET-GKLIAEAMEKVGHDGVITIEESRGVDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDILPLLQSIVEQGKPLLIIADDISGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKEQLQDIAILTGGTVITDDLGLELKDTTIDQLGQANKVTVTKDNTTIVEGAGSKDAISERVEFIRNQIGETTSDFDKEKLQERLAKLAGGVAVVRVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTALINVIK--DVAALKETGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKMKEQKPGVGFNAATDEWVDMIKAGIVDPTKVTRSALQNAASVSALLLTTEAVVAEKPEENAPAAPAAPNPGMGGMM 541
>gi|167362529|ref|ZP_02297052.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167070617|gb|EDR74570.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325] (542 aa)
Score = 1374, Expect = 1.1e-149, Identities = 299/521 (57%), Positives = 401/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEIKFS  AR K+  GV  L +AVK T+GP+GRNV+I++S+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V AIV EL  +++KI+   EI QV TISAN D +IG  +A AME+VG+DGVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E+PYILI +KK+S+++ +LP+LE ++++ +PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ +++DLGI  + VTL  LG+A+ V I+K+N+TIV G G +S I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA++EGI+ GGG AL+   K + NV T N  GD+++G  IV  A+ +P  QI  NAG +  V++ ++ + +    G+NA TG+Y D++  G+IDP KV R ALQ+A S++ +L+TTEA+I
  S:     3 AKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIERSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVGAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMERVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVQEGILPGGGVALLRAVKALDNVKTAN--GDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMI 522
>gi|163767731|ref|ZP_02174739.1| chaperonin GroEL [Anaeromyxobacter sp. K] >gi|196171728|gb|ACG72701.1| chaperonin GroEL [Anaeromyxobacter sp. K] (547 aa)
Score = 1374, Expect = 1.2e-149, Identities = 294/523 (56%), Positives = 399/523 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AKEI F   AR  +  GVQ L +AV VT+GP+GRNV+I+KS+GAP ITKDGV+VAKE+++ +  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +++EGL+ V +G NP+++KRG+D+ V  +V  L K S     K++I QV TISAN D  IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY SPYFVT+ ++M A LE+PYILIT+KK++++ D++P+LE++ ++G+PLLIIA++V+GEAL TLVVNK+RG  +V AVKAP FGD+RK++L+DIA LTGG+ V ++LGI  D++ L+DLG+A+ + +DKDN+TIV G+G +  I+ RI  ++  IE T S+YD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A +     +    +   GD++ G QIV+ A+  P  +I  NAG+D  VV+N+IL+      GFNAAT  + D+ + G+IDP KV+R ALQNA SV+S+LLTTEA++ D
  S:     3 AKEIAFHQPAREAILRGVQTLAEAVAVTLGPKGRNVVIEKSFGAPTITKDGVTVAKEIEVESKFENMGAQMVKEVASQTSDKAGDGTTTATVLARSIYEEGLKLVAAGHNPMDLKRGIDRAVEVVVAHLKKLSTPTKGKEDIAQVGTISANGDTTIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYSSPYFVTNPDRMEAVLEDPYILITEKKITAMADLIPVLEQVARSGKPLLIIAEEVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIATLTGGTVVAEELGIKLDQLGLKDLGRAKRITVDKDNTTIVDGEGKKEDIQARIKVMRGQIEETTSEYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRALAELQKLDVGQ-GDQRFGVQIVVKALEWPARRIAENAGWDGPVVVNKILEGQGA-FGFNAATDTFEDLTKAGVIDPTKVSRTALQNAASVASLLLTTEAMVAD 523
>gi|194015865|ref|ZP_03054480.1| chaperonin GroL [Bacillus pumilus ATCC 7061] >gi|194012220|gb|EDW21787.1| chaperonin GroL [Bacillus pumilus ATCC 7061] (544 aa)
Score = 1374, Expect = 1.2e-149, Identities = 301/524 (57%), Positives = 409/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G+++ V   +  L++ SK I  K+ I QVA+ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LENPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI++LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G  +QI  R+++I+  +E T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V K+  V ++   GD + G  IV+ ++  PI QI  NAG + G VI E LK     +GFNAAT ++V+M + GI+DP KVTR ALQNA SV++MLLTTEAV+ D
  S:     1 MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIEEAVKVALEGLHEISKPIEGKESIAQVASISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGELITEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGDSAQISARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYKK--VASIEADGDVQTGVNIVLRSLEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGFNAATNEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVAD 520
>gi|77166372|ref|YP_344897.1| chaperonin GroEL [Nitrosococcus oceani ATCC 19707] >gi|119366252|sp|Q3J729|CH60_NITOC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|76884686|gb|ABA59367.1| Chaperonin Cpn60/TCP-1 [Nitrosococcus oceani ATCC 19707] (554 aa)
Score = 1374, Expect = 1.2e-149, Identities = 295/531 (55%), Positives = 410/531 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDS 532
           AK+++FS+ AR+++ +GV  L DAV+VT+GPRGRNV+++KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A V EL K SK       I QV TISAN+++ +G++IA AM+KVG +GVITVEE  G+++EL VVEGMQFDRGY+SPYF+TD   M A L++PYILI DKK+S+I+D+LP+LE + K G+PLL+I++DV+GEAL TLVVN +RG+  V AVKAP FGD+RK +LEDIA+LTGG+ +++++G+S DKVTL DLG+A+ + ++K+N+TIV G G    IK R+ +++  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +E+E+KEKK RV+DAL AT+AA+EEG+V GGG AL+    R  +   +L G   D+ +G  I   A+  P+ QIV+N+G +  V++N+I K    + G+NAATG++ DM   GI+DP KV+R ALQNA SV+ +++TTEA+I +   D+E S
  S:     3 AKDVRFSEDARHRMMHGVNVLADAVRVTLGPRGRNVVLEKSFGAPTITKDGVSVAKEIELKDRFENMGAQMVKEVASQTSDVAGDGTTTATVLAQSILREGMKAVAAGMNPMDLKRGVDKAVVAAVEELKKLSKPCEDSKAIGQVGTISANAEESVGKIIAEAMDKVGKEGVITVEEGSGLDNELEVVEGMQFDRGYLSPYFITDQQSMAADLDDPYILIHDKKISNIRDLLPVLESVAKAGKPLLVISEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDIAVLTGGTVISEEVGLSLDKVTLDDLGRAKKITVNKENTTIVDGAGSADDIKARVEQVRIQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEMEMKEKKARVEDALHATRAAVEEGVVPGGGVALI----RALLGIKDLKGANHDQDVGINIARRAMEEPLRQIVNNSGEEASVIVNQI-KGGEGNYGYNAATGEFGDMIAMGILDPTKVSRTALQNAASVAGLMITTEAMIAEAPKDEEAS 531
>gi|90419968|ref|ZP_01227877.1| chaperonin groEL [Aurantimonas sp. SI85-9A1] >gi|90336009|gb|EAS49757.1| chaperonin groEL [Aurantimonas sp. SI85-9A1] (551 aa)
Score = 1374, Expect = 1.3e-149, Identities = 299/521 (57%), Positives = 404/521 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE+KF   AR ++  GV  L DAVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D+AGDGTTTATVLA  + +EG + V +G NP+++KRG+D  V  +V  L  +++ I   DE+ QV TISAN +K+IGE+IA+AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+  KM+A+LE+ YIL+ +KK+S+++ +LP+LE ++++ +PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIA+LTGG+ +++D+GI  + VTL  LG+A+ V I K+N+TIV G G ++QI+ R+ +IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL+AT+AA+EEGIV GGG AL+  S  + +  +N   D+  G  IV  A+ +PI QIV NAG +  +++ +IL+  +   G+NAATG+Y DM Q GI+DPVKV R ALQ+A SV+ +L+TTEA+I
  S:     3 AKEVKFGRDARERMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPMDVKRGIDAAVLKVVEALGVAARSIDTSDEVAQVGTISANGEKEIGEMIASAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVAELEDCYILLHEKKLSNLQALLPVLESVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAVLTGGTVISEDVGIKLENVTLDMLGRAKKVSITKENTTIVDGAGEKTQIEARVGQIKGQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGVALLRASNAVTIKGIN--ADQDAGIAIVRKALQAPIRQIVQNAGAEGSIIVGKILENESLSFGYNAATGEYGDMIQMGIVDPVKVVRSALQDAASVAGLLVTTEAMI 521
>gi|66047299|ref|YP_237140.1| chaperonin GroEL [Pseudomonas syringae pv. syringae B728a] >gi|81307950|sp|Q4ZP20|CH60_PSEU2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|63258006|gb|AAY39102.1| Chaperonin Cpn60/TCP-1 [Pseudomonas syringae pv. syringae B728a] (547 aa)
Score = 1373, Expect = 1.3e-149, Identities = 299/528 (56%), Positives = 406/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DS R K+  GV  L DAVK T+GP+GRNV+I+KS+GAP+ITKDGVSVAKE++L +  ENMGAQLVKDVAS+  D+AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL K SK       I QV TISANSD  IG++IA AMEKV  DGVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+L++P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG+ +++++G+S +  TL+ LG A+ V+++K+N+TI+ G G+++ I  RIS+I+  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I         D+ +G  ++  A+ +P+ QIV+N+G +  VV++++ K  + + G+NAA+G+Y DM + GI+DP KVTR ALQ A S++S+++TTEA+I DV +DK
  S:     3 AKEVKFGDSGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPLLLLVDKKISNIREMLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTVISEEIGLSLETTTLEHLGNAKRVILNKENTTIIDGAGVKTDIDSRISQIRQQIGDTSSDYDKEKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRSLQAIE-GLKGDNADQDVGIALLRRAVEAPLRQIVANSGDEPSVVVDKV-KQGSGNYGYNAASGEYGDMIEMGILDPAKVTRSALQAASSIASLMITTEAMIADVPEDK 528
>gi|2493641|sp|P95678|CH60_RHOCA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|1699436|gb|AAB37532.1| Cpn60 [Rhodobacter capsulatus] (545 aa)
Score = 1373, Expect = 1.3e-149, Identities = 288/528 (54%), Positives = 406/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KFS  AR+++  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T DEAGDGTTTATVLA  + +EG++ V +G NP+++KRG+D     +V  +  +++ +   DE+ QV TISAN + +IG  IA+A +KVG++GVITVEE KG++ E+ VVEGMQFDRGY+SPYFVT+ +KMIA LE+ YIL+ +KK+SS++ ++P+LE ++++ RPL+I+A+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +L+DIAILTGG  ++DDLG+  + VTL  LG+A+ V I K+N+TIV G G +++I  R++ I+T IE T SDYD++ L+ R+AKL  GVAVI+VG ++EVE+KE+KDRVDDAL+AT+AA++EGI++GGG ALV  +K++N +      D+  G  IV  A+ +P+ QI  NAG D  VV  ++ ++ +P  GFNA T +Y DMF  G+IDP KVTR AL++A S++ +L+TTE +I +  + K
  S:     3 AKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGIDLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADASQKVGNEGVITVEENKGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAVIQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQVISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAHIRTQIEETTSDYDREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALVQAAKKLN-DLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFNAQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPK 529
>gi|170698819|ref|ZP_02889882.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10] >gi|170136297|gb|EDT04562.1| chaperonin GroEL [Burkholderia ambifaria IOP40-10] (540 aa)
Score = 1373, Expect = 1.4e-149, Identities = 300/534 (56%), Positives = 407/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPA 535
           AK++KF DSAR ++  GV  L DAVKVT+GP+GRNVLI++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL K SK I+   EI QV +ISAN+D+ IG++IA+AMEKVG++GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D +K  A L++  IL+ DKK+S+I+D+LP+LE   K G+PLLI+A+D+DGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G    K +L+DLG+A+ V + K+++ I+ G G + +I  R+  I T IE T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  ++    +      D+  G QIV+ A+ +P+  I SNAG +  VVI ++L+    + G+NAATG+Y D+ + G++DP KVTR ALQNA S++ ++LTT+A + D  KDDK    PA
  S:     3 AKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADETIGKIIADAMEKVGNEGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPDKQAAYLDDALILLHDKKISNIRDLLPVLEATSKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEETGKQLQKASLEDLGRAKRVEVRKEDTIIIDGAGDQERIDARVKSIHTQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLR-ARSTATSLKGANNDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGKG-NFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDDKPAQAPA 535
>gi|163763029|ref|ZP_02170092.1| ABC transporter, transmembrane region, type 1 [Bacillus selenitireducens MLS10] >gi|160356297|gb|EDP82947.1| ABC transporter, transmembrane region, type 1 [Bacillus selenitireducens MLS10] (544 aa)
Score = 1373, Expect = 1.4e-149, Identities = 304/528 (57%), Positives = 402/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKFS+ AR  +  GV +L D VKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGAQLV +VASKT D AGDGTTTATVLA  +  EGL+NV SGANP+ I++G++K   A V+EL   SK I  ++ I QVA IS+ +D ++GELIA AME+VG+DGVITVEE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE+PYILITDKK+ +I+++LP+LE++++  RP+LIIA+DV+GEA  TLVVNK+RG FN VAVKAP FGD+RK +LED+A LTGG  +T+DLG+     ++  LG+A  VV+ KDN+TIV G G  ++I  R+++IK  +E T S++DK+ L+ RLAKL  GVAV+KVGA +E E+KEKK R++DAL++T+AA+EEGIV GGG AL++V     V  +   GDE  G  IV+ A+  P+ QI  NAG + G +I E LK     +GFNAATG+YV+M + GI+DP KVTR ALQNA SVS+M LTTEAVI D  ++
  S:     1 MAKDIKFSEDARRAMLRGVDRLADTVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDNFENMGAQLVSEVASKTNDIAGDGTTTATVLAQSMIAEGLKNVTSGANPMVIRKGIEKATQAAVDELRAISKPIEGRESISQVAAISS-ADDEVGELIAEAMERVGNDGVITVEESKGFATELEVVEGMQFDRGYASPYMVTDSDKMEAVLEDPYILITDKKIGNIQEVLPVLEQVVQQSRPILIIAEDVEGEAFATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDVATLTGGEVITEDLGLDLKSASITQLGRASKVVVTKDNTTIVDGNGDAAEIANRVNQIKAQLEETTSEFDKEKLQERLAKLAGGVAVVKVGAATETEMKEKKLRIEDALNSTRAAVEEGIVAGGGTALINVLNA--VKAVEADGDEATGVNIVLRALEEPLRQIAHNAGLE-GSIIVERLKGEEVGVGFNAATGEYVNMVEAGIVDPTKVTRSALQNAASVSAMFLTTEAVIADFPEE 524
>gi|157691328|ref|YP_001485790.1| chaperonin GroEL [Bacillus pumilus SAFR-032] >gi|167008690|sp|A8FAG3|CH60_BACP2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|157680086|gb|ABV61230.1| chaperone GroEL [Bacillus pumilus SAFR-032] (544 aa)
Score = 1373, Expect = 1.4e-149, Identities = 301/524 (57%), Positives = 409/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G+++ V   +  L++ SK I  K+ I QVA+ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LENPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI++LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G  +QI  R+++I+  +E T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V K+  V ++   GD + G  IV+ ++  PI QI  NAG + G VI E LK     +GFNAAT ++V+M + GI+DP KVTR ALQNA SV++MLLTTEAV+ D
  S:     1 MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIEEAVKVALEGLHEISKPIEGKESIAQVASISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGELITEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGDSAQIAARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYKK--VASIEADGDVQTGVNIVLRSLEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGFNAATNEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVAD 520
>gi|194100044|ref|YP_002003184.1| GroEL [Neisseria gonorrhoeae NCCP11945] >gi|193935334|gb|ACF31158.1| GroEL [Neisseria gonorrhoeae NCCP11945] (544 aa)
Score = 1373, Expect = 1.4e-149, Identities = 293/537 (54%), Positives = 411/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RGV   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+T++ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM   G++DP KVTR ALQ+A S++ ++LTT+ +I ++ ++K    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGVLKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTVIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIGMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEEK----PAVPD 533
>gi|116618851|ref|YP_819222.1| chaperonin GroEL [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270949|sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116097698|gb|ABJ62849.1| Chaperonin GroEL (HSP60 family) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (539 aa)
Score = 1373, Expect = 1.4e-149, Identities = 312/545 (57%), Positives = 410/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKE+KFS+ AR K+  GV +L D VK T+GP+GRNV++++SYGAP IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EGL+NV +GANP+ I+ G++K   A V +L++ S  +  KDEI Q+A+ISA +++++GELIA AM+KVG+DGVIT+EE+KGI   L VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+ +I+DILP+L+ +++ GR LLIIADD+ GEAL TLV+NKMRG FNVVAVKAP FGD+RK  LEDIAILTGG+ +T+DLG++   VT+  LGQA  + I KDN+TIV+G G +  +  R+  IK  I  T SD+D++ L+ RLAKL  GVAVI VGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V     V+ L+  GD + G   V+ A+ SP+ QI  NAG +  V++N+ LK      G+NAAT ++VDM   GI+DP KVTR ALQNA SVS++LLTTEAV+   ++ K+D+  AMP  GM GMM
  S:     1 MAKELKFSEDARAKMKAGVDKLADTVKTTIGPKGRNVVLEQSYGAPTITNDGVTIAKAIELEDHFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVGEGLKNVTAGANPVGIRTGIEKATAAAVAKLHEMSHTVNTKDEIAQIASISA-ANEEVGELIAEAMDKVGNDGVITIEESKGIETTLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIGNIQDILPVLQSVVEQGRALLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKAQLEDIAILTGGTVITEDLGLNLKDVTIDQLGQASKINITKDNTTIVEGSGDKGAVASRVDTIKQQIAETTSDFDREKLQERLAKLAGGVAVINVGAATETELKERKYRIEDALNATRAAVEEGFVAGGGTALVNVIAA--VSALSEEGDVQTGINTVIKALESPVRQIAENAGLEGSVIVNK-LKEQKEGFGYNAATDEWVDMIAAGIVDPTKVTRSALQNAASVSALLLTTEAVV--AEEPKDDAPAAMPQGGMPGMM 539
>gi|37701746|gb|AAR00649.1| GroEL [Enterococcus mundtii] (524 aa)
Score = 1373, Expect = 1.5e-149, Identities = 305/524 (58%), Positives = 403/524 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKE+KF++ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++      V EL+  S  +  K+ I QVA +S+ S++ +G LIA AMEKV +DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPY+LITDKK+S+I+DILP+LE+I++  RPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG+ +TDDLG+     T+++LG A  VV+DKDN+TIV+G G +  I  R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  ++ +  +   GD   G +IV  A+  PI QI  NAG++  V++++ LK  +   GFNAATG++V+M + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKELKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKTAVEELHNISTVVDSKEAIAQVAAVSSGSEQ-VGPLIAYAMEKVRNDGVITIEESKGIETELDVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYLLITDKKISNIQDILPLLEQILQQSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGTVITDDLGLELKDATIENLGNASKVVVDKDNTTIVEGSGDKPAIDARVQLIKNQIAETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNATRAAVEEGMVSGGGTALVNVINKVAM--IEAEGDVATGIKIVTRALEEPIRQIAENAGYEGSVIVDK-LKNVDLGTGFNAATGEWVNMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|116691621|ref|YP_837154.1| chaperonin GroEL [Burkholderia cenocepacia HI2424] >gi|123464467|sp|A0AXY5|CH602_BURCH 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|116649621|gb|ABK10261.1| chaperonin GroEL [Burkholderia cenocepacia HI2424] (546 aa)
Score = 1373, Expect = 1.5e-149, Identities = 292/527 (55%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR+KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V + V EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++E+PYIL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I         D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + T  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +Y+   D
  S:     3 AKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKTTLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRQAIR-ELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGTG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527
>gi|148827734|ref|YP_001292487.1| chaperonin GroEL [Haemophilus influenzae PittGG] >gi|166198465|sp|A5UH48|CH60_HAEIG 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|148718976|gb|ABR00104.1| chaperonin GroEL [Haemophilus influenzae PittGG] (548 aa)
Score = 1373, Expect = 1.5e-149, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|170736378|ref|YP_001777638.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3] >gi|169818566|gb|ACA93148.1| chaperonin GroEL [Burkholderia cenocepacia MC0-3] (546 aa)
Score = 1373, Expect = 1.6e-149, Identities = 292/527 (55%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR+KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V + V EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++E+PYIL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I         D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + T  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +Y+   D
  S:     3 AKEILFSDIARSKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVASAVEELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRQAIR-ELKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGTG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVYEAPKD 527
>gi|56476061|ref|YP_157650.1| chaperonin GroEL [Azoarcus sp. EbN1] >gi|68566262|sp|Q5P7G2|CH60_AZOSE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|56312104|emb|CAI06749.1| Chaperonin 60kD subunit [Azoarcus sp. EbN1] (550 aa)
Score = 1373, Expect = 1.6e-149, Identities = 291/528 (55%), Positives = 408/528 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG-DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DSAR+++  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A+  EL K SK  +   EI QV +ISANSD  IGE+IA +M+KVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ + +K +A LENP+IL+ DKK+S+I+D+LP+LE++ K GRPLLI+A+DV+GEAL TLVVN +RG+    +VKAP FGD+RK +LEDIA+LTGG  + +++G++ +K TL +LGQA  + I K+N+ I+ G G  S+I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+    R N+ TL     D+  G +IV+ A+  P+ +IV+NAG +  VV+N +++ T  + G+NAATG+Y D+   G++DP KV RIALQNA SV+ ++LTT+ ++ ++ ++K
  S:     3 AKEVKFGDSARDRMVAGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVIAVTEELKKLSKPCSTNKEIAQVGSISANSDADIGEIIAKSMDKVGKEGVITVEDGKSLQNELDVVEGMQFDRGYLSPYFINNPDKQVAILENPFILLFDKKISNIRDLLPVLEQVAKAGRPLLIVAEDVEGEALATLVVNNIRGILKTCSVKAPGFGDRRKAMLEDIAVLTGGQVIAEEVGLTLEKATLAELGQAARIEIGKENTIIIDGAGEGSRIEGRVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRA--RANLGTLKGDNHDQDAGIKIVLRALEQPLREIVANAGDEPSVVVNRVVEGTG-NFGYNAATGEYGDLVDMGVLDPTKVERIALQNAASVAGLMLTTDCMVGELAEEK 528
>gi|94500716|ref|ZP_01307245.1| chaperonin GroEL [Oceanobacter sp. RED65] >gi|94427038|gb|EAT12019.1| chaperonin GroEL [Oceanobacter sp. RED65] (545 aa)
Score = 1373, Expect = 1.7e-149, Identities = 296/528 (56%), Positives = 402/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK++KF DSAR+K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+  D+AGDGTTTATVLA  +  EGL++V +G NP+++KRG+DK   A+V EL K S+       I QV TISANSDK +G+LIA AMEKVG +GVITVEE +G+ DEL VVEGMQFDRGY+SPYF+ +  KM  +LENP IL+ DKK+ ++++I+P+LE + K+GRPLLI+A+DV+G+AL TLVVN MRG F V AVKAP FGD+RK +L+DIA LTGG  +++++G+S +  +L+DLG A+ VVIDK+N+ +V G G ++ +  R  +I++ IE T SDYDK+ L+ RLAKL  GVAVIKVGA SE+E+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + V   N   D+ +G  + + A+ +PI QI  NAG +  VV++++ K+     G+NA+TG+Y DM + GIIDP KVTR +LQ A SV  +++TTEA++ D+ ++
  S:     1 MAKDVKFGDSARSKMLKGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASQANDKAGDGTTTATVLAQAIINEGLKSVAAGMNPMDLKRGIDKATAAVVEELAKLSRPCTDSKNIAQVGTISANSDKTVGDLIAQAMEKVGKEGVITVEEGQGLADELEVVEGMQFDRGYLSPYFINNQEKMNVELENPLILLADKKIDNLQEIIPLLENVAKSGRPLLIVAEDVEGQALATLVVNTMRGTFKVAAVKAPGFGDRRKAMLQDIATLTGGKVISEEVGMSLETTSLEDLGTAKKVVIDKENTVMVGGAGSDADVTARCEQIRSEIETTTSDYDKEKLQERLAKLAGGVAVIKVGAGSEIEMKEKKDRVEDALQATRAAVEEGVVAGGGVALIRAISNVTVTGDN--EDQNVGIALALRAMEAPIRQIAYNAGDEASVVVDKV-KSGEGSFGYNASTGEYGDMIELGIIDPTKVTRSSLQAAASVGGLMITTEAMVADIPEE 525
>gi|161830449|ref|YP_001597541.1| chaperonin GroL [Coxiella burnetii RSA 331] >gi|189082349|sp|A9NA82|CH60_COXBR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|30142090|gb|AAP13855.1| heat shock protein B [Coxiella burnetii] >gi|161762316|gb|ABX77958.1| chaperonin GroL [Coxiella burnetii RSA 331] (552 aa)
Score = 1373, Expect = 1.7e-149, Identities = 296/533 (55%), Positives = 405/533 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK +KFS    + +  GV+ L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +  EG++ VI+G NP+++KRG+DK V A V EL K SK    +  I QV TISANSDK IG++IA AMEKVG +GVITVE+  G+ + L VVEGMQFDRGY+SPYF+ +   M A+LENP+IL+ DKK+S+I++++P+LE I K+GRPLL+IA+D++GEAL TLVVN +RGV  V AVKAP FGD+RK +L+DIA+LTGG  +++++G+S +  +L DLG A+ VV+ KD++TI+ G G    IK R+ +I+  IE + SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+ V K ++ V   N   D+++G +I   A+  P+SQIV N G    VV +++L   + + G+NAATG+Y DM + GI+DP KVTR ALQNA S++ +++TTE ++ +    KE+S+P
  S:     3 AKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGIDKAVTAAVAELKKISKPCKDQKAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDGSGLENALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNIRELIPLLENIAKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVEN--EDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMP 534
>gi|149776882|gb|ABR28463.1| chaperonin GroEL [Bacillus megaterium] (543 aa)
Score = 1372, Expect = 1.7e-149, Identities = 305/538 (56%), Positives = 407/538 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ I++GM+K V   V EL   SK I  KD I QVA ISA +D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A L++PYILITDKK+ +I++ILP+LE++++ G+PLLIIA+DV+GEAL TLVVNK+RG F  VAVKAP FGD+RK +L+D+AILTGG  +T++LG+      +  LG+A  +V+ K+N+T+V G G    I  R+++IK  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV++  +  V ++   GD   G  IV+ AI  P+ QI  NAG + G VI E LK      GFNAATG++V+M  TGI+DP KVTR ALQNA SV++M LTTEAV+ D    +E   PAMP+
  S:     1 MAKDIKFSEEARRAMLRGVDTLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGMEKAVAVAVEELKAISKPIQGKDSIAQVAAISA-ADEEVGQLIAEAMERVGNDGVITLEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDDPYILITDKKIGNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGDRRKAMLQDVAILTGGEVITEELGLDLKTAGIDQLGRASKIVVTKENTTVVNGAGNAEDILARVNQIKAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNIYNK--VASIEADGDTATGINIVLRAIEEPVRQIAHNAGLE-GSVIVERLKGEAVGTGFNAATGEWVNMLDTGIVDPTKVTRSALQNASSVAAMFLTTEAVVAD--KPEEGGAPAMPD 532
>gi|145635376|ref|ZP_01791078.1| chaperonin GroEL [Haemophilus influenzae PittAA] >gi|145267382|gb|EDK07384.1| chaperonin GroEL [Haemophilus influenzae PittAA] (545 aa)
Score = 1372, Expect = 1.8e-149, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|42630824|ref|ZP_00156363.1| COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influenzae R2866] >gi|145628924|ref|ZP_01784724.1| chaperonin GroEL [Haemophilus influenzae 22.1-21] >gi|145638547|ref|ZP_01794156.1| chaperonin GroEL [Haemophilus influenzae PittII] >gi|145640516|ref|ZP_01796100.1| chaperonin GroEL [Haemophilus influenzae R3021] >gi|148825183|ref|YP_001289936.1| chaperonin GroEL [Haemophilus influenzae PittEE] >gi|166198464|sp|A5U9V2|CH60_HAEIE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|144979394|gb|EDJ89080.1| chaperonin GroEL [Haemophilus influenzae 22.1-21] >gi|145272142|gb|EDK12050.1| chaperonin GroEL [Haemophilus influenzae PittII] >gi|145275102|gb|EDK14964.1| chaperonin GroEL [Haemophilus influenzae 22.4-21] >gi|148715343|gb|ABQ97553.1| chaperonin GroEL [Haemophilus influenzae PittEE] (548 aa)
Score = 1372, Expect = 1.8e-149, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|42629991|ref|ZP_00155536.1| COG0459: Chaperonin GroEL (HSP60 family) [Haemophilus influenzae R2846] (551 aa)
Score = 1372, Expect = 1.8e-149, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|47121795|gb|AAT11556.1| chaperonin 60 [Cytophaga sp. FIRDI-133-V546] (546 aa)
Score = 1372, Expect = 1.8e-149, Identities = 300/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           M KE+KFS+ AR  +  GV +L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G++K V   V EL   SK I  K+ I QVA ISA +D ++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LENPYILITDKK+S+I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI+ LTGG  +T+++G+     T+  LG+A  VV+ K+++TIV G G  ++I  R+ +I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV++  +  V  +   GDE  G  IV+ AI  P+ QI  NAG +  V+I E LK     +GFNAA+GK+V+M +TGI+DP KVTR ALQNA SV++M LTTEAV+ D
  S:     1 MVKEMKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQALIREGLKNVTAGANPVGLRKGIEKAVAVAVEELKAISKPIEGKESIAQVAAISA-ADDEVGQLIAEAMERVGNDGVITLEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITDKKISNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISTLTGGEVITEEIGLDLKSSTIDQLGRAAKVVVTKEHTTIVSGAGNPAEIDARVKQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNIYNK--VAGVEAEGDEATGINIVLRAIEEPVRQIAHNAGLEGSVII-ERLKNEAVGVGFNAASGKWVNMIETGIVDPTKVTRSALQNAASVAAMFLTTEAVVAD 520
>gi|59802396|ref|YP_209108.1| chaperonin GroEL [Neisseria gonorrhoeae FA 1090] >gi|66774042|sp|Q5F541|CH60_NEIG1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|59719291|gb|AAW90696.1| chaperonin 60 kDa subunit [Neisseria gonorrhoeae FA 1090] (544 aa)
Score = 1372, Expect = 1.9e-149, Identities = 292/537 (54%), Positives = 411/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+T++ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM   G++DP KVTR ALQ+A S++ ++LTT+ +I ++ ++K    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTVIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIGMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEEK----PAVPD 533
>gi|16077670|ref|NP_388484.1| chaperonin GroEL [Bacillus subtilis subsp. subtilis str. 168] >gi|116230|sp|P28598|CH60_BACSU 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Stress protein H5) >gi|143027|gb|AAA22503.1| heat shock protein >gi|143063|gb|AAA22531.1| heat shock protein >gi|2521994|dbj|BAA22747.1| chaperonin [Bacillus subtilis] >gi|2632916|emb|CAB12422.1| class I heat-shock protein (chaperonin) [Bacillus subtilis subsp. subtilis str. 168] (544 aa)
Score = 1372, Expect = 2.1e-149, Identities = 301/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++GM++ V   +  L + SK I  K+ I QVA ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A L+NPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIA+LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   +I  R+++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V  +  V  +   GD + G  IV+ A+  PI QI  NAG + G VI E LK     +GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D
  S:     1 MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGMEQAVAVAIENLKEISKPIEGKESIAQVAAISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVITEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYNK--VAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGFNAATGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVAD 520
>gi|170696124|ref|ZP_02887259.1| chaperonin GroEL [Burkholderia graminis C4D1M] >gi|170138939|gb|EDT07132.1| chaperonin GroEL [Burkholderia graminis C4D1M] (546 aa)
Score = 1372, Expect = 2.1e-149, Identities = 290/527 (55%), Positives = 408/527 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR+KL  GV  L +AVKVT+GP+GRNV++++S+G+P++TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A ++EL K S+      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K ++DEL VVEG+QFDRGY+SPYF+ D +K +A L+NP++L+ DKKVS+I+D+LP+LE++ K GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G+S +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+T IE   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I+     +  D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + T  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +++   D
  S:     3 AKEIIFSDVARSKLVEGVNILANAVKVTLGPKGRNVVLERSFGSPIVTKDGVSVAKEIELPDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVIAAIDELKKISRPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPFVLLHDKKVSNIRDLLPVLEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLSLEKATLAELGQAKRIEVGKENTTVIDGAGDSKNIEARVKQIRTQIEEASSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVKQAISA-LKGVNADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGTG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVHEAPKD 527
>gi|85373658|ref|YP_457720.1| chaperonin GroEL [Erythrobacter litoralis HTCC2594] >gi|123409666|sp|Q2NBL8|CH601_ERYLH 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|84786741|gb|ABC62923.1| heat shock protein [Erythrobacter litoralis HTCC2594] (539 aa)
Score = 1372, Expect = 2.1e-149, Identities = 294/538 (54%), Positives = 413/538 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AKE+KF+  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ++++VASK  D+AGDGTTTATVLA  + +EG + V +G NPI++KRG+D  V  +V +L   +KK++   EI QVATISAN D+ +G  +A AM+KVG++GVITVEEAK +  EL  VEGMQFDRGY+SPYFVT+T K+  +LE+PYILI +KK+S+++ ++P+LE+++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LED+AILT G+ V+++LG   + VT+  LG+A+ V+IDKDN+TIV G G ++ I  R+S+I+  IE T SDYD++ L+ R+AKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ +   N   D++ G  IV  A+ +P  QI  NAG D   ++ ++L+  + + GFNAATG+Y D+ ++G+IDP KV R ALQ+A SV+S+L+TTEA++ ++   KED+   MP M
  S:     3 AKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELKDKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPIDLKRGIDLAVGTVVKDLESHAKKVSANSEIAQVATISANGDETVGRFLAEAMDKVGNEGVITVEEAKSLETELETVEGMQFDRGYLSPYFVTNTEKLKVELEDPYILIHEKKLSNLQALIPLLEQVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDVAILTAGNVVSEELGTKLENVTIGMLGRAKKVIIDKDNTTIVDGAGNKADIDARVSQIRAQIETTTSDYDREKLQERVAKLAGGVAVIRVGGATEVEVKERKDRVDDALHATRAAVEEGILPGGGIALLRALKSLDGLKAAN--DDQQSGIDIVRRALRAPARQIAENAGEDGAYIVGKLLEGDDYNHGFNAATGEYEDLVKSGVIDPAKVVRTALQDAASVASLLITTEALVAELP--KEDTPAPMPAM 537
>gi|149185484|ref|ZP_01863800.1| chaperonin GroEL [Erythrobacter sp. SD-21] >gi|148830704|gb|EDL49139.1| chaperonin GroEL [Erythrobacter sp. SD-21] (549 aa)
Score = 1372, Expect = 2.2e-149, Identities = 303/537 (56%), Positives = 403/537 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK++KF   AR  +  GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGV+VAKE++L +  ENMGAQ++K+VASK+ D AGDGTTTATVLA  +  EG+++V +G NP+++KRG+D  V  +V  L   SK ++   EI QV  ISAN D+++GE IA AMEKVG +GVITV+E+KG+  EL  VEGMQFDRGY+SPYF+T+  KM  +LENPYILI +KK+S+++ +LP+LE  +++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +L+DI+ILT G  +++DLGI  + VTL  LG+A+ V IDKDN+TIV G G E  IK R+S+I+T I+ T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++ SK ++     L G   D+  G  IV  A+ +P+ QI +NAG D  VV  ++  + + +LGFNAAT  Y ++   G+IDP KV R ALQNA SV+ +L+TTEA + D  +DK  S PAMP+
  S:     3 AKDVKFGRDAREGIQRGVDTLANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELKDKFENMGAQMLKEVASKSNDAAGDGTTTATVLAQSIVTEGMKSVAAGMNPMDLKRGIDLAVEKVVENLKSRSKDVSGSSEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDESKGLEFELETVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSNLQAMLPVLEAAVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLQDISILTKGEMISEDLGIKLENVTLGMLGEAKRVTIDKDNTTIVDGAGSEDDIKARVSEIRTQIDNTSSDYDREKLQERLAKLAGGVAVIKVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYASKALD----GLSGGNDDQTRGIDIVRRALTAPVRQIATNAGHDGAVVSGKLTDSNDENLGFNAATDTYENLVSAGVIDPTKVVRTALQNAASVAGLLITTEAAVVDKPEDKS-SAPAMPD 537
>gi|119944606|ref|YP_942286.1| chaperonin Cpn60, GroEL, large subunit of GroESL [Psychromonas ingrahamii 37] >gi|187470779|sp|A1ST72|CH601_PSYIN 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|119863210|gb|ABM02687.1| chaperonin Cpn60, GroEL, large subunit of GroESL [Psychromonas ingrahamii 37] (544 aa)
Score = 1371, Expect = 2.2e-149, Identities = 302/524 (57%), Positives = 397/524 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           M+KEIKF + +R+K+ NGV  L DAVK+T+GP+GRNV+I KSYGAP ITKDGV+VAKE++L +  ENMGAQ+VKDVAS+T D AGDGTTTATVLA  +  +GL+ V +G NP+++KRG+D+TV A V EL K S   +    I QV TISANSD +IGE+IA AM+KVG+ GVITVEE +G+  EL VVEGMQFDRGY+SPYF+T+      +LENPYIL+ DKK+ +I+++LP LE + K  +PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA LTGG+ +++++G+  +KV L+DLGQA+ VVI+KD +TI+ G G ES I  R+S+IK  IE + SDYDK+ L+ R AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEG+V GGG ALV V+  +      L G   D+ +G ++ + A+ +P+ QIV N G +  VV N + +    + G+NA TG+Y DM + GIIDP KV R ALQ A SV+++++TTE +I D
  S:     1 MSKEIKFGNDSRSKMLNGVNILADAVKITLGPKGRNVVIDKSYGAPQITKDGVTVAKEIELEDKFENMGAQMVKDVASQTNDAAGDGTTTATVLAQAIIADGLKAVAAGMNPMDLKRGIDQTVKAAVAELKKLSTPCSDSKAITQVGTISANSDHEIGEIIAQAMQKVGNQGVITVEEGQGLETELDVVEGMQFDRGYLSPYFMTNHESGTVELENPYILLVDKKIGNIRELLPTLEAVAKASKPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGLDMEKVQLEDLGQAKRVVINKDETTIIDGIGDESVINARVSQIKQQIEASTSDYDKEKLQERSAKLAGGVAVIKVGASTEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALVRVAAILK----GLTGENEDQNVGIRVALRAMEAPLRQIVENCGEEASVVANNVRQGEGNY-GYNATTGEYGDMLEMGIIDPTKVARSALQFAASVAALMITTECMITD 522
>gi|148556278|ref|YP_001263860.1| chaperonin GroEL [Sphingomonas wittichii RW1] >gi|166201753|sp|A5VBQ6|CH60_SPHWW 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|148501468|gb|ABQ69722.1| chaperonin GroEL [Sphingomonas wittichii RW1] (549 aa)
Score = 1371, Expect = 2.3e-149, Identities = 305/536 (56%), Positives = 398/536 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AK++KFS  AR ++  GV  L DAVKVT+GP+GRNV+I KS+GAP ITKDGV+VAKE++L +  EN+GAQLV++VASKT D AGDGTTTATVLA  + +EGL++V +G NP+++KRG+D  V  +V  L   SK +A  +E+ QV  ISAN DK++GE IA AM+KVG +GVITVEEAKG+  EL VVEGMQFDRGY+SPYF+T+  KM  +L +PYILI +KK+S+++ ILPILE ++++GRPLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  +++DLGI  + VT+  LG A+ V IDKDN+TIV G G    IK R+  I+  IE+T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++ +K ++        D+  G  I+  AI +P+ QI  NAG D  VV   +L+  +   GFNAAT  Y ++   G+IDP KV R ALQ+A SV+ +L+TTEA I ++ +DK    PAMP
  S:     3 AKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELKDKFENIGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGLKSVAAGMNPMDLKRGIDLAVTKVVENLKARSKPVAGSNEVAQVGIISANGDKEVGEKIAEAMDKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMQVELTDPYILIHEKKLSNLQSILPILEAVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTNGELISEDLGIKLENVTIGMLGTAKRVTIDKDNTTIVDGAGAADAIKGRVEAIRKQIEITTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYATKALD-GLKGANDDQTRGIDIIRRAISAPVKQIAQNAGQDGAVVAGNLLRENDETKGFNAATDVYENLVAAGVIDPTKVVRTALQDAASVAGLLITTEATIAELPEDK---APAMP 534
>gi|194565922|ref|YP_002100944.1| Chaperonin GroEL [Burkholderia dolosa AUO158] >gi|124899582|gb|EAY71425.1| Chaperonin GroEL [Burkholderia dolosa AUO158] (546 aa)
Score = 1371, Expect = 2.4e-149, Identities = 291/527 (55%), Positives = 404/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE+ L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A V+EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++ENPYIL+ DKK+S+I+D+LP+LE++ K+GRPLLI+A+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  I+   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V   I  +      D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + +  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A ++D   D
  S:     3 AKEITFSDVARAKLTEGVNVLANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIGLADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVAAAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIVAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIDEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRHAIR-DLKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGSG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFDAPKD 527
>gi|145630276|ref|ZP_01786057.1| chaperonin GroEL [Haemophilus influenzae 22.4-21] >gi|144984011|gb|EDJ91448.1| chaperonin GroEL [Haemophilus influenzae R3021] (548 aa)
Score = 1371, Expect = 2.4e-149, Identities = 299/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETSKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTTGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|118581209|ref|YP_902459.1| chaperonin GroEL [Pelobacter propionicus DSM 2379] >gi|166201739|sp|A1AST1|CH60_PELPD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|118503919|gb|ABL00402.1| chaperonin GroEL [Pelobacter propionicus DSM 2379] (554 aa)
Score = 1371, Expect = 2.4e-149, Identities = 303/521 (58%), Positives = 397/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AK IKF    RN +  GV  L D VKVT+GP+GRNV+I KS+GAP+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+DK V  IV EL K SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK ++  L  VEGMQFDRGY+SPYFVTD  +M A LEN  ILI DKK+S++KD+LPILE+  K+GRPLLIIA+D++GEAL TLVVNK+RGV NV AVKAP FGD+RK +LEDIA LTGG  +++++G   ++ T+  LG+A+ + IDKDN+TI+ G+G E+ I+ R+ +I+  IE T SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA++EG+V GGG A +     +  + LNL  +++ G  +V  A+ +PI QI  NAG D  +V++++    +   G++AA+ +YVDM + GIIDP KV+R ALQNA S++ ++LTTEA+I
  S:     3 AKIIKFDQEGRNAILKGVNILADTVKVTLGPKGRNVVIDKSFGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGIDKAVETIVAELQKISKPIVDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKSMDTTLETVEGMQFDRGYLSPYFVTDPERMEAALENALILIHDKKISNMKDLLPILEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVAAVKAPGFGDRRKAMLEDIATLTGGLVISEEVGHKLEQATMDMLGRAKRITIDKDNTTIIDGEGKEADIQGRVKQIRAQIEETTSDYDKEKLQERLAKLVGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVDEGVVPGGGVAYIRTLSAL--DNLNLENEQQFGVTVVKLALEAPIRQIADNAGIDASIVVDKVRNGKDA-FGYDAASDEYVDMLKAGIIDPTKVSRSALQNASSIAGLMLTTEALI 520
>gi|20807076|ref|NP_622247.1| chaperonin GroEL [Thermoanaerobacter tengcongensis MB4] >gi|25452851|sp|Q8R5T7|CH60_THETN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|20515566|gb|AAM23851.1| Chaperonin GroEL (HSP60 family) [Thermoanaerobacter tengcongensis MB4] (540 aa)
Score = 1371, Expect = 2.5e-149, Identities = 301/535 (56%), Positives = 402/535 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           MAK+IK+ + AR  L  GV  + + VKVT+GPRGRNV++ K YG P +T DGV++A+E++L +P EN GAQL+K+ A+KT D AGDGTTTAT+LA  +  EGL+N+ +GANP+ ++RGM K V A V  L + SK I  K+ I  VA ISA +D++IG+LIA AMEKVG DGVITVEE+K I   L VVEGMQFDRGYISPY VTD  KM A LE P ILITDKK+SS++D+LP+LE+I++ G+ LLIIADDV+GEAL TLVVNK+RG F+ VAVKAP FGD+RK++L+DIAILTGG  ++++LG     VTL  LG+A  V + K+++TIV G G    IK+RI++IK  IE T SDYD++ L+ RLAKL  GVAVI+VGA +E ELKEKK R++DAL+ATKAA+EEGIV GGG AL++V + +     +L GD K G +IV+ A+ +P+ QI  NAG D  +++ +I  A +P+ G++A   ++ DM + GIIDP KVTR ALQNA S++SM+LTTEA++ DV + ++ ++P 
  S:     1 MAKQIKYGEEARKALERGVNAVANTVKVTLGPRGRNVVLDKKYGTPTVTNDGVTIAREIELEDPFENQGAQLLKEAATKTNDVAGDGTTTATLLAQVMVLEGLKNLAAGANPMLLRRGMAKAVEAAVEGLRRISKPIDNKESIAHVAAISA-ADEEIGQLIAEAMEKVGKDGVITVEESKTIGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSSVQDLLPLLEQIVQHGKKLLIIADDVEGEALATLVVNKLRGTFSCVAVKAPGFGDRRKEMLQDIAILTGGQVISEELGYDLKDVTLDMLGRARQVKVTKEHTTIVGGAGNPEDIKKRINQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQVGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGVALLNVIEDVQKVVDSLEGDFKTGAKIVLKALEAPVRQIAENAGVDGSIIVEKIKAAKDPNFGYDAYREEFTDMIKRGIIDPTKVTRTALQNAASIASMILTTEAIVVDVPEKEKSNIPG 534
>gi|2493642|sp|Q60024|CH60_THEBR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|1326191|gb|AAB00559.1| chaperonin 60 (541 aa)
Score = 1371, Expect = 2.6e-149, Identities = 300/542 (55%), Positives = 405/542 (74%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMG 542
           MAK+IK+ + AR  L  GV  + D VKVT+GPRGRNV++ K YG+P +T DGV++A+E++L +P EN GAQL+K+ A+KT D AGDGTTTAT+LA  + +EGL+N+ +GANP+ ++RG+ K V+A V  L + SK I  K+ I  VA+ISA +D++IG+LIA AM+KVG DGVITVEE+K +   L VVEGMQFDRGYISPY VTD  KM A LE P ILITDKK+S+I+D+LP+LE+I++ G+ LLIIADDV+GEAL TL+VNK+RG F  VAVKAP FGD+RK++L+DIAILTGG  ++++LG     V L  LG+A  V + K+ +TIV G G  S+IK+R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+ GA +E ELKEKK R++DAL+ATKAA+EEGIV GGG AL++V + +     +L GD K G +IV+ A+  P+ QI +NAG D  V++ +I  A +P+ G++A   ++ DMF+ GI+DP KVTR ALQNA S++SM+LTTEA++ D+ +        MPN G G
  S:     1 MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIELEDPFENQGAQLLKEAATKTNDIAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIAKAVDAAVEGLKRISKPIDNKESIAHVASISA-ADEEIGKLIAEAMDKVGKDGVITVEESKTLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKISNIQDLLPLLEQIVQQGKKLLIIADDVEGEALATLIVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVISEELGYDLKDVRLDMLGRARQVKVTKEYTTIVGGAGDPSEIKKRVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLNVIEDVQKVVDSLEGDFKTGAKIVLRALEEPVRQIATNAGVDGSVIVEKIKAAKDPNFGYDAYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAIVVDIPEKNT----GMPNPGAG 537
>gi|37701749|gb|AAR00651.1| GroEL [Enterococcus cecorum] (526 aa)
Score = 1371, Expect = 2.7e-149, Identities = 303/524 (57%), Positives = 399/524 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKF++ AR  +  GV +L D VKVT+GP+GRNV+++KS+G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  S  +  K+ I QV  +S+ S++ +G  IA+AMEKVG+DGVIT+EE+KGI  EL VVEGMQFDRGY+S Y VTD +KM A LENPYIL TDKK+S+I++ILP+LE+I++  +PLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+     TLQ LGQA  VV++KD +TIV+G G    I  R+  IK  I  T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE K R++DAL+AT+AA+EEG+V GGG ALV+V  ++        GD   G +IV+ A+  P+ QI  NAG++  V+++  LK     +GFNAATG++V+M + GI+DP KVTR ALQNA SV+++LLTTEAV+ D
  S:     1 MAKEIKFAEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPLGIRRGIELATKAAVEELHNISAIVDSKEAIAQVGAVSSGSEQ-VGNYIADAMEKVGNDGVITIEESKGIETELEVVEGMQFDRGYLSQYMVTDNDKMEAVLENPYILTTDKKISNIQEILPLLEQILQQSKPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATLQSLGQASKVVVNKDTTTIVEGAGDSENIAARVQIIKGQIAETTSDFDREKLQERLAKLAGGVAVIKVGAPTETELKEMKLRIEDALNATRAAVEEGMVSGGGTALVNVINKVAEAESKETGDVATGVRIVLRALEEPVRQIAENAGYEGSVIVDR-LKKEKLGVGFNAATGEWVNMLEAGIVDPTKVTRSALQNAASVAALLLTTEAVVAD 522
>gi|119946138|ref|YP_943818.1| chaperonin Cpn60, GroEL, large subunit of GroESL [Psychromonas ingrahamii 37] >gi|187470712|sp|A1SXK4|CH602_PSYIN 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|119864742|gb|ABM04219.1| chaperonin Cpn60, GroEL, large subunit of GroESL [Psychromonas ingrahamii 37] (544 aa)
Score = 1371, Expect = 2.8e-149, Identities = 301/524 (57%), Positives = 397/524 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           M+KEIKF + +R+K+ NGV  L DAVK+T+GP+GRNV+I KSYGAP ITKDGV+VAKE++L +  ENMGAQ+VKDVAS+T D AGDGTTTATVLA  +  +GL+ V +G NP+++KRG+D+TV A V EL K S   +    I QV TISANSD +IGE+IA AM+KVG+ GVITVEE +G+  EL VVEGMQFDRGY+SPYF+T+      +LENPYIL+ DKK+ +I+++LP LE + K  +PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA LTGG+ +++++G+  +KV L+DLGQA+ +VI+KD +TI+ G G ES I  R+S+IK  IE + SDYDK+ L+ R AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEG+V GGG ALV V+  +      L G   D+ +G ++ + A+ +P+ QIV N G +  VV N + +    + G+NA TG+Y DM + GIIDP KV R ALQ A SV+++++TTE +I D
  S:     1 MSKEIKFGNDSRSKMLNGVNILADAVKITLGPKGRNVVIDKSYGAPQITKDGVTVAKEIELEDKFENMGAQMVKDVASQTNDAAGDGTTTATVLAQAIIADGLKAVAAGMNPMDLKRGIDQTVKAAVAELKKLSTPCSDSKAITQVGTISANSDHEIGEIIARAMQKVGNQGVITVEEGQGLETELDVVEGMQFDRGYLSPYFMTNHESGTVELENPYILLVDKKIGNIRELLPTLEAVAKASKPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGLDMEKVQLEDLGQAKRIVINKDETTIIDGIGDESVINARVSQIKQQIEASTSDYDKEKLQERSAKLAGGVAVIKVGASTEVEMKEKKDRVDDALHATRAAVEEGVVAGGGVALVRVAAILK----GLTGENEDQNVGIRVALRAMEAPLRQIVENCGEEASVVANNVRQGEGNY-GYNATTGEYGDMLEMGIIDPTKVARSALQFAASVAALMITTECMITD 522
>gi|444101|prf||1906220B groEL gene (544 aa)
Score = 1371, Expect = 2.8e-149, Identities = 300/524 (57%), Positives = 403/524 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++GM++ V   +  L + SK I  K+ I QVA ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A L+NPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIA+LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   +I  R+++I+  +E T S++D++ L+ RLAKL  GV VIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V  +  V  +   GD + G  IV+ A+  PI QI  NAG + G VI E LK     +GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D
  S:     1 MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGMEQAVALAIENLKEISKPIEGKESIAQVAAISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYLVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVITEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFDREKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYNK--VAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGFNAATGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVAD 520
>gi|438187|emb|CAA80551.1| heat-shock protein [Neisseria gonorrhoeae] (541 aa)
Score = 1371, Expect = 2.8e-149, Identities = 293/537 (54%), Positives = 411/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RGV   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+T++ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D++ G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM   G+ DP KVTR ALQ+A S++ ++LTT+ +I ++ ++K    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGIKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGVLKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTVIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQEAGVQIVLRAVESPVRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIGMGVHDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEEK----PAVPD 533
>gi|153004338|ref|YP_001378663.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5] >gi|187470730|sp|A7HAD3|CH601_ANADF 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|152027911|gb|ABS25679.1| chaperonin GroEL [Anaeromyxobacter sp. Fw109-5] (547 aa)
Score = 1371, Expect = 2.9e-149, Identities = 299/534 (55%), Positives = 404/534 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAAL---VHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AKEI F   AR  +  GVQ L +AV VT+GP+GRNV+I+KS+G+P ITKDGV+VAKE+++ N  ENMGAQ+V++VAS+T+D+AGDGTTTATVLA  +F+EGL+ V +G NP+++KRG+D+ V  IV EL K SK    K +I QV TISAN D+ IG +IA AMEKVG +GVITVEEAKG+   L VVEGMQFDRGY SPYFVT+ ++M A LE+P+ILIT+KK+S++ D++P+LE++ ++G+PLLI+A+DV+GEAL TLVVNK+RG  +V AVKAP FGD+RK++L+DIA LTGG+ V ++LGI  +++T++DLG+A+ + IDK+N+TIV G+G    I+ RI +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG A    +   K++ V      GD++ G  IV  A+  P  +I  NAG+D  VV++ I      H GFNAA+  + D+ + G+IDP KV+R ALQNA SV+S+LLTTEA++   +  K+   PA
  S:     3 AKEIAFHQGAREAILRGVQTLAEAVAVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIEVENKFENMGAQMVREVASQTSDKAGDGTTTATVLARALFEEGLKLVAAGHNPMDLKRGIDRAVEVIVAELKKLSKPTQGKKDIAQVGTISANGDETIGNIIAEAMEKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYSSPYFVTNPDRMEAVLEDPFILITEKKISAMADLIPVLEQVARSGKPLLIVAEDVEGEALATLVVNKLRGTLHVCAVKAPGFGDRRKEMLKDIATLTGGNVVAEELGIKLEQLTVKDLGRAKRITIDKENTTIVDGEGKREDIEARIKQIRAQIEETTSDYDREKLQERLAKLVGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVAYLRALQALKKLEVPE----GDQRFGVAIVQKALEYPARRIAENAGWDGAVVVSRINDGKAAH-GFNAASEVFEDLEKAGVIDPTKVSRTALQNAASVASLLLTTEAMV--AEKPKKKGAPA 532
>gi|3599924|gb|AAC36500.1| GroEL/HSP60 homolog [Lawsonia intracellularis] (548 aa)
Score = 1370, Expect = 2.9e-149, Identities = 304/529 (57%), Positives = 396/529 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           +KEI F   AR KL  GV +L +AVKVT+GP+GRNV+I+KS+G+PVITKDGVSVAKE++L +  ENMGAQ+VK+VA KT+D AGDGTTTATVLA  +++EG++ V +G NP+ IKRG+DK V A+  EL+  +K    + EI QV TISANSD  IG +IA AM KVG  GVITVEEAKG+   L VVEGM+FDRGY+SPYFVT+  KM+ +L+NPYIL  +KK++S+KD+LPILE++ K  RPLLIIA+DV+GEAL TLVVNK+RG   VVAVKAP FG++RK +LEDIAILTGG  + +D GI  + V+L  LG A+ VVIDK+N+TIV G G    IK R+ +I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKKDRV+DAL+AT+AA+EEGIV GGG A V   K ++ +      DE  G  I+  ++  P+ QI +NAG++  +V+ ++ +      GFNAA+G+Y D+ + G+IDP KVTRIALQNA SV+S+LLTTE  I +  + K+
  S:     3 SKEILFDAKAREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVAPKTSDIAGDGTTTATVLAQAIYREGVKLVAAGRNPMAIKRGIDKAVVAVTKELSDITKPTRDQKEIAQVGTISANSDTTIGNIIAEAMAKVGKGGVITVEEAKGLETTLDVVEGMKFDRGYLSPYFVTNPEKMVCELDNPYILCNEKKITSMKDMLPILEQVAKVNRPLLIIAEDVEGEALATLVVNKLRGALQVVAVKAPGFGERRKAMLEDIAILTGGEAIFEDRGIKLENVSLSSLGTAKRVVIDKENTTIVDGAGKSEDIKARVKQIRAQIEETSSDYDREKLQERLAKLVGGVAVIHVGAATETEMKEKKDRVEDALNATRAAVEEGIVPGGGTAFVRSIKVLD-DIKPADDDELAGLNIIRRSLEEPLRQIAANAGYEGSIVVEKV-REPKDGFGFNAASGEYEDLIKAGVIDPKKVTRIALQNAASVASLLLTTECAIAEKPEPKK 529
>gi|167587510|ref|ZP_02379898.1| chaperonin GroEL [Burkholderia ubonensis Bu] (540 aa)
Score = 1370, Expect = 2.9e-149, Identities = 301/538 (55%), Positives = 406/538 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLN-LIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AK+++F DSAR ++  GV  L DAVKVT+GP+GRNVLI++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL K SK I+   EI QV +ISAN+D+ IG++IA+AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K  A L++  IL+ DKK+SSI+D+LP+LE   K G+PLLIIA+DVDGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G    K TL+DLG+A+ V + KD++ I+ G G E +I+ R+  I+T IE   SDYD++ L+ R+AKL  GVAVIKVGA +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+    R  V +L     D+  G  IV+ A+ +P+  I SNAG +  VVI ++L+    + G+NAATG+Y D+ + G++DP KVTR ALQNA S++ ++LTT+A + +   D++    A P +
  S:     3 AKDVRFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADETIGKIIADAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISSIRDLLPVLEATSKAGKPLLIIAEDVDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEEAGKQLQKATLEDLGRAKRVEVRKDDTIIIDGSGDEKRIEARVKSIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEIEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLRA--RSAVTSLKGANSDQDAGVHIVLRALEAPLRVIASNAGDEPSVVIAKVLEGKG-NFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVAEAPKDEKPVQSATPEL 538
>gi|29655007|ref|NP_820699.1| chaperonin GroL [Coxiella burnetii RSA 493] >gi|153209043|ref|ZP_01947222.1| chaperonin GroL [Coxiella burnetii 'MSU Goat Q177'] >gi|154706878|ref|YP_001423710.1| chaperonin GroL [Coxiella burnetii Dugway 5J108-111] >gi|189082348|sp|A9KC15|CH60_COXBN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116236|sp|P19421|CH60_COXBU 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat shock protein B) >gi|144998|gb|AAA23309.1| heat shock protein B (htpB) >gi|29542276|gb|AAO91213.1| chaperonin, 60 kDa [Coxiella burnetii RSA 493] >gi|120575525|gb|EAX32149.1| chaperonin GroL [Coxiella burnetii 'MSU Goat Q177'] >gi|154356164|gb|ABS77626.1| chaperonin GroL [Coxiella burnetii Dugway 5J108-111] (552 aa)
Score = 1370, Expect = 2.9e-149, Identities = 295/533 (55%), Positives = 405/533 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK +KFS    + +  GV+ L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +  EG++ VI+G NP+++KRG+DK V A V EL K SK    +  I QV TISANSDK IG++IA AMEKVG +GVITVE+  G+ + L VVEGMQFDRGY+SPYF+ +   M A+LENP+IL+ DKK+S+I++++P+LE + K+GRPLL+IA+D++GEAL TLVVN +RGV  V AVKAP FGD+RK +L+DIA+LTGG  +++++G+S +  +L DLG A+ VV+ KD++TI+ G G    IK R+ +I+  IE + SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+ V K ++ V   N   D+++G +I   A+  P+SQIV N G    VV +++L   + + G+NAATG+Y DM + GI+DP KVTR ALQNA S++ +++TTE ++ +    KE+S+P
  S:     3 AKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGIDKAVTAAVAELKKISKPCKDQKAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDGSGLENALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNIRELIPLLENVAKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVEN--EDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMP 534
>gi|170746968|ref|YP_001753228.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831] >gi|170653490|gb|ACB22545.1| chaperonin GroEL [Methylobacterium radiotolerans JCM 2831] (546 aa)
Score = 1370, Expect = 3.0e-149, Identities = 303/523 (57%), Positives = 405/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPH-LGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK+++FS  AR+K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+D    A V ++   +KK++  DE+ QV TISAN DK+IGE+IA+AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+  KM+A+LE+PYILI +KK+SS++ +LP+LE +++TG+PLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  + +DLGI  + VTL  LG+A+ V I+K+N+TI+ G G +S I+ RIS+IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL+AT+AA+EEGIV GGG AL+   K +     + I D + G +IV+ A+ +P+ QI  NAG +  +V+ +I   T+    GFNA T +YVDM Q GI+DP KV R ALQ+A SV+ +L+TTEA++ D
  S:     3 AKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGIDLATQAAVKDIIARAKKVSTSDEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMVAELEDPYILIHEKKLSSLQAMLPVLEAVVQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQMIAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGVGEKSDIEGRISQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALLRAKKAV-AELKSDIPDVQAGIKIVLKALEAPLRQIAQNAGVEGSIVVGKITDNTSSETFGFNAQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVAD 525
>gi|16272487|ref|NP_438701.1| chaperonin GroEL [Haemophilus influenzae Rd KW20] >gi|1168916|sp|P43733|CH60_HAEIN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|1573528|gb|AAC22201.1| heat shock protein (groEL) [Haemophilus influenzae Rd KW20] (548 aa)
Score = 1370, Expect = 3.1e-149, Identities = 298/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GR+V++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+NAG +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRHVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNAGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|116492224|ref|YP_803959.1| chaperonin GroEL [Pediococcus pentosaceus ATCC 25745] >gi|122266312|sp|Q03H05|CH60_PEDPA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|116102374|gb|ABJ67517.1| Chaperonin GroEL (HSP60 family) [Pediococcus pentosaceus ATCC 25745] (539 aa)
Score = 1370, Expect = 3.1e-149, Identities = 303/528 (57%), Positives = 405/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAKEIKFS+ AR K+  GV +L D VK T+GP+GRNV++++SYG+P IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++K  +  V  L+K S ++  KD+I Q+A+IS+ ++ ++G+LIANAMEKVG+DGVIT+EE++G++  L VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+ +I+DILP+L+ +++  R LLIIADD+ GEAL TLV+NKMRG FNVVAVKAP FGD+RK+ LEDIAILTGG+ +TDDLG++   VT++ LGQ+  V + KD++TIV+G G + QI ER+  IK  I  T SD+DK+ L+ RLAKL+ GVAVI+VGA +E ELKEKK R++DAL+AT+AA+EEG V GGG AL +V    ++  +   GDE  G  IV  A+  P+ QI  NAG ++G VI   LK   P +G+NAA  ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D+ +D
  S:     1 MAKEIKFSEDARTKMLKGVDKLADTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIEKATSKAVEALHKMSHEVKTKDDIAQIASISS-ANPEVGKLIANAMEKVGNDGVITIEESRGVDTTLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIGNIQDILPVLQSVVEQSRSLLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKEQLEDIAILTGGTVITDDLGLNLKDVTIEQLGQSNKVTVTKDDTTIVEGAGSQEQIAERVGIIKQQISETTSDFDKEKLQERLAKLSGGVAVIRVGAATETELKEKKYRIEDALNATRAAVEEGFVPGGGTALANVIS--DLEDVEAEGDEATGVNIVRRALEEPVRQIAENAG-EEGSVIVTKLKGQKPGVGYNAANDEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADLPED 524
>gi|152980643|ref|YP_001354342.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille] >gi|166198468|sp|A6T1E5|CH60_JANMA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|151280720|gb|ABR89130.1| chaperonin GroEL (Hsp60) [Janthinobacterium sp. Marseille] (548 aa)
Score = 1370, Expect = 3.1e-149, Identities = 290/528 (54%), Positives = 401/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+ F D+AR K+  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L + ++NMGAQLVK+VAS+T+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A V +L   +K      EI QV +ISANSD  IGE IA AMEKVG +GVITVE+ K +NDEL +VEGMQFDRGY+SPYF+ +  K  A LENP+IL+ DKK+S+I+D+LP+LE++ K GRPLLIIA+D++GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAIL+GG  V +++G++ +K+TL++LGQA+ + I K+N+T++ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+     I +   N   D++ G +IV+ A+  P+  IV NAG +  VV+ ++L+    + G+NAA G Y DM + G++DP KVTR ALQNA S++++LLTT+ ++ +V +DK
  S:     3 AKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVAATVEQLAAIAKPCTTTKEIAQVGSISANSDASIGERIAEAMEKVGKEGVITVEDGKSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQVAKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQVVAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAVTIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRARAAIKIKGDN--PDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGKG-NFGYNAANGTYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEDK 527
>gi|30142092|gb|AAP13856.1| heat shock protein B [Coxiella burnetii] (552 aa)
Score = 1370, Expect = 3.3e-149, Identities = 296/533 (55%), Positives = 404/533 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK +KFS    + +  GV+ L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T+D+AGDGTTTATVLA  +  EG++ VI+G NP+++KRG+DK V A V EL K SK    +  I QV TISANSDK IG++IA AMEKVG +GVITVE+  G+ + L VVEGMQFDRGY+SPYF+ +   M A+LENP+IL+ DKK+S+I++++P+LE I K+GRPLL+IA+D++GEAL TLVVN +RGV  V AVKAP FGD+RK +L+DIA+LTGG  +++++G+S +  +L DLG A+ VV+ KD++TI+ G G    IK R+ +I+  IE + SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+ V K ++ V   N   D+++G +I   A+  P+SQIV N G    VV +++L   + + G+NAATG+Y DM + GI+DP KVTR ALQNA S + +++TTE ++ +    KE+S+P
  S:     3 AKVLKFSHEVLHAMSRGVEVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGIDKAVTAAVAELKKISKPCKDQKAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDGSGLENALEVVEGMQFDRGYLSPYFINNQQNMSAELENPFILLVDKKISNIRELIPLLENIAKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGFGDRRKAMLQDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRKEIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRVLKSLDSVEVEN--EDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASTAGLMITTECMVTEAPKKKEESMP 534
>gi|23451133|gb|AAN32671.1|AF417583_2 GroEL [Enterococcus avium] (532 aa)
Score = 1370, Expect = 3.3e-149, Identities = 310/524 (59%), Positives = 409/524 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS+ AR  +  GV +L D VKVT+GP+GRNV+++KSYG+P+IT DGV++AK+++L +  ENMGA+LV +VASKT D AGDGTTTATVL   + +EGL+NV +GANP+ I+RG++    A V EL+  SK +  KD I QVA +S+ S++ +G+LIA AMEKVG+DGVIT+EE+KGI+ EL VVEGMQFDRGY+S Y VTD +KM A LENPYILITDKK+S+I+DILP+LE++++  R LLIIADDVDGEAL TLV+NK+RG  NVVAVKAP FGD+RK +LEDIAILTG + +T+DLG+   + T+++LG A  VV+DKDN+TIV+G G ++ + +R+  IK  I  T SD+D++ L+ RLAKL  GVAV+KVGA +E ELKE K R++DAL++T+AA+EEGIV GGG ALV+V K+  V+ L   GD   G +IV+ A+  P+ QI  NAGF+  VVI++ LK  +   GFNAA+G+YV+M   GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKDIKFSEDARAAMLRGVDKLADTVKVTLGPKGRNVVLEKSYGSPLITNDGVTIAKDIELDDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPMGIRRGIELATKAAVEELHSISKVVDSKDAIAQVAAVSSGSEE-VGKLIAEAMEKVGNDGVITIEESKGIDTELDVVEGMQFDRGYLSQYMVTDNDKMEAALENPYILITDKKISNIQDILPLLEQVLQQSRSLLIIADDVDGEALPTLVLNKIRGTVNVVAVKAPGFGDRRKAMLEDIAILTGATVITEDLGLDLKEATIENLGTAGKVVVDKDNTTIVEGSGDKAALNDRVEMIKRQIGETTSDFDREKLQERLAKLAGGVAVVKVGAATETELKELKLRIEDALNSTRAAVEEGIVSGGGTALVNVIKK--VSELEAEGDAATGIKIVVRALEEPVRQIAENAGFEGSVVIDK-LKNADQGTGFNAASGEYVNMIDAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|114328844|ref|YP_746001.1| chaperonin GroEL [Granulibacter bethesdensis CGDNIH1] >gi|122326206|sp|Q0BQ24|CH60_GRABC 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|114317018|gb|ABI63078.1| 60 kDa chaperonin GROEL [Granulibacter bethesdensis CGDNIH1] (544 aa)
Score = 1370, Expect = 3.5e-149, Identities = 304/543 (55%), Positives = 411/543 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AK++KF   AR ++  GV  L DAVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT D+AGDGTTTATVL   + +EG + V +G NP+++KRG+DK V  ++ +L  +S+KI    E  QV TISAN + +IG +I+ AM+KVG++GVITVEEAKGI  EL VVEGMQFDRGY+SPYF+T+  KMIA+L+NPYILI +KK++ ++ +LP+LE ++++GRPLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTLQ LG A+ V+I+K+N+TIV+G G    IK R S+I+   E T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL   S ++ ++   N  GD+K+G +I+  A+ SP+ QI  NAG D  V+  ++L+    + GF+A TG++ D+   GIIDP KV R ALQ+A SV+++L+TTEA+I +  + K  +    P  GMG M
  S:     3 AKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDKAGDGTTTATVLTQAIVREGAKAVAAGLNPMDLKRGIDKAVAVVIEDLKANSRKITNPSETAQVGTISANGESEIGRMISEAMQKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNPEKMIAELDNPYILIHEKKLAQLQPLLPLLESVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEDLGIKLETVTLQQLGTAKRVLIEKENTTIVEGAGSPDDIKGRCSQIRAQAEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGVALARASLKLADLGYDN--GDQKVGIEIIRRALQSPLRQISENAGEDGAVIAGKVLENGTYNFGFDAQTGEFKDLVSAGIIDPAKVVRTALQDAASVAALLITTEAMIAEKPEKKAPA--GAPPGGMGDM 542
>gi|68249140|ref|YP_248252.1| chaperonin GroEL [Haemophilus influenzae 86-028NP] >gi|81336454|sp|Q4QN05|CH60_HAEI8 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68057339|gb|AAX87592.1| 60 kDa chaperonin [Haemophilus influenzae 86-028NP] (545 aa)
Score = 1370, Expect = 3.6e-149, Identities = 298/530 (56%), Positives = 405/530 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKED 531
           AK++KF + AR K+  GV  L DAVKVT+GP+GRNV++ KS+GAP ITKDGVSVA+E++L +  ENMGAQ+VK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V+A+V+EL   SK      EI QV TISANSD  +G+LI+ AMEKVG +GVITVE+  G+ DEL VVEGMQFDRGY+SPYF+        +L+NPY+L+ DKK+S+I+++LP+LE + K G+PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILT G+ +++++G+  +K TL+DLGQA+ VVI+KDN+TI+ G G E+QIK R+++I+  IE + SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG ALV  + ++  +      ++ +G ++ + A+ +P+ QIV+N+G +  VV + + K    + G+NA T +Y DM + GI+DP KVTR ALQ A SV+ +++TTE ++ D+ KDDK D
  S:     3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLLVDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEAQIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTNSGEEASVVASAV-KNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMITTECMVTDLPKDDKAD 532
>gi|160947329|ref|ZP_02094496.1| hypothetical protein PEPMIC_01263 [Peptostreptococcus micros ATCC 33270] >gi|158446463|gb|EDP23458.1| hypothetical protein PEPMIC_01263 [Peptostreptococcus micros ATCC 33270] (543 aa)
Score = 1370, Expect = 3.6e-149, Identities = 299/544 (54%), Positives = 419/544 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPAMPNMGMGGM 544
           MAKEIKF++ AR  +  G+ +L + VKVT+GP+GRNV++ K +G+P+IT DGV++A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANP+ I++G+ K V+  V  + + SK +  K+ I QVA+ISA +D+++G+LI++AMEKVG DGVITVEE++ +   L VVEGMQFDRGY+SPY VT+T KM A+LE+PYILITDKK+++I+++LP+LE+I++ G+PLLIIADDV+GEA+ TLVVNK+RG FN VAVKAP FGD+RK +L+DIAILTGG+ +++DLG    + +++ LG+A  V + K+ + IV G G +S I+ER++ I+  IE++DS+YD+D L+ RLAKL  GVAVI+VGA +E ELKE+K R++DAL+AT+AA+EEGIV GGG  L++V  ++        GDE+ G  I++ A+  P+ QI  NAG + G VI E +K     +GF+A + KYV+M ++GI+DP KVTR ALQNA SV+SM+LTTEA + DV KD+    +P   N GMG M
  S:     1 MAKEIKFNEEARKGMEAGINKLSNTVKVTLGPKGRNVVLDKKFGSPLITNDGVTIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVAAGANPMIIQKGIKKAVDKAVEGIKEFSKPVETKESIAQVASISA-ADEEVGKLISDAMEKVGKDGVITVEESRSMGTTLEVVEGMQFDRGYVSPYMVTNTEKMEAELEDPYILITDKKITNIQEVLPVLEQIVQQGKPLLIIADDVEGEAMATLVVNKLRGTFNCVAVKAPAFGDRRKDMLQDIAILTGGTVISEDLGYELKETSIEMLGKARRVTVGKELTVIVNGAGEQSAIEERVALIRNQIEISDSEYDRDKLQERLAKLAGGVAVIQVGAATETELKERKLRIEDALAATRAAVEEGIVPGGGTVLLNVIPKVKALLEGTNGDERTGVNIIVKALEEPVRQIAINAGLE-GSVIVENVKNAEVGIGFDALSEKYVNMLESGIVDPTKVTRSALQNASSVASMVLTTEAAVADVTKDEPMGQMPGGMNPGMGYM 543
>gi|110004968|emb|CAK99299.1| groel chaperonin protein [Spiroplasma citri] (537 aa)
Score = 1369, Expect = 4.0e-149, Identities = 296/541 (54%), Positives = 413/541 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           M+K IKF++ AR KL NG+ +L DAVKVT+GP+G+ VL++K+YG+P+IT DGV+++KE++L+N  ENMGA+LV +VA+KT D AGDGTTTA VL   + KEGL+N+ +GAN + I+ G++KTV AIV+ L +S+K+I  K+EI QVA++S+  D +IG LIA  M KVG+DGVIT+EE+K IN E +V EG+QFD+GY+S Y VTD+ KM+ + ENPYILITDKK+S++K+ILPILE+I++ GRPLLIIADDVDG+ L TL++NKMRG FN+  VKAPEFG+ RK +LEDIA+L  G FV  DLG+    +TL DLG A+ V++ KD +TI++GK   ++I+ R   I+  IE   S +++D L+ RLAKL  GV +IKVGA +E E+KEKK R++DAL++TKAA+EEGIV GGG ALV V K++    L L  +E++G  IV+ AI  P+ QI +NAG D  +++N  LK  + ++G+NAAT  + +M + GI+DPVKVTR ALQ+A SVS++LLTTEAV+ +  +DK+    + P++G+
  S:     1 MSKSIKFAEEARMKLLNGINKLTDAVKVTLGPKGKYVLLEKNYGSPLITNDGVTISKEIELSNHFENMGAKLVAEVANKTNDVAGDGTTTAIVLTQAIVKEGLKNITAGANAVAIRNGIEKTVKAIVDLLKQSAKEIKSKEEIAQVASVSSK-DLEIGALIAEIMAKVGNDGVITIEESKTINTETSVTEGLQFDKGYLSQYMVTDSEKMLTEFENPYILITDKKISNMKEILPILEKIVEEGRPLLIIADDVDGDVLPTLLLNKMRGAFNICVVKAPEFGNNRKDLLEDIAMLVKGKFVNGDLGMDLKTLTLDDLGTAKKVIVSKDTTTIIEGKATRAEIEARKDFIRHQIENEKSTFEQDKLKKRLAKLANGVGIIKVGAPTETEMKEKKLRIEDALNSTKAAVEEGIVAGGGTALVQVGKKL--GNLKLNDEERLGLNIVLRAIEEPVRQIAANAGVDGSIIVNN-LKEQSENIGYNAATNTWENMIEAGIVDPVKVTRYALQHAGSVSALLLTTEAVVVNNDEDKQPKASSYPDLGI 537
>gi|169182752|ref|ZP_02843266.1| chaperonin GroEL [Thauera sp. MZ1T] >gi|169010160|gb|EDS56928.1| chaperonin GroEL [Thauera sp. MZ1T] (549 aa)
Score = 1369, Expect = 4.1e-149, Identities = 290/528 (54%), Positives = 407/528 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DSAR ++  G+  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V A ++EL K SK  +   EI QV +ISANSD  IG++IA AM+KVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ + +K +A LE P++L+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG  + +++G++ +K TL DLGQA  + + K+N+ I+ G G   +I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+     +      L G   D+  G +IV+ A+  P+ +IV+NAG +  VV+N++++ +  + GFNAATG+Y DM + G++DP KVTR ALQNA SV+ ++LTT+ ++ ++ +DK
  S:     3 AKEVKFGDSARERMVAGINILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVVATIDELKKLSKPCSTNKEIAQVGSISANSDSDIGDIIARAMDKVGKEGVITVEDGKSLQNELDVVEGMQFDRGYLSPYFINNPDKQVAILEQPFVLLFDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGQVIAEEVGLTLEKATLDDLGQAARIEVGKENTIIIDGAGQADRIEARVKQIRVQIEEASSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRARAALG----ELKGDNHDQDAGIKIVLRAMEQPLREIVANAGDEPSVVVNKVVEGSGNY-GFNAATGEYGDMVEMGVLDPTKVTRTALQNAASVAGLMLTTDCMVGELAEDK 528
>gi|187932712|ref|YP_001884621.1| chaperonin GroL [Clostridium botulinum B str. Eklund 17B] >gi|187720865|gb|ACD22086.1| chaperonin GroL [Clostridium botulinum B str. Eklund 17B] (540 aa)
Score = 1369, Expect = 4.1e-149, Identities = 308/544 (56%), Positives = 418/544 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           MAK +KF + AR  +  GV +L D VKVT+GP+GRNV++ K +G+P+IT DGVS+A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANP+ I+ G+   V+  V E+ K SK +  K++I +VA ISA +D++IG+LIA+AMEKVG++GVIT+EE+K +  EL VVEGMQFDRGY+SPY  TDT KM A L+ PYILITDKK+++I++ILPILE+I++ GR LLIIA+D++GEA+ TLVVNK+RG F  VAVKAP FGD+RK++LEDIAILTGG+ + ++LG    +VTL  LGQAESV + KDN+ +V GKG    IK+RIS+IK  IE T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+ATKAA+EEGIV GGG A ++V K +   T + + D ++G +I++ ++  P+ QI SNAG +  V+I ++ K +    G++A  GKYV+M ++GI+DP KVTR ALQNA SVS+  LTTEA + ++   KE ++PA P MGM GM
  S:     1 MAKMLKFGEDARRSMQVGVDKLADTVKVTLGPKGRNVVLDKKFGSPLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPMLIRNGIRMAVDKAVEEIKKISKPVEGKEDIARVAAISA-ADEEIGKLIADAMEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMSTDTEKMEAILDTPYILITDKKITNIQEILPILEQIVQAGRKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGDRRKEMLEDIAILTGGTVIAEELGRDLKEVTLDMLGQAESVKVSKDNTVVVNGKGNPENIKDRISQIKAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALAATKAAVEEGIVPGGGTAYINVIKEVEKLTSD-VQDTELGIKIIVKSLEEPLRQIASNAGVEGSVIIEKV-KNSEVGTGYDALYGKYVNMIKSGIVDPTKVTRSALQNAASVSATFLTTEAAVAEIP-QKEPAMPA-PGMGMDGM 539
>gi|16801239|ref|NP_471507.1| chaperonin GroEL [Listeria innocua Clip11262] >gi|20137851|sp|Q929V0|CH60_LISIN 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|16414687|emb|CAC97403.1| class I heat-shock protein (chaperonin) GroEL [Listeria innocua] (542 aa)
Score = 1369, Expect = 4.2e-149, Identities = 300/528 (56%), Positives = 405/528 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAK+IKFS+ AR  +  GV QL +AVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +P ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ ++RG++K V   + EL   SK I  K+ I QVA IS+  D+++G+LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LE PYILITDKK+++I++IL +LE++++ GRP+LIIA+DV+GEA  TLV+NK+RG FNVVAVKAP FGD+RK +LEDIA+LTGG  +T+DLG+     T+  LG A  VV+ KD++TIV+G G  +QI  R+++I+  +E T S++D++ L+ RLAKL  GVAV+KVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV +  +  V  L   GD + G  IV+ ++  P+ QI  NAG + G VI E LK     +GFNAA G++V+M   GI+DP KVTR ALQNA SV+++LLTTEAV+ D  D+
  S:     1 MAKDIKFSEDARRAMLRGVDQLANAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVSEVASKTNDVAGDGTTTATVLAQAMIQEGLKNVTAGANPVGVRRGIEKAVATAIEELKAISKPIESKESIAQVAAISS-GDEEVGKLIAEAMERVGNDGVITIEESKGFATELDVVEGMQFDRGYTSPYMVTDSDKMEAVLEKPYILITDKKINNIQEILSVLEQVVQQGRPMLIIAEDVEGEAQATLVLNKLRGTFNVVAVKAPGFGDRRKAMLEDIAVLTGGQVITEDLGLELKTATVDQLGTANKVVVTKDDTTIVEGAGDSTQISARVNQIRAQMEETTSEFDREKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVSIYNK--VAALEAEGDVETGINIVLRSLEEPVRQIAHNAGLE-GSVIVERLKHEAVGVGFNAANGEWVNMIDAGIVDPTKVTRSALQNASSVAALLLTTEAVVADQPDE 524
>gi|1345762|sp|P48215|CH60_NEIFL 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63) >gi|438183|emb|CAA80531.1| heat-shock protein [Neisseria flavescens] (544 aa)
Score = 1369, Expect = 4.6e-149, Identities = 292/537 (54%), Positives = 410/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGVSVAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V+EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +L+DIAILTGG  +++++G+S +K TL DLGQA+ + I K+N+TI+ G G  +QI+ R+++I+  IE   SDY K+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D++ G QIV+ A+ SP+ QIV+ AG +  VV+N++L+    + G+ A +G+Y DM + G++DP KVTR ALQ+A S++ ++LTT+ +I ++ + K    PAMP+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVLDRAFGGPHITKDGVSVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVDELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLQDIAILTGGVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAAQIEARVAEIRQQIETATSDYGKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQEAGVQIVLRAVESPLRQIVAKAGGEPSVVVNKVLEGKGNY-GYKAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPERK----PAMPD 533
>gi|91780203|ref|YP_555410.1| chaperonin GroEL [Burkholderia xenovorans LB400] >gi|118597104|sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 (Protein Cpn60 5) (groEL protein 5) >gi|91692863|gb|ABE36060.1| groEL 60 kDa chaperonin [Burkholderia xenovorans LB400] (546 aa)
Score = 1369, Expect = 4.6e-149, Identities = 289/527 (54%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR+KL  GV  L +AVKVT+GP+GRNV++++S+G+PV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A ++EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K ++DEL VVEG+QFDRGY+SPYF+ D +K +A L+NPY+L+ DKKVS+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  I+   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V   I+        D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + +  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+++LLTT+A +Y+   D
  S:     3 AKEIIFSDVARSKLVEGVNILANAVKVTLGPKGRNVVLERSFGSPVVTKDGVSVAKEIELPDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVVAAIDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPYVLLHDKKVSNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGEHKNIEARVKQIRAQIDEASSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRNAIS-GLKGANADQDAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGSG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAALLLTTDATVYEAPKD 527
>gi|57339736|gb|AAW49855.1| hypothetical protein FTT1696 [synthetic construct] (579 aa)
Score = 1369, Expect = 4.7e-149, Identities = 304/526 (57%), Positives = 393/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+G P ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:    29 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGTPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNYGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 552
>gi|196480063|gb|ACG79591.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum HLK1] (547 aa)
Score = 1369, Expect = 4.7e-149, Identities = 301/523 (57%), Positives = 403/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK++ FS  AR+++  GV  L +AVKVT+GP+GRNV+I+KS+GAP  TKDGVSVAKE++L++  EN+GAQL+++VASKT D+AGDGTTTATVLA  +  EGL++V +G NP+++KRG+DK V  ++ E+  +SKK++   EI QV TISAN D ++GE+IA AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+  KM A LE P IL+ +KK+SS++ +LP+LE ++++GRPLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  +++DLGI  + V+L  LG+A+ V I K+++TIV G G +S I+ RI++IK  IE T SDYDK+ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL+AT+AA+EEGIV GGG AL+  SK ++        D++ G  IV  A+ +PI QI  NAG +  +V+ ++L+  +P  GFNA T +YVD+ Q G+IDP KV R ALQ+A SV+ +L+TTEA I +
  S:     3 AKDVYFSSDARDRMLRGVNTLANAVKVTLGPKGRNVVIEKSFGAPRSTKDGVSVAKEIELSDKFENLGAQLIREVASKTNDKAGDGTTTATVLAQAIVVEGLKSVAAGMNPMDLKRGVDKAVAKVIEEIKATSKKVSANSEIAQVGTISANGDVEVGEMIARAMEKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMEADLEEPLILLFEKKLSSLQPLLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLRVAAVKAPGFGDRRKAMLEDIAILTGGQLISEDLGIKLENVSLDMLGRAKKVTITKEDTTIVDGSGDKSGIEGRIAQIKKQIEDTTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALLKASKVLD-GFKGDNDDQEAGIAIVRRALQAPIRQISENAGVEGSIVVGKVLENASPTFGFNAQTEEYVDLVQAGVIDPAKVVRTALQDAASVAGLLITTEAAIVE 524
>gi|152238|gb|AAA26287.1| groEL (541 aa)
Score = 1368, Expect = 5.3e-149, Identities = 296/540 (54%), Positives = 410/540 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AKE+KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VAS+T D AGDGTTTATVLA  + +EG + V SG NP+++KRG+D  V+A+V EL  +++KI++  EI QV TISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+ +KM  +LE+PYILI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ V++DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++ I+ R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDA+ AT+AA+EEGI+ GGG AL+   K ++ + T N   D+++G  +V  AI +P+ QI  NAG +  +++ ++ + T    G+NA T +Y D++  G+IDP KV R  LQ+A SV+ +L+TTEA+I   +  K+++ PA    GM
  S:     3 AKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGIDLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDPYILIHEKKLSNLQAMLPVLERVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTGGTVVSEDLGIKLESVTLDMLGRAKKVSIEKENTTIIDGAGSKADIEGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDAVHATRAAVEEGILPGGGVALLRAVKALDGLKTAN--NDQRVGVDLVRRAIEAPVRQIAENAGAEGSIIVGKLREKTEFSYGWNAQTNEYGDLYAMGVIDPAKVVRTGLQDAASVAGLLVTTEAMI--AEKPKKEAAPAFRPRGM 539
>gi|70732163|ref|YP_261919.1| chaperonin GroEL [Pseudomonas fluorescens Pf-5] >gi|119366258|sp|Q4K764|CH60_PSEF5 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|68346462|gb|AAY94068.1| GroEL protein PA4385 [Pseudomonas fluorescens Pf-5] (547 aa)
Score = 1368, Expect = 5.3e-149, Identities = 295/528 (55%), Positives = 403/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DSAR K+  GV  L DAVK T+GP+GRNV+I+KS+GAP ITKDGVSVAKE++L +  ENMGAQLVKDVAS+  D+AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL   SK  A    I QV TISANSD  IG++IA AMEKVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+L+ P IL+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG+ +++++G+S +  TL+ LG A+ V++ K+N+TI+ G G+E+ I+ R+++I+  +  T SDYD++ L+ RLAKL+ GVAVIKVGA SEVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+   + IN +      D+ +G  ++  AI +P+ QIV+N+G +  VV++++ +    + G+NAAT +Y DM + GI+DP KVTR ALQ A S+  ++LTTEA + ++ +DK
  S:     3 AKEVKFGDSARKKMLTGVNVLADAVKATLGPKGRNVIIEKSFGAPTITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGIDKATIAIVKELKGLSKPCADSKAIAQVGTISANSDNSIGDIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDGPLILLVDKKISNIREMLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTVISEEIGLSLESTTLEHLGNAKRVILSKENTTIIDGAGVEADIQARVTQIRQQVADTSSDYDREKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIRALQGIN-DLKGDNADQDVGIAVLRRAIEAPLRQIVANSGDEPSVVVDKVKQGAG-NFGYNAATSEYGDMIEMGILDPTKVTRSALQAASSIGGLILTTEAAVAEIVEDK 528
>gi|89896706|ref|YP_520193.1| hypothetical protein DSY3960 [Desulfitobacterium hafniense Y51] >gi|89336154|dbj|BAE85749.1| hypothetical protein [Desulfitobacterium hafniense Y51] (555 aa)
Score = 1368, Expect = 5.4e-149, Identities = 296/525 (56%), Positives = 403/525 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV 525
           +AK+I F++ AR  L  GV  L ++V+VT+GP+GRNV++ K +GAP+IT DGV++A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTATVLA  + +EGL+NV +GANP+ IKRG++K V ++V+++  ++K I  K+ I QVA+ISA  D  IG LI++AMEKVG DGVITVEEAKG+  EL VVEGMQFDRGY+S Y +TDT+KM A L +PYILITDKK+ +I DILP+LE++++ GR LLIIA+D++GEAL TL++NK+RG F  VAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+  +  T+  LG+A  + + K+ +TIV+G G +  IK R+  IK  I+ T SD+D++ L+ RLAKL  GVAVI+VGA +EVE+KEKK R++DAL+AT+AA+EEGIV GGG ALV  +K +  ++L L GDEK G  IV  A+  P+ QI +NAGF+  +V+ ++ +     +GFNA T  Y DM   GI+DP KVTR ALQNA S+++MLLTTE ++ D+
  S:    12 VAKQIVFNEEARRALERGVNALAESVRVTLGPKGRNVVLDKKFGAPLITNDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVAAGANPMGIKRGIEKAVESVVDDIKTNAKPIESKESIAQVASISAGDDN-IGVLISDAMEKVGKDGVITVEEAKGMTTELKVVEGMQFDRGYLSAYMITDTDKMEAILNDPYILITDKKIGAIADILPVLEKVVQAGRQLLIIAEDIEGEALATLILNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLKLENTTIDMLGRARQIRVTKEETTIVEGSGSQDDIKSRVEAIKKQIDETTSDFDREKLQERLAKLAGGVAVIQVGAATEVEMKEKKLRIEDALAATRAAVEEGIVAGGGCALVDAAKAL--DSLKLTGDEKTGVAIVYRALEEPLRQIANNAGFEGSIVVEKV-RNGGRGVGFNALTEAYEDMIAAGIVDPAKVTRSALQNAASIAAMLLTTECLVSDI 532
>gi|52079060|ref|YP_077851.1| chaperonin GroEL [Bacillus licheniformis ATCC 14580] >gi|52784430|ref|YP_090259.1| chaperonin GroEL [Bacillus licheniformis ATCC 14580] >gi|68566268|sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|52002271|gb|AAU22213.1| class I heat-shock protein (chaperonin) [Bacillus licheniformis ATCC 14580] >gi|52346932|gb|AAU39566.1| GroEL [Bacillus licheniformis DSM 13] (544 aa)
Score = 1368, Expect = 5.6e-149, Identities = 302/530 (56%), Positives = 406/530 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKE 530
           MAK+IKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++G+++ V   V  L + SK I  K+ I QVA+ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A LENPYIL+TDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI+ILTG   +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   QI  R+++I+  +E T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V  +  V  L   GDE  G  IV+ A+  PI QI  NAG + G VI E LK     +G+NAATG++V+M   GI+DP KVTR ALQNA SV++M LTTEAV+ D  ++ +
  S:     1 MAKDIKFSEEARRSMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGIEQAVAVAVESLKEISKPIEGKESIAQVASISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILVTDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISILTGAEVITEDLGLDLKSTQINQLGRASKVVVTKENTTIVEGAGDTEQIAARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYNK--VAALEAEGDELTGINIVLRALEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGYNAATGEWVNMIDKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENK 526
>gi|169824583|ref|YP_001692194.1| heat shock protein [Finegoldia magna ATCC 29328] >gi|167831388|dbj|BAG08304.1| heat shock protein [Finegoldia magna ATCC 29328] (539 aa)
Score = 1368, Expect = 5.7e-149, Identities = 297/545 (54%), Positives = 411/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAK+IKFSD AR  +  G+ +L D VKVT+GP+GRNV++ K YGAP+IT DGVS+A+E++L +  ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+N+ +GANPI +++G+ K V   V  +   S  +  K+EI  V ++SA +D+ IG+LIA AMEKVG++GVITVEE+K +   L VVEGM+FDRGY+SPY V+D++KM+A +E+P+IL+TD+K+++I+DILP+LE++++ G+PL IIA+DV+GEAL TLV+NK+RG FN VAVKAP FGD+RK++LEDI ILTG   +T+DLGI     +   LG+A  V + KD +TIV G G +S+I+ERI++I+  I  TDS+YD++ L+ RLAKL+ GVAVI+VGA +E ELKE+K R++DAL+AT+AA+EEGIV GGG  L+ + + +     ++ GDEK G +I++ A+  P+ QI  NAG D G VI E +K  +  +GF+A  G+YVDM + GI+DP KVT  ALQNA SV+S+LLTTEA +  +K D+    PAMP  G G  M
  S:     1 MAKQIKFSDDARKSMVEGINKLSDTVKVTLGPKGRNVVLDKEYGAPLITNDGVSIAREIELEDEYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNLAAGANPIVLQKGIKKAVEKSVEAIKARSHSVTTKEEIANVGSVSA-ADETIGKLIAEAMEKVGNNGVITVEESKSMGTTLNVVEGMEFDRGYVSPYMVSDSDKMVAAMEDPFILVTDRKITNIQDILPLLEQVVQQGKPLFIIAEDVEGEALATLVLNKIRGTFNCVAVKAPGFGDRRKEMLEDICILTGAQLITEDLGIELKDASFDMLGRARKVNVSKDKTTIVDGNGDQSKIEERINQIQNRIPETDSEYDREKLQERLAKLSGGVAVIEVGAATETELKERKLRIEDALAATRAAVEEGIVAGGGTILLDIIEEVEKLVDDVEGDEKTGVKIILKALEEPVKQIAINAGID-GSVIVENVKNKDKGIGFDAYKGEYVDMLKAGIVDPTKVTLSALQNAASVASLLLTTEAAVVTIKKDE----PAMPQPGPGAYM 539
>gi|169656738|ref|YP_001429247.2| chaperonin GroL [Francisella tularensis subsp. holarctica FTNF002-00] >gi|164551806|gb|ABU62291.2| chaperonin GroL [Francisella tularensis subsp. holarctica FTNF002-00] (559 aa)
Score = 1368, Expect = 6.0e-149, Identities = 305/526 (57%), Positives = 394/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:    18 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNHGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 541
>gi|87198061|ref|YP_495318.1| chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444] >gi|119366253|sp|Q2G2Z4|CH60_NOVAD 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|87133742|gb|ABD24484.1| chaperonin GroEL [Novosphingobium aromaticivorans DSM 12444] (547 aa)
Score = 1368, Expect = 6.1e-149, Identities = 302/528 (57%), Positives = 389/528 (73%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF   AR ++  GV  L DAVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASK  D AGDGTTTATVLA  + +EG+  V +G NP+++KRG+D  V  +V  L   S  +A   EI QV  ISAN D ++G+ IA AMEKVG +GVITVEEAKG+  EL VVEGMQFDRGY+SPYF+T+  KM  +LENPYILI +KK+SS++ +LPILE ++++GRPLLIIA+D++GEAL TLVVNK+RG   + AVKAP FGD+RK +L DIA LT G  +++DLGI  + VTL  LGQA+ V IDKDN+TIV G G   +IK R+ +I+  IE+T SDYD++ L+ RLAKL  GVAVIKVG  +EVE+KE+KDRVDDAL AT+AA+EEGIV GGG AL++ +K +         D+  G  IV  AI +PI QI +NAG D  VV   +L+  + + GFNAAT  Y ++   G+IDP KV R ALQ+A SVS +L+TTEA I +  DDK
  S:     3 AKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGIDIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENPYILIHEKKLSSLQAMLPILEAVVQSGRPLLIIAEDIEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLGDIATLTAGEMISEDLGIKLESVTLAMLGQAKKVTIDKDNTTIVDGAGSAEEIKARVEQIRAQIEVTTSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALLYATKALE-GLKGANDDQTKGIDIVRRAIQAPIRQIAANAGHDGAVVSGNLLRENDENQGFNAATDTYENLKAAGVIDPTKVVRTALQDAASVSGLLITTEAAISEKPDDK 529
>gi|28871512|ref|NP_794131.1| chaperonin GroEL [Pseudomonas syringae pv. tomato str. DC3000] >gi|38257464|sp|Q87X14|CH60_PSESM 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|28854763|gb|AAO57826.1| chaperonin, 60 kDa [Pseudomonas syringae pv. tomato str. DC3000] (547 aa)
Score = 1368, Expect = 6.1e-149, Identities = 298/528 (56%), Positives = 406/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF D+ R K+  GV  L DAVK T+GP+GRNV+I+KS+GAP+ITKDGVSVAKE++L +  ENMGAQLVKDVAS+  D+AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV EL K SK       I QV TISANSD  IG++IA AMEKV  DGVITVEE  G+ +EL+VVEGMQFDRGY+SPYF+   + M+A+L++P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG+ +++++G+S +  TL+ LG A+ V+++K+N+TI+ G G+++ I  RIS+I+  I  T SDYDK+ L+ RLAKL+ GVAVIKVGA SEVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I         D+ +G  ++  A+ +P+ QIV+N+G +  VV++++ K  + + G+NAA+G+Y DM + GI+DP KVTR ALQ A S++S+++TTEA+I DV D+K
  S:     3 AKEVKFGDAGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPLLLLVDKKISNIREMLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGTVISEEIGLSLETTTLEHLGNAKRVILNKENTTIIDGAGVKTDIDSRISQIRQQIGDTSSDYDKEKLQERLAKLSGGVAVIKVGAGSEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRSLQAIE-GLKGDNADQDVGIALLRRAVEAPLRQIVANSGDEPSVVVDKV-KQGSGNFGYNAASGEYGDMIEMGILDPAKVTRSALQAASSIASLMITTEAMIADVADEK 528
>gi|167586346|ref|ZP_02378734.1| chaperonin GroEL [Burkholderia ubonensis Bu] (540 aa)
Score = 1368, Expect = 6.3e-149, Identities = 294/540 (54%), Positives = 401/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTL-NLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK+++F D AR ++  GV  L DAVKVT+GPRGRNV+++KS+GAP ITKDGVSVAK+++L + +ENMGAQ+VK VA+KT+D AGDGTTTATVLA  + +EG++ V SG NP+++KRG+D+  +A+V EL K SK +    EI QV  ISAN+D+ IG  IA AME+VG DG IT+EE + +  EL +VEGMQFDRG++SPYF+TD  K +A LE PYIL+ D+K+SSI D+LP+LE + K G+PLL+IA++V+GEAL+TLVVN +RG+   VAVKAP FGD+RK +LEDIA LTGG  + ++ G   +KVTL+DLG+A  V ++K+ +TI+ G G   ++  RI  +K  ++   SDYDK+ L+ R+AKL+ GVAVIKVGA +EVE+KEKK RVDDAL AT+AA+EEGIV GGG AL+    R NV  L     D+  G +IV+ A+  P+ QI  NAG +  VV+N++L+    + G+NAA   Y D+ + GIIDP KV R ALQNA SV+ ++LTT+AV+ ++   KE++ PA+P+  M
  S:     3 AKDVQFHDVARQRVVRGVNILADAVKVTLGPRGRNVVLEKSFGAPTITKDGVSVAKDIELPDKLENMGAQMVKQVAAKTSDIAGDGTTTATVLAQAIVREGMKYVASGLNPMDLKRGIDQAASALVEELKKLSKAVTTSKEITQVGAISANADEDIGRTIAEAMERVGKDGAITIEEGRSLQSELEIVEGMQFDRGWLSPYFITDPEKQLAVLEEPYILVHDRKISSIHDLLPVLEAVAKAGKPLLVIAEEVEGEALSTLVVNSLRGILKTVAVKAPGFGDRRKAMLEDIATLTGGLLIAEETGKQLEKVTLEDLGRARRVEVEKEATTIIDGAGDRKKVDARIQALKRQVDEATSDYDKEKLQERIAKLSGGVAVIKVGAATEVEMKEKKARVDDALHATRAAVEEGIVPGGGIALLRA--RANVKDLRGANADQDAGIRIVLRALEEPLRQIALNAGEEASVVLNKVLEQAG-NFGWNAAANTYGDLMEMGIIDPTKVERTALQNAASVAGLILTTDAVVAELP--KEETRPAVPSHEM 538
>gi|160901092|ref|YP_001566674.1| chaperonin GroEL [Delftia acidovorans SPH-1] >gi|160366676|gb|ABX38289.1| chaperonin GroEL [Delftia acidovorans SPH-1] (547 aa)
Score = 1367, Expect = 7.2e-149, Identities = 299/537 (55%), Positives = 406/537 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK++ F   AR ++  GV  L +AVKVT+GP+GRNV++++S+GAP +TKDGVSVAKE++L + ++NMGAQLVK+VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A+V EL K SK      EI QV +ISANSD+ +G +IA AM+KVG +GVITVEE K + +EL VVEGMQFDRGY+SPYF+ +  K +A L+NP++L+ DKK+S+I+D+LP LE + K GRPLLIIA+DV+GEAL TLVVN +RG+  VVAVKAP FGD+RK +LEDIAILTGG  + +++G++ DKVTL+DLGQA  + I K+N+TI+ G G  ++I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+   + +  +      ++  G +++M AI +P+ +IV+NAG +  VV+N +L  +  + GFNAA   Y DM + GI+DP KVTR ALQNA SV+S+LLTTEA+I   +  K +  PAMP+
  S:     3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGLNPMDLKRGIDKAVAALVEELKKQSKATTTSKEIAQVGSISANSDESVGSIIAEAMDKVGKEGVITVEEGKSLANELDVVEGMQFDRGYLSPYFINNPEKQVALLDNPFVLLFDKKISNIRDLLPTLEAVAKAGRPLLIIAEDVEGEALATLVVNTIRGILKVVAVKAPGFGDRRKAMLEDIAILTGGKVIAEEVGLALDKVTLEDLGQAVRIEIGKENTTIIDGAGQAAEIEARVKQIRIQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVAGGGVALLRAKQAVG-DLKTGDAEQDAGIKLIMKAIEAPLREIVANAGGEPSVVVNAVLNGSGNY-GFNAANDTYGDMLEMGILDPTKVTRTALQNAASVASLLLTTEAMI--AESPKAEGGPAMPD 535
>gi|67458801|ref|YP_246425.1| chaperonin GroEL [Rickettsia felis URRWXCal2] >gi|75536750|sp|Q4UMF2|CH60_RICFE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|67004334|gb|AAY61260.1| 60 kDa chaperonin [Rickettsia felis URRWXCal2] (547 aa)
Score = 1367, Expect = 7.4e-149, Identities = 299/536 (55%), Positives = 411/536 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM 536
           MAK IK     R ++  GV  L DAVKVT+GP+GRNVLI++S+G+P ITKDGV+VAK ++L + I N GAQL+K  A+K A+ AGDGTTTATVLA  + +EG + V +G NP+++KRGMD  VNA+V E+ KSSKKI  ++EI QV TIS+N DK+IGE IA AME+VG +GVITVEEAK  + ++ VV+GM FDRGY+SPYFVT++ KM+A+LENP+IL+ +KK+S+++ +LPILE ++++ RPLLIIA+DV+GEAL TLVVN++RG   V AVKAP FGD+RK ++EDIAILT G  +T+DLG+  + V+++ LG A+ V I K+N+ IV G G +  I++R+ +IK+ I  T SDYDK+ L+ RLAKL+ GVAV+KVG  +EVE+KE+KDRV+DAL+AT+AA+EEG+V GGG  L+H S+ + N+   N   D++ G +IV+ A+  P+ QIV NAG + GVV+ ++L+  + + GFNA   +YVDM + GIIDP KV R ALQ+A SV+S+++TTE +I D   DKEDS+P M
  S:     1 MAKLIKHGSEGREQVLKGVDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSIELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGMDLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILLFEKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLLHASQTLRNLKVDN--KDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFNAQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKEDSIPPM 535
>gi|25452890|sp|Q9L691|CH602_RHILE 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|7578866|gb|AAF64160.1|AF239163_2 GroEL [Rhizobium leguminosarum] (542 aa)
Score = 1367, Expect = 7.4e-149, Identities = 300/521 (57%), Positives = 400/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKEIKFS  AR K+  GV  L +AVK T+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V AIV EL  +++KI+   EI QV TISAN D +IG  +A AMEKVG+DGVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  + E+PYILI +KK+S+++ +LP+LE ++++ +PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ +++DLGI  + VTL  LG+A+ V I+K+N+TIV G G ++ I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ V T N  GD+++G  IV  A+ +P  QI  NAG +  V++ ++ + +    G+NA TG+Y D++  G+IDP KV R ALQ+A S++ +L+TTEA+I
  S:     3 AKEIKFSTEAREKMLRGVDILANAVKATLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVTSGMNPMDLKRGIDLAVAAIVAELKANARKISNNSEIAQVGTISANGDAEIGRFLAEAMEKVGNDGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMRVEFEDPYILIHEKKLSNLQSMLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLESVTLDMLGRAKKVSIEKENTTIVDGSGAKTDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDAVKTAN--GDQRVGVDIVRRAVEAPARQIAENAGAEGSVIVGKLREKSEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASIAGLLVTTEAMI 522
>gi|153810951|ref|ZP_01963619.1| hypothetical protein RUMOBE_01341 [Ruminococcus obeum ATCC 29174] >gi|149832839|gb|EDM87922.1| hypothetical protein RUMOBE_01341 [Ruminococcus obeum ATCC 29174] (541 aa)
Score = 1367, Expect = 7.6e-149, Identities = 301/545 (55%), Positives = 419/545 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP--NMGMGGMM 545
           MAKEIKF   AR  L  GV +L D V+VT+GP+GRNV++ K +GAP+IT DGV++AKE++L +  ENMGAQL+K+VASKT D AGDGTTTATVLA  +  EG++N+ +GANPI +++GM K  +A V  + + S+KI+ K +I  VA+ISA SD+++G+L+A+AMEKV +DGVITVEE+K ++ EL +VEGMQFDRGYIS Y  TD  KM A LE+PYILITDKK+S+I+++LP+LE++++ G  LLIIA+DV+GEALTTL+VNK+RG F VVAVKAP +GD+RK++L+DIAILTGG  ++++LG+   + T+  LG+A+SV + K+N+ IV G G + +I +R+++I+  I  T S++DK+ L+ RLAKL  GVAVI+VGA +E E+KE K R++DAL+AT+AA+EEGI+ GGG+A +H SK++      L GDEK G  +++ A+ +P+  I +NAG +  V+IN++ + + P +GF+A   KYVDM   GI+DPVKVTR ALQNA SV+S LLTTE+V+  +K+D     PAMP    GMGGMM
  S:     1 MAKEIKFGAEARAALETGVNKLADTVRVTIGPKGRNVVLDKQFGAPLITNDGVTIAKEIELEDRFENMGAQLIKEVASKTNDVAGDGTTTATVLAQAMVHEGMKNLAAGANPIILRKGMRKATDAAVEAIKEMSQKISGKAQIANVASISA-SDEEVGQLVADAMEKVSNDGVITVEESKTMHTELDLVEGMQFDRGYISAYMSTDMEKMEANLEDPYILITDKKISNIQEVLPLLEQVVQAGAKLLIIAEDVEGEALTTLIVNKLRGTFQVVAVKAPGYGDRRKEMLQDIAILTGGQVISEELGLDLKETTMAQLGRAKSVKVAKENTVIVDGLGDKKEIADRVAQIRKQIAETKSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRLEDALAATRAAVEEGIIAGGGSAYIHASKKVAELVATLEGDEKTGANVILKALEAPLFHISANAGLEGSVIINKV-RESEPGVGFDALNEKYVDMVGAGILDPVKVTRSALQNATSVASTLLTTESVVATIKED----APAMPAGAPGMGGMM 541
>gi|148549568|ref|YP_001269670.1| chaperonin GroEL [Pseudomonas putida F1] >gi|166201742|sp|A5W8M6|CH60_PSEP1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|148513626|gb|ABQ80486.1| chaperonin GroEL [Pseudomonas putida F1] (546 aa)
Score = 1367, Expect = 7.7e-149, Identities = 297/528 (56%), Positives = 399/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF DSAR K+  GV  L DAVK T+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQLVK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   A+V EL   SK  A    I QV TISANSD  IGE+IA AMEKVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYFV   + M+A+LE P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG  +++++G+S +  TL+ LG A+ V++ K+N+TI+ G G +++I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV     I V+      D+ +G  ++  A+ SP+ QI +NAG +  VV +++ K  + + G+NAATG+Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ D+ +DK
  S:     3 AKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQVISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALAAI-VDLKGDNEDQNVGIALLRRAVESPLRQITANAGDEPSVVADKV-KQGSGNFGYNAATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDK 528
>gi|134301378|ref|YP_001121346.1| chaperonin GroEL [Francisella tularensis subsp. tularensis WY96-3418] >gi|166198461|sp|A4IWC4|CH60_FRATW 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|134049155|gb|ABO46226.1| chaperonin GroL [Francisella tularensis subsp. tularensis WY96-3418] (544 aa)
Score = 1367, Expect = 8.1e-149, Identities = 305/526 (57%), Positives = 395/526 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V++ KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:     3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVLVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNHGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 526
>gi|39998429|ref|NP_954380.1| chaperonin GroEL [Geobacter sulfurreducens PCA] >gi|59797821|sp|Q747C7|CH60_GEOSL 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|39985376|gb|AAR36730.1| 60 kDa chaperonin [Geobacter sulfurreducens PCA] (544 aa)
Score = 1367, Expect = 8.3e-149, Identities = 298/523 (56%), Positives = 396/523 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           A+ IKF    RN +  GV  L DAVKVT+GP+GRNV+I+K++G+P+ITKDGV+VAKE++L +  ENMGAQLVK+VASKT+D AGDGTTTATVLA  ++++G + V +G NP+EIKRG+DK V  IV EL   SK I    EI QV TISAN+DK IG++IA AMEKVG +GVITVEEAK +   L  VEGMQFDRGY+SPYFVTD  +M A LEN  ILI DKK+S++KD+LP+LE+  K+GRPLLIIA+D++GEAL TLVVNK+RGV N+ AVKAP FGD+RK +LEDIAILTGG  +++++G   +  T+  LG+A+ + +DKDN+TI+ G G E+ I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +E E+KEKK RV+DAL AT+AA++EGIV GGG A  ++    +++ L+L  +++ G  ++  ++  PI QI  NAG D  +V++++ K +    G+NAA  +YVDM   GIIDP KV+R ALQNA SV+ ++LTTEA+I D
  S:     3 ARIIKFDQEGRNAILKGVNTLADAVKVTLGPKGRNVVIEKAFGSPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGIDKAVETIVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAQAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEASLENAMILIHDKKISNMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNICAVKAPGFGDRRKAMLEDIAILTGGQVISEEIGNKLENTTMDMLGRAKRITVDKDNTTIIDGDGKEADIQGRVKQIRAQIEETTSDYDREKLQERLAKLVGGVAVIKVGAATETEMKEKKARVEDALHATRAAVDEGIVPGGGVA--YLRALASLDALSLPTEQQFGVNVIKRSLEEPIRQIAQNAGVDGSIVVDKV-KNSKDAFGYNAAEDEYVDMLAAGIIDPTKVSRSALQNAASVAGLMLTTEAMIAD 522
>gi|149927965|ref|ZP_01916215.1| chaperonin GroEL [Limnobacter sp. MED105] >gi|149823404|gb|EDM82637.1| chaperonin GroEL [Limnobacter sp. MED105] (548 aa)
Score = 1367, Expect = 8.4e-149, Identities = 292/537 (54%), Positives = 402/537 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKE+ F D AR+++  GV  L +AVKVT+GPRGRNV++++S+G+P ITKDGVSVAKE++L +  ENMGAQ+VK+VAS+T+D AGDGTTTATVLA  + KEG++ V +G NP+++KRG+DK V+A + EL   SK  A    I QV +ISANSD+ IG +IA AMEKVG +GVITVE+ K +++EL VVEGMQFDRGY+SPYF+ +  K +  L+NP++L+ DKK+S+I+D+LP LE++ K GRPLLIIA+D++GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG  + ++ G+S + VTL+ LGQA+ + + K+N+TI+ G G  + I+ R+ +I+  IE + SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+    +I      L  D+  G +IV+ A+  P+  IV+NAG +  VV N ++     + G+NAATG+Y DM   G++DP KVTR ALQNA S++S++LTT+ ++ D  DDK    P+ P+
  S:     3 AKEVFFGDDARSRMVRGVNILANAVKVTLGPRGRNVVLERSFGSPTITKDGVSVAKEIELKDKFENMGAQMVKEVASRTSDNAGDGTTTATVLAQAIVKEGMKFVTAGMNPMDLKRGIDKAVSAAIVELRALSKPCATTKAIAQVGSISANSDESIGNIIAEAMEKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNQEKQVVALDNPFVLLHDKKISNIRDLLPTLEQVAKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILTGGVVIAEETGMSLETVTLEHLGQAKRIEVGKENTTIIDGAGDGANIEARVKQIRGQIEESSSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRARAKIE-GLKGLNPDQDAGIKIVLRAMEEPLRMIVTNAGEESSVVANNVMGGEGNY-GYNAATGEYGDMVDMGVLDPTKVTRTALQNAASIASLMLTTDCMVADAADDK----PSAPD 533
>gi|170743558|ref|YP_001772213.1| chaperonin GroEL [Methylobacterium sp. 4-46] >gi|168197832|gb|ACA19779.1| chaperonin GroEL [Methylobacterium sp. 4-46] (551 aa)
Score = 1367, Expect = 8.4e-149, Identities = 303/536 (56%), Positives = 410/536 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AK+++FS  AR K+  GV  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + KEG + V +G NP+++KRG+D  V A+V +L ++S+KI R DEI Q+ TISAN D +IG ++A AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+  KMIA+LE+PYILI +KK+SS++ +LP+LE +++TG+PLLI+A+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  + +DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++ I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDA+ AT+AA+EEGIV GGGAAL+        V + N   D + G  IV+ A+ +PI QI  NAG +  +V+ ++ +  +   GF+A    YVD+ Q GI+DPVKV R ALQ+A SV+ +L+TTEA++ D    K+++ PAMP
  S:     3 AKDVRFSADAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGIDLAVAAVVEDLKQNSRKITRNDEIAQIGTISANGDAEIGRMLAEAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGEKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDAMHATRAAVEEGIVPGGGAALLRAKAAAQGVKSDN--PDVQAGINIVVRALEAPIRQIAENAGVEGSIVVGKVAENGSATFGFDAQNETYVDLIQAGIVDPVKVVRTALQDAASVAGLLVTTEAMVADAP--KKEAPPAMP 535
>gi|154685103|ref|YP_001420264.1| chaperonin GroEL [Bacillus amyloliquefaciens FZB42] >gi|166198433|sp|A7Z207|CH60_BACA2 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|154350954|gb|ABS73033.1| GroEL [Bacillus amyloliquefaciens FZB42] (544 aa)
Score = 1366, Expect = 8.6e-149, Identities = 300/524 (57%), Positives = 405/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAK+IKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++GM++ V   +  L + SK I  K+ I QVA ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A L+NPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDI++LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   +I  R+++I+  +E T S++D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V  +  V  +   GD + G  IV+ A+  PI QI  NAG + G VI E LK     +GFNAATG++V+M + GI+DP KVTR ALQNA SV++MLLTTEAV+ D
  S:     1 MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGMEQAVTVAIENLKEISKPIEGKESIAQVAAISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDISVLTGGEVITEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGAGDTEKIAARVNQIRAQVEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYNK--VAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLE-GSVIVERLKNEKIGVGFNAATGEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAVVAD 520
>gi|26988095|ref|NP_743520.1| chaperonin GroEL [Pseudomonas putida KT2440] >gi|38257490|sp|Q88N55|CH60_PSEPK 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|24982821|gb|AAN66984.1|AE016326_10 chaperonin, 60 kDa [Pseudomonas putida KT2440] (546 aa)
Score = 1366, Expect = 8.6e-149, Identities = 298/528 (56%), Positives = 401/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF DSAR K+  GV  L DAVK T+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQLVK+VASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   A+V EL   SK  A    I QV TISANSD  IGE+IA AMEKVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYFV   + M+A+LE P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIA+LTGG  +++++G+S +  TL+ LG A+ V++ K+N+TI+ G G +++I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV     I    ++L G   D+ +G  ++  A+ SP+ QI +NAG +  VV +++ K  + + G+NAATG+Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ D+ +DK
  S:     3 AKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTGGQVISEEIGLSLETATLEHLGNAKRVILSKENTTIIDGAGADTEIEARVKQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGAGTEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALAAI----IDLKGDNEDQNVGIALLRRAVESPLRQITANAGDEPSVVADKV-KQGSGNFGYNAATGEYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVADLPEDK 528
>gi|1705797|sp|P29842|CH60_NEIGO 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63) >gi|438185|emb|CAA80550.1| heat-shock protein [Neisseria gonorrhoeae] (544 aa)
Score = 1366, Expect = 8.7e-149, Identities = 292/537 (54%), Positives = 410/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AK+++F +  R K+ NGV  L +AV+VT+GP+GRNV++ +++G P ITKDGV+VAKE++L +  ENMGAQ+VK+VASKT D AGDGTTTATVLA  +  EG++ V +G NP ++KRG+DK V A+V EL   +K      EI QV +ISANSD+++G +IA AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K IA L+NP++L+ DKK+S+I+D+LP+LE++ K  RPLLIIA+DV+GEAL TLVVN +RGV   VAVKAP FGD+RK +L+DIAILTG   +++++G+S +K TL DLGQA+ + I K+N+T++ G G  +QI+ R+++I+  IE   SDYDK+ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRV+DAL AT+AA+EEG+V GGG AL+     + N++T N   D+  G QIV+ A+ SP+ QIV+NAG +  VV+N++L+    + G+NA +G+Y DM   G++DP KVTR ALQ+A S++ ++LTT+ +I ++ ++K    PA+P+
  S:     3 AKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGIKAVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGVLKTVAVKAPGFGDRRKAMLQDIAILTGAVVISEEVGLSLEKATLDDLGQAKRIEIGKENTTVIDGFGDAAQIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDALHATRAAVEEGVVAGGGVALLRARAALENLHTGN--ADQDAGVQIVLRAVESPLRQIVANAGGEPSVVVNKVLEGKGNY-GYNAGSGEYGDMIGMGVLDPAKVTRSALQHAASIAGLMLTTDCMIAEIPEEK----PAVPD 533
>gi|87312190|ref|ZP_01094293.1| 60 kDa chaperonin 5 [Blastopirellula marina DSM 3645] >gi|87285115|gb|EAQ77046.1| 60 kDa chaperonin 5 [Blastopirellula marina DSM 3645] (538 aa)
Score = 1366, Expect = 9.0e-149, Identities = 290/531 (54%), Positives = 402/531 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEI-LKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           MAK++ F D AR+K+  G+ +L DAV VTMGP GRNV+I KS+G P +TKDGV+V+KE++L +  ENMGA+LV +VASKT+D AGDGTTTATVLA  +FKEG+RN+++G+NP  I+RG++K V A    L  ++K +  K+E+  V  ISAN+D  IGEL+A A+ +VG DGVITVEE K     +  VEGMQFD+GY+SPYF+++  +M  +LE+ YIL+ +KK+SSI+D++PILE++  TG+PLLI+A+DVDGEALT LVVNK+RGV NV AVKAP FGD+RK +L D+AILTGG+ +++DLG++ DKVTL  LG+A+ + + KDN+T+V+G G +S +++RI ++K  IE T+S+YDK+  + RLAKL  GVAVI VGA +E E+K+ K RV+DAL AT+AA+EEGI+ GGG ALV   + +     +  GDEKIG  I++S + +P+ QI  NAG D  VV++E+  K TN  +G++A +G+Y DM + GIIDP KV R AL NA S++ +LLTTEA++ +   DKED
  S:     1 MAKQLLFDDHARSKMLKGIDKLADAVAVTMGPTGRNVIINKSFGGPTVTKDGVTVSKEIELEDRFENMGAKLVNEVASKTSDVAGDGTTTATVLARAIFKEGIRNIVAGSNPAAIRRGIEKAVAAAEAHLLSTAKPVKGKEEVAHVGAISANNDHAIGELLAEALYRVGKDGVITVEEGKTRETTVEYVEGMQFDKGYVSPYFISNPAEMDCELEDAYILLFEKKISSIRDLVPILEQVSGTGKPLLIVAEDVDGEALTALVVNKLRGVLNVCAVKAPGFGDRRKAMLADMAILTGGTVISEDLGVTLDKVTLSQLGKAKRITVTKDNTTLVQGGGDKSALEQRIGQLKKQIEETESEYDKEKYQERLAKLAGGVAVIAVGAETEAEMKQTKARVEDALHATRAALEEGILPGGGVALVRCKEAVEKARSSAKGDEKIGVSIILSVLSAPMKQIADNAGIDGAVVVDEVSQKGTN--IGYDAHSGQYCDMLKAGIIDPAKVVRTALSNAASIAGLLLTTEAMVTNF--DKED 528
>gi|170740040|ref|YP_001768695.1| chaperonin GroEL [Methylobacterium sp. 4-46] >gi|168194314|gb|ACA16261.1| chaperonin GroEL [Methylobacterium sp. 4-46] (545 aa)
Score = 1366, Expect = 9.4e-149, Identities = 298/523 (56%), Positives = 405/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRI-NVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK+++F+  AR K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + KEG + V +G NP+++KRG+D  V A+V ++   SKK++  +EI QV TISAN DK IG++IA AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYF+T+  KMIA+LE+PYILI +KK+SS++ +LP+LE +++TG+PLLI+A+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  + +DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++ I+ R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGIV GGGAAL+   + I ++ + N   D + G +IV+ A+ +PI QI +NAG +  +V+ ++ +  +   GF+A    YVD+ Q GI+DP KV R ALQ+A SV+ +L+TTEA++ D
  S:     3 AKDVRFASDAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVKEGAKYVAAGMNPMDLKRGIDLAVTAVVKDIQGRSKKVSASEEIAQVGTISANGDKDIGQMIAQAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPYILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKENTTIIDGAGDKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGIVPGGGAALLRAREAIKDLKSDN--ADVQAGIKIVLKALEAPIRQIAANAGVEGSIVVGKVAENGSATFGFDAQNETYVDLIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVAD 524
>gi|118597112|sp|Q24QE3|CH60_DESHY 60 kDa chaperonin (Protein Cpn60) (groEL protein) (544 aa)
Score = 1366, Expect = 9.7e-149, Identities = 297/525 (56%), Positives = 403/525 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV 525
           MAK+I F++ AR  L  GV  L ++V+VT+GP+GRNV++ K +GAP+IT DGV++A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTATVLA  + +EGL+NV +GANP+ IKRG++K V ++V+++  ++K I  K+ I QVA+ISA  D  IG LI++AMEKVG DGVITVEEAKG+  EL VVEGMQFDRGY+S Y +TDT+KM A L +PYILITDKK+ +I DILP+LE++++ GR LLIIA+D++GEAL TL++NK+RG F  VAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+  +  T+  LG+A  + + K+ +TIV+G G +  IK R+  IK  I+ T SD+D++ L+ RLAKL  GVAVI+VGA +EVE+KEKK R++DAL+AT+AA+EEGIV GGG ALV  +K +  ++L L GDEK G  IV  A+  P+ QI +NAGF+  +V+ ++ +     +GFNA T  Y DM   GI+DP KVTR ALQNA S+++MLLTTE ++ D+
  S:     1 MAKQIVFNEEARRALERGVNALAESVRVTLGPKGRNVVLDKKFGAPLITNDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVAAGANPMGIKRGIEKAVESVVDDIKTNAKPIESKESIAQVASISAGDDN-IGVLISDAMEKVGKDGVITVEEAKGMTTELKVVEGMQFDRGYLSAYMITDTDKMEAILNDPYILITDKKIGAIADILPVLEKVVQAGRQLLIIAEDIEGEALATLILNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLKLENTTIDMLGRARQIRVTKEETTIVEGSGSQDDIKSRVEAIKKQIDETTSDFDREKLQERLAKLAGGVAVIQVGAATEVEMKEKKLRIEDALAATRAAVEEGIVAGGGCALVDAAKAL--DSLKLTGDEKTGVAIVYRALEEPLRQIANNAGFEGSIVVEKV-RNGGRGVGFNALTEAYEDMIAAGIVDPAKVTRSALQNAASIAAMLLTTECLVSDI 521
>gi|172065373|ref|YP_001816085.1| chaperonin GroEL [Burkholderia ambifaria MC40-6] >gi|171997615|gb|ACB68532.1| chaperonin GroEL [Burkholderia ambifaria MC40-6] (540 aa)
Score = 1366, Expect = 9.9e-149, Identities = 298/534 (55%), Positives = 406/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPA 535
           AK++KF DSAR ++  GV  L DAVKVT+GP+GRNV+I++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL K SK I+   EI QV +ISAN+D+ IG++IA+AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K  A L++  IL+ DKK+S+I+D+LP+LE   K G+PLLI+A+D+DGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G    K +L+DLG A+ V + K+++ I+ G G + +I+ R+  I+T IE T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  ++    +      D+  G QIV+ A+ +P+  I SNAG +  VVI ++L+    + G+NAATG+Y D+ + G++DP KVTR ALQNA S++ ++LTT+A + D  KD+K    PA
  S:     3 AKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQSIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEATSKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLR-ARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGKG-NFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPAQAPA 535
>gi|171319177|ref|ZP_02908296.1| chaperonin GroEL [Burkholderia ambifaria MEX-5] >gi|171095605|gb|EDT40566.1| chaperonin GroEL [Burkholderia ambifaria MEX-5] (540 aa)
Score = 1366, Expect = 1.0e-148, Identities = 297/538 (55%), Positives = 405/538 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM 539
           AK++KF DSAR ++  GV  L DAVKVT+GP+GRNVLI++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL K SK I+   EI QV +ISAN+D  IG++IA+AMEKVG +GVITVE+ K +++EL VVEGMQFDRGY+SPYF+ D  K  A L++  IL+ DKK+S+I+D+LP+LE   K G+PLLI+A+D+DGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G    K +L DLG+A+ V + K+++ I+ G G E +I  R+  I+T IE T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+ EGIV GGG AL+  ++    +      D+  G QIV+ A+ +P+  I SNAG +  VVI ++L+    + G+NAATG+Y D+ + G++DP KVTR ALQNA S++ ++LTT+A + D   D++ +  A P +
  S:     3 AKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVLIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADDAIGKIIADAMEKVGKEGVITVEDGKSLDNELEVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEATSKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEETGKQLQKASLDDLGRAKRVEVRKEDTIIIDGAGDEQRIDARVKSIRTQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVAEGIVPGGGVALLR-ARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGKG-NFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPAQAAAPEL 538
>gi|163858248|ref|YP_001632546.1| chaperonin GroEL [Bordetella petrii DSM 12804] >gi|163261976|emb|CAP44278.1| putative chaperonin GroEL [Bordetella petrii] (546 aa)
Score = 1366, Expect = 1.0e-148, Identities = 290/528 (54%), Positives = 405/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++ F D AR ++  GV  L +AVK T+GP+GRNV++++S+GAP +TKDGVSVAKE++L +  EN+GAQLVKDVASKT+D AGDGTTTATVLA  + +EGL+ V +G NPI++KRG+DK V+A V EL K SK +    EI QV +ISANSD+ IG++IA+AM+KVG +GVITVE+ K +++EL VVEGMQFDRGY+SPYF+ + +K +A L++PY+LI DKK+S+I+D+LP+LE++ K+ RPLLIIA+DV+GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG  ++++ G+S +K TLQ+LGQA+ + + K+N+TI+ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVI+VGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+   + I  +      D+  G ++++ A+  P+  IV+NAG +  VV+N +L     + G+NAATG+Y D+ + G++DP KVTR ALQNA SV+S+LLT EA + ++ +DK
  S:     3 AKQVLFGDDARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENIGAQLVKDVASKTSDNAGDGTTTATVLAQAIVQEGLKYVAAGFNPIDLKRGIDKAVSAAVAELAKQSKPVTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNPDKQVAALDDPYVLIFDKKISNIRDLLPVLEQVAKSSRPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPGFGDRRKAMLEDIAILTGGVVISEETGMSLEKATLQELGQAKRIEVGKENTTIIDGAGDSKSIEARVKQIRVQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALLRAKQAI-ADLKGDTADQNAGIKLILRAVEEPLRTIVTNAGEEASVVVNNVLNGKGNY-GYNAATGEYTDLVEQGVLDPTKVTRTALQNAASVASLLLTAEAAVVELSEDK 528
>gi|4433781|dbj|BAA22519.1| GroEL protein [Bacillus subtilis] (544 aa)
Score = 1366, Expect = 1.1e-148, Identities = 300/524 (57%), Positives = 402/524 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR     GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EGL+NV +GANP+ +++GM++ V   +  L + SK I  K+ I QVA ISA +D+++G LIA AME+VG+DGVIT+EE+KG   EL VVEGMQFDRGY SPY VTD++KM A L+NPYILITDKK+++I++ILP+LE++++ G+PLL+IA+DV+GEAL TLVVNK+RG FN VAVKAP FGD+RK +LEDIA+LTGG  +T+DLG+      +  LG+A  VV+ K+N+TIV+G G   +I  R+++I+  +E T S++D++ L+ RLAKL  GV VIKVGA +E ELKE+K R++DAL++T+AA+EEGIV GGG ALV+V  +  V  +   GD + G  IV+ A+  PI QI  NAG + G VI E LK     +GFNAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAV+ D
  S:     1 MAKEIKFSEEARRANLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGMEQAVALAIENLKEISKPIEGKESIAQVAAISA-ADEEVGSLIAEAMERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYLVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVITEDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFDREKLQERLAKLAGGVRVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNVYNK--VAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLE-GSVIVERLKNEEIGVGFNAATGEWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVAD 520
>gi|150015219|ref|YP_001307473.1| chaperonin GroEL [Clostridium beijerinckii NCIMB 8052] >gi|189082345|sp|A6LQ87|CH60_CLOB8 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|149901684|gb|ABR32517.1| chaperonin GroEL [Clostridium beijerinckii NCIMB 8052] (541 aa)
Score = 1366, Expect = 1.1e-148, Identities = 307/544 (56%), Positives = 416/544 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           MAK +KF + AR  +  GV +L D VKVT+GP+GRNV++ K +GAP+IT DGVS+A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANPI I+ G+   V+  V E+ K SK++  K++I +VA ISA +D+++G+LIA+AMEKVG++GVIT+EE+K +  EL VVEGMQFDRGY+SPY  TDT KM A LENPYILITDKK+S+I++ILP+LE+I+++G+ LLIIA+D++GEA+ TLVVNK+RG F  VAVKAP FGD+RK++L+DIA LTGG+ + ++LG     VT+  LG A+SV + K+N+ IV GKG  + IKERI++IK  IE T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKEKK R++DAL+ATKAA+EEGIV GGG A V+V   +   T + + D +IG  I++ ++  P+ QI +NAG + G VI E +K + P +G++A  G+Y++M + GI+DP KVTR ALQNA SV+S  LTTEA + D+   KE  +P  P MGM GM
  S:     1 MAKMLKFGEDARRSMQIGVDKLADTVKVTLGPKGRNVVLDKKFGAPLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPILIRTGIKMAVDKAVEEIQKISKQVDGKEDIARVAAISA-ADEEVGKLIADAMEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMATDTEKMEAVLENPYILITDKKISNIQEILPVLEQIVQSGKKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIATLTGGTVIAEELGRELKDVTIDMLGTADSVKVSKENTVIVNGKGDSNAIKERINQIKAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALAATKAAVEEGIVAGGGTAYVNVINEVAKLTSD-VADTQIGINIIVKSLEEPVRQIATNAGVE-GSVIIEKVKNSEPGIGYDALHGEYINMIKGGIVDPTKVTRSALQNAASVASTFLTTEAAVADIP-AKETPMPGAPGMGMDGM 540
>gi|167463819|ref|ZP_02328908.1| chaperonin GroEL [Paenibacillus larvae subsp. larvae BRL-230010] (542 aa)
Score = 1365, Expect = 1.2e-148, Identities = 310/538 (57%), Positives = 406/538 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           MAK+IKFS+ AR  +  GV  L DAVKVT+GP+GRNV+++K +G+P+IT DGV++AKE++L +  ENMGAQLVK+VA+KT D AGDGTTTATVLA  +  EGL+NV +GANP+ +++G+DK V A V EL K +K I  K  I QVA ISA +D ++GELIA AMEKVG DGVITVEE+KG   E+ +VEGMQFDRGY+SPY +TDT+KM A LENPYILITDKK+S+I++ILP+LE++++ G+ LLIIA+DV+GEA  TL+VNK+RG F  VAVKAP FGD+RK +L+DIA LTGG  +T++LG+      +  LG A  V + K+N+ IV G G +  I+ RI++I+  +E T S++DK+ L+ RLAKL  GV VIKVGA +E ELKE+K R++DAL+AT+AA+EEGIV GGG ALV+V     V  +   GDEK G  IV+ A+  P+  I +NAG  +G VI E LK     +G+NAATG++V+M + GI+DP KVTR ALQNA SV++M LTTEAVI D K +KE   PAMP+
  S:     1 MAKDIKFSEDARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDAFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAMITEGLKNVTAGANPMVVRKGIDKAVRAAVEELQKIAKPIEGKQNIAQVAAISA-ADDEVGELIAEAMEKVGKDGVITVEESKGFATEMEIVEGMQFDRGYVSPYMITDTDKMEAVLENPYILITDKKISNIQEILPVLEKVVQQGKALLIIAEDVEGEAQATLIVNKLRGTFTCVAVKAPGFGDRRKAMLQDIAALTGGQVITEELGLDLKSTAIDQLGSARQVRVTKENTIIVDGAGDKKDIEARINQIRAQLEETTSEFDKEKLQERLAKLAGGVGVIKVGAATETELKERKLRIEDALNATRAAVEEGIVAGGGTALVNVYNA--VAAVKAEGDEKTGVNIVLRALEEPVRTIAANAG-QEGSVIVERLKKEALGIGYNAATGEWVNMLEQGIVDPAKVTRSALQNAASVAAMFLTTEAVIAD-KPEKEK--PAMPD 531
>gi|109647333|ref|ZP_01371237.1| chaperonin GroEL [Desulfitobacterium hafniense DCB-2] >gi|109642579|gb|EAT52133.1| chaperonin GroEL [Desulfitobacterium hafniense DCB-2] (544 aa)
Score = 1365, Expect = 1.3e-148, Identities = 297/525 (56%), Positives = 402/525 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV 525
           MAK+I F++ AR  L  GV  L ++V+VT+GP+GRNV++ K +GAP+IT DGV++A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTATVLA  + +EGL+NV +GANP+ IKRG++K V ++V ++  ++K I  K+ I QVA+ISA  D  IG LI++AMEKVG DGVITVEEAKG+  EL VVEGMQFDRGY+S Y +TDT+KM A L +PYILITDKK+ +I DILP+LE++++ GR LLIIA+D++GEAL TL++NK+RG F  VAVKAP FGD+RK +LEDIAILTGG+ +T+DLG+  +  T+  LG+A  + + K+ +TIV+G G +  IK R+  IK  I+ T SD+D++ L+ RLAKL  GVAVI+VGA +EVE+KEKK R++DAL+AT+AA+EEGIV GGG ALV  +K +  ++L L GDEK G  IV  A+  P+ QI +NAGF+  +V+ ++ +     +GFNA T  Y DM   GI+DP KVTR ALQNA S+++MLLTTE ++ D+
  S:     1 MAKQIVFNEEARRALERGVNALAESVRVTLGPKGRNVVLDKKFGAPLITNDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVAAGANPMGIKRGIEKAVESVVEDIKTNAKPIESKESIAQVASISAGDDN-IGVLISDAMEKVGKDGVITVEEAKGMTTELKVVEGMQFDRGYLSAYMITDTDKMEAILNDPYILITDKKIGAIADILPVLEKVVQAGRQLLIIAEDIEGEALATLILNKLRGTFTCVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLKLENTTIDMLGRARQIRVTKEETTIVEGSGSQDDIKSRVEAIKKQIDETTSDFDREKLQERLAKLAGGVAVIQVGAATEVEMKEKKLRIEDALAATRAAVEEGIVAGGGCALVDAAKAL--DSLKLTGDEKTGVAIVCRALEEPLRQIANNAGFEGSIVVEKV-RNGGRGVGFNALTEAYEDMIAAGIVDPAKVTRSALQNAASIAAMLLTTECLVSDI 521
>gi|15964949|ref|NP_385302.1| chaperonin GroEL [Sinorhizobium meliloti 1021] >gi|7404334|sp|P35470|CH602_RHIME 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|15074128|emb|CAC45775.1| 60 KD chaperonin B (GroEL) protein [Sinorhizobium meliloti 1021] (542 aa)
Score = 1365, Expect = 1.3e-148, Identities = 292/539 (54%), Positives = 412/539 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMG 540
           AKE+KF+  AR+++  GV  + +AV+VT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VAS+T+D AGDGTTTATVLA  + +EG + V SG NP+++KRG+D  V AIV EL  +++K+++  EI QVATISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGM+FDRGY+SPYF+T+  KM  +LE+ YIL+ +KK+S+++ ++PILE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ ++++LGI  +  T+  LG+A+ +++DK+ +TIV G G +  I  R+++IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+ V   +N + T N   D+++G +IV  AI +P+ QI  NAG +  +++ ++ +  +   G+NA TG++ D+FQ G+IDP KV R ALQ+A S++ +L+TTEA+I   +  K+D  P MP  G
  S:     3 AKEVKFTSDARDRMLRGVDIMANAVRVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASRTSDIAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGIDLAVEAIVKELRNNARKVSKNAEIAQVATISANGDAEIGRYLAEAMEKVGNEGVITVEEAKTAEIELEVVEGMEFDRGYLSPYFITNQEKMRVELEDAYILLHEKKLSNLQAMIPILESVIQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKSMLEDIAILTGGTVISEELGIKLENTTMDTLGRAKRIMVDKETTTIVDGAGSKEDIGGRVAQIKAQIEDTTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRVVSALNGLATAN--DDQRVGIEIVRRAIEAPVRQIAENAGAEGSIIVGKLREKQDFAFGWNAQTGEFGDLFQMGVIDPAKVVRAALQDAASIAGLLVTTEAMI--AEKPKKDGQPQMPPGG 538
>gi|116749774|ref|YP_846461.1| chaperonin GroEL [Syntrophobacter fumaroxidans MPOB] >gi|187470721|sp|A0LKS4|CH602_SYNFM 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|116698838|gb|ABK18026.1| chaperonin GroEL [Syntrophobacter fumaroxidans MPOB] (542 aa)
Score = 1365, Expect = 1.3e-148, Identities = 307/542 (56%), Positives = 403/542 (74%)
  Q:     3 KEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           KEIK+   AR K+  GV  L DAVKVT+GPRGRNV+++KS+G P +TKDGV+VAKE+DL +  ENMGAQ+VK+VASKT+D AGDGTTTAT+LA  +++ G + V +G NP+ +KRG++  V A V EL   SK    + EI QV TISAN+D  IG++IA AM KVG +GVITVEEAK +   L VVEGMQFDRGY+SPYFVTD  +M   LE+PYILI +KK+S++KD+LP+LE+I K G PLLI+A+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LED+A+LTGG  V++D+G+  + V+LQDLG+A++V IDKDN+TIV G G  S I+ R+ +I+  I+ T SDYD++ L+ RLAK+  GVAV++VGA +E E+KEKK RV+DAL+AT+AA+EEGIV GGG AL+     +    L+L G++  G +IVM A+  P+ QI +NAG +  VV+ ++ + T  H GFNA T  Y D+   G+IDP KV R ALQNA SV+S+LLTTEA+I + K  K+   PAMP  GM  M
  S:     4 KEIKYYAEAREKIMAGVDTLADAVKVTLGPRGRNVVLEKSWGPPTVTKDGVTVAKEIDLEDKFENMGAQMVKEVASKTSDVAGDGTTTATILAQAIYRAGSKLVSAGHNPMALKRGIELAVAAAVRELRNMSKPTKDQKEIAQVGTISANNDVAIGDIIAEAMNKVGKEGVITVEEAKSMETTLEVVEGMQFDRGYVSPYFVTDPERMEVVLEDPYILINEKKISNMKDLLPVLEQIAKMGAPLLIVAEDVEGEALATLVVNKLRGTLKVSAVKAPGFGDRRKAMLEDLAVLTGGKVVSEDIGVKLENVSLQDLGRAKTVRIDKDNTTIVDGAGARSAIEARVKQIRAQIDETTSDYDREKLQERLAKIVGGVAVVRVGAATETEMKEKKARVEDALNATRAAVEEGIVPGGGVALLRCLPAL--EKLDLHGEDAFGVKIVMRALEEPVRQIANNAGHEGSVVVQQVKQGTGSH-GFNADTEVYEDLSAAGVIDPTKVVRFALQNAASVASLLLTTEAMIAE-KPKKQKPAPAMPGAGMEDM 541
>gi|134047129|ref|YP_001102020.1| chaperonin GroEL [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|157412103|ref|YP_001481444.1| chaperonin GroEL [Escherichia coli APEC O1] >gi|122975474|sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|99867128|gb|ABF67773.1| GroEL [Escherichia coli APEC O1] >gi|133905048|gb|ABO41063.1| 60 kDa chaperonin GroL [Salmonella enterica subsp. enterica serovar Newport str. SL254] (545 aa)
Score = 1365, Expect = 1.4e-148, Identities = 292/533 (54%), Positives = 402/533 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVP 534
           AK+I+F + AR ++  GV  L +AVK T+GP+GRNV+++KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG++ V +G NP+++KRG+DK V + V EL K SK  +   EI QV +ISANSD  IGELIA AM+KVG +GVITVEE  G+ +EL VVEGMQFDRGY+SPYF+ +   M A+LE+P+IL+ DKK+S+++D+LPILE + K G+PLLI+A+DV+GEAL TLVVN +RG+  V AVKAP FGD+RK +LED+AILTGG+ +++++G+S +K T+ DLG+A+ V + K+N+TI+ G G  + I+ RI +IK  IE T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+     I         D+  G  I + A+ +P+ +IV+NAG +  VV+N + + T    G+NAA G++ DM + GI+DP KVTR ALQNA S++ +++TTEA++ +    +E + P
  S:     3 AKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGIDKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDPFILLHDKKISNVRDLLPILEGVAKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPGFGDRRKAMLEDMAILTGGTVISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTADIEARIKQIKAQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRAKAAI-AELKGANEDQNHGIAIALRAMEAPLREIVTNAGDEPSVVLNRVAEGTGA-FGYNAANGEFGDMIEFGILDPTKVTRSALQNAASIAGLMITTEAMVAEAPKKEEPAAP 533
>gi|163781593|ref|ZP_02176593.1| GroEL [Hydrogenivirga sp. 128-5-R1-1] >gi|159882813|gb|EDP76317.1| GroEL [Hydrogenivirga sp. 128-5-R1-1] (545 aa)
Score = 1365, Expect = 1.4e-148, Identities = 305/538 (56%), Positives = 410/538 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEIL---KATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD-KEDSVPA-MPNM 539
           AK I +S+ AR KL +GV +L +AVKVT+GPRGR V++ K++G PV+TKDGV+VAKE++L +  EN+GAQLVK+VASKTAD AGDGTTTAT+LA  +F EGL+ + SGANP+++KRG+DK V  +V E+   S ++  + EI QVA ISAN+D +IG++IA+AME VG DGVITVEE+K     L  V+GMQFDRGY+SPYFVTD +KM   LE PYILI +KK+S+IKD+LP+LE++++ G+PLL+IA+DV+GEAL TLVVN ++GV    AVKAP FG +RK  L+DIA+LTGG+ + +DLGI  + VTL  LG+A+ VV+DK+ +TIV GKG E  IK RI +IK  I+ T SDYD++ L+ RLAKL+ GVAVI+VGA +E ELKEKK RV+DA+ ATKAA+EEGIV GGG ALV  S+ ++ V+  N   D+++G +I+  A  +P+ QI  NAGF+  VV+ +++   K      GFNAA G+YVDM + G+IDP KV R A++NA SV+  ++T EAVI D+ +D K+D  P  MP +
  S:     3 AKGIIYSEEARAKLKSGVDKLANAVKVTLGPRGREVILGKNWGTPVVTKDGVTVAKEIELKDNYENIGAQLVKEVASKTADVAGDGTTTATILAQAIFHEGLKAIASGANPMDVKRGIDKAVKKVVEEVKNLSVEVKGRTEIEQVAAISANNDPEIGKIIADAMEAVGKDGVITVEESKSAETTLETVQGMQFDRGYLSPYFVTDPDKMQCVLEEPYILIYEKKISNIKDLLPVLEQVVRAGKPLLVIAEDVEGEALATLVVNHIKGVLKACAVKAPGFGQRRKDYLQDIAVLTGGTAIMEDLGIKLESVTLDMLGRADKVVVDKETTTIVGGKGKEEDIKARIEQIKKQIQETTSDYDREKLQERLAKLSGGVAVIRVGAATEAELKEKKARVEDAVHATKAAVEEGIVPGGGVALVRASEDLDSVDVDN--EDQRLGVEIIKKACRTPLRQIAYNAGFEGFVVLEKVIELGKEKGKSWGFNAANGEYVDMMEAGVIDPTKVVRTAIENAASVAGTMITAEAVIADLPEDKKKDMTPTDMPEL 544
>gi|186458344|ref|ZP_02968653.1| chaperonin GroEL [bacterium Ellin514] >gi|184205212|gb|EDU02262.1| chaperonin GroEL [bacterium Ellin514] (547 aa)
Score = 1364, Expect = 1.5e-148, Identities = 307/534 (57%), Positives = 412/534 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPA 535
           AK++ F + AR  L  GV++L  AVK T+GP+GRNV++ K +G+P +TKDGV+VAKE++L +P ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA+PI ++RG+ K V+A V  L K +KK+  K+EI QVAT+SAN D  IGE+IA+AM+KVG DG ITVEEAK I   L VVEGMQFD+GY+SPYFVT+   M AKLE+ YIL  +KK+SS+KD+LPILE++ K G+PLLIIA+DV+GEAL TLVVNK+RG  N+ AVKAP FGD+RK ++EDIAILTGG  +T+DLGI  D + L+DLG+A+S+V+DK+N+TIV+G G  S+I+ R+++I+  IE T SDYD++ L+ RLAKL  GVAVI VGA +E E+KEKK RV+DAL AT+AA+EEGIV GGG AL+     I  ++L L GDE+IG +IV  AI +P+  + SNAG +  +V+ E+ K    + G+N AT +Y D+ + G++DP KVTR ALQNA S++ +LLTTE +I +V  +KE   PA
  S:     3 AKQLIFDEVARQSLLKGVEKLSRAVKATLGPKGRNVVLDKKFGSPTVTKDGVTVAKEIELEDPYENMGAQMVREVASKTSDTAGDGTTTATVLAEAIYREGLKNVTAGASPISLQRGIQKAVDAAVEHLAKIAKKVKDKEEIKQVATVSANWDTTIGEIIADAMDKVGKDGTITVEEAKSIETTLDVVEGMQFDKGYLSPYFVTNAESMEAKLEDAYILNYEKKISSLKDLLPILEKVAKIGKPLLIIAEDVEGEALATLVVNKLRGTLNICAVKAPGFGDRRKAMMEDIAILTGGKCITEDLGIKLDSIGLEDLGRAKSIVVDKENTTIVEGYGKSSEIQGRVNQIRRQIEETTSDYDREKLQERLAKLAGGVAVINVGAATETEMKEKKARVEDALHATRAAVEEGIVPGGGVALLRCLPAI--DSLKLEGDEQIGVEIVKRAIEAPLRALASNAGVEGSIVVQEV-KKRKGNDGYNVATNEYEDLVKAGVVDPKKVTRSALQNASSIAGLLLTTECLITEVP-EKEKPAPA 532
>gi|89256983|ref|YP_514345.1| chaperonin GroEL [Francisella tularensis subsp. holarctica] >gi|115315341|ref|YP_764064.1| chaperonin GroEL [Francisella tularensis subsp. holarctica OSU18] >gi|167010965|ref|ZP_02275896.1| chaperonin GroL [Francisella tularensis subsp. holarctica FSC200] >gi|122324668|sp|Q0BKF7|CH60_FRATO 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|166198459|sp|A7NE88|CH60_FRATF 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|108885294|sp|P94798|CH60_FRATH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|89144814|emb|CAJ80153.1| Chaperone protein, groEL [Francisella tularensis subsp. holarctica LVS] >gi|115130240|gb|ABI83427.1| chaperone GroEL [Francisella tularensis subsp. holarctica OSU18] >gi|134254049|gb|EBA53143.1| chaperone protein groEL [Francisella tularensis subsp. holarctica 257] (544 aa)
Score = 1364, Expect = 1.5e-148, Identities = 305/526 (57%), Positives = 394/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:     3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNHGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 526
>gi|184154802|ref|YP_001843142.1| chaperonin GroEL [Lactobacillus fermentum IFO 3956] >gi|183226146|dbj|BAG26662.1| chaperonin GroEL [Lactobacillus fermentum IFO 3956] (543 aa)
Score = 1364, Expect = 1.5e-148, Identities = 306/545 (56%), Positives = 409/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNM-GMGGMM 545
           MAKE+KFS+ AR+ +  GV +L D VK T+GP+GRNV++++SYG+P IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++K   A V  L K S  +  KD+I Q+A+ISA ++K++G+LIA+AMEKVG+DGVIT+E+++G++  + VVEGM FDRGY+S Y VTD +KM A L+NPY+LITDKK+S+I+DILP+L+ +++ GR LLIIADD+ GEAL TLV+NK+RG FNVVAVKAP FGD+RK  LEDIA+LTGG+ ++DDLG+     T+  LG A  V I KD +TIV G G +  I ER+ +IK AI  T SD+DK+ L+ RLAKL  GVAV+KVGA +E ELKEKK R++DAL+AT+AA++EG V GGG ALV+V   ++    +  GDE  G +IV +A+ +P+ QI  NAG +  V++N+ LK   P +G+NAA  K+ DM   GI+DP KVTR ALQNA SVS++LLTTEAV+ D K    D+ P  P   GMGGMM
  S:     1 MAKELKFSEDARSAMLRGVDKLADTVKTTIGPKGRNVVLEQSYGSPTITNDGVTIAKSIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVTEGMKNVTAGANPVGIRRGIEKATAAAVEGLKKMSHDVKTKDDIAQIASISA-ANKEVGKLIADAMEKVGNDGVITIEDSRGVDTSVDVVEGMSFDRGYMSQYMVTDNDKMEANLDNPYVLITDKKISNIQDILPLLQSVVQEGRALLIIADDITGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIAVLTGGTVISDDLGMQLKDATIDQLGSANKVTITKDATTIVDGSGNKEAIAERVDQIKKAIAETTSDFDKEKLQERLAKLAGGVAVVKVGAATETELKEKKYRIEDALNATRAAVQEGFVPGGGTALVNVIPALDEVEASATGDEATGIKIVKAALEAPVRQIAENAGLEGSVIVNQ-LKQEKPGVGYNAADDKFEDMVAAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD-KPQPADAAPQAPVAGGMGGMM 543
>gi|167757720|ref|ZP_02429847.1| hypothetical protein CLOSCI_00050 [Clostridium scindens ATCC 35704] >gi|167664602|gb|EDS08732.1| hypothetical protein CLOSCI_00050 [Clostridium scindens ATCC 35704] (541 aa)
Score = 1364, Expect = 1.6e-148, Identities = 296/528 (56%), Positives = 413/528 (78%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAKEIK+   AR+ L  GV QL D V+VT+GP+GRNV++ KS+GAP+IT DGV++AKE++L +  ENMGAQL+K+VASKT D AGDGTTTATVLA  +  EG++N+ +GANPI +++GM K  +  V+ + K S K+  KD+I +VA ISA  D ++GE++A+AMEKV +DGVIT+EE+K +  EL +VEGMQFDRGY+S Y  TD +KM A LE+PYILITDKK+S+I+DILP+LE+I+++G  LLIIA+D++GEALTTL+VNK+RG FNV AVKAP +GD+RK++L+DIAILTGG  ++D+LG+   + T++ LG+A+SV I K+N+ IV G G + +I +R+++IK  IE T SD+DK+ L+ RLAKL  GVAVI+VGA +E E+KE K R++DAL+AT+AA+EEGI+ GGG+A +H +K +     +L GDEK G  +V+ A+ SP+  I +NAG +  V+IN++ K ++P  GF+A T  YVDM ++GI+DP KVTR ALQNA SV+S LLTTE+V+ ++K++
  S:     1 MAKEIKYGAEARSALETGVNQLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDAFENMGAQLIKEVASKTNDVAGDGTTTATVLAQAMVHEGMKNLAAGANPIILRKGMKKATDKAVDAIAKMSSKVKDKDQIAKVAAISA-GDVEVGEMVADAMEKVSNDGVITIEESKTMKTELDLVEGMQFDRGYVSAYMATDMDKMEANLEDPYILITDKKISNIQDILPLLEQIVQSGARLLIIAEDIEGEALTTLIVNKLRGTFNVAAVKAPGYGDRRKEMLKDIAILTGGQVISDELGMDLKETTMEQLGRAKSVKIQKENTVIVDGIGDKKEIADRVAQIKAQIEETTSDFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKMRMEDALNATRAAVEEGIIAGGGSAYIHAAKEVAALAESLEGDEKTGANVVLKALESPLYHIAANAGLEGSVIINKV-KESDPGYGFDALTENYVDMVESGILDPAKVTRSALQNATSVASTLLTTESVVANIKEE 526
>gi|33595552|ref|NP_883195.1| chaperonin GroEL [Bordetella parapertussis 12822] >gi|33599950|ref|NP_887510.1| chaperonin GroEL [Bordetella bronchiseptica RB50] >gi|41016855|sp|Q7W134|CH60_BORPA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|41016862|sp|Q7WNS4|CH60_BORBR 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|33565630|emb|CAE40277.1| 60 kDa chaperonin [Bordetella parapertussis] >gi|33567547|emb|CAE31461.1| 60 kDa chaperonin [Bordetella bronchiseptica RB50] (547 aa)
Score = 1364, Expect = 1.6e-148, Identities = 293/528 (55%), Positives = 401/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++ F+D AR ++  GV  L +AVK T+GP+GRNV++++S+GAP +TKDGVSVAKE++L +  EN+GAQLVKDVASKT+D AGDGTTTATVLA  V +EGL+ V +G NPI++KRG+DK V A V EL K SK +    EI QV +ISANSD  IG++IA+AM+KVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+    K +A L++PY+LI DKKVS+I+D+LP+LE++ K+ RPLLIIA+DV+GEAL TLVVN +RG+    AVKAP FGD+RK +LEDIAILTGG+ ++++ G+S +K TLQDLGQA+ + + K+N+TI+ G G    I+ R+ +I+  IE   SDYD++ L+ R+AKL  GVAVI+VGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG AL+   + I         D+  G ++++ A+  P+  IV+NAG +  VV+N +L     + G+NAATG+Y D+ + G++DP KVTR ALQNA SV+S+LLT EA + ++ +DK
  S:     3 AKQVLFADEARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKFENIGAQLVKDVASKTSDNAGDGTTTATVLAQAVVQEGLKYVAAGFNPIDLKRGIDKAVAAAVEELKKLSKPVTTSKEIAQVGSISANSDASIGQIIADAMDKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINSPEKQVAALDDPYVLIYDKKVSNIRDLLPVLEQVAKSSRPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPGFGDRRKAMLEDIAILTGGTVISEETGMSLEKATLQDLGQAKRIEVAKENTTIIDGAGDGKSIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALLRAKQAIT-GLKGDTADQNAGIKLILRAVEEPLRTIVTNAGDEASVVVNTVLNGKGNY-GYNAATGEYGDLVEQGVLDPTKVTRTALQNAASVASLLLTAEAAVVELMEDK 528
>gi|157122796|gb|EDO66925.1| chaperone protein [Francisella tularensis subsp. holarctica FSC022] (544 aa)
Score = 1364, Expect = 1.7e-148, Identities = 305/526 (57%), Positives = 394/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:     3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNHGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 526
>gi|193213015|ref|YP_001998968.1| chaperonin GroEL [Chlorobaculum parvum NCIB 8327] >gi|193086492|gb|ACF11768.1| chaperonin GroEL [Chlorobaculum parvum NCIB 8327] (547 aa)
Score = 1364, Expect = 1.7e-148, Identities = 305/530 (57%), Positives = 400/530 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           AK+I F   AR KL  GV +L +AVKVT+GP GRNVLI K +GAP  TKDGV+VAKE++L +  ENMGAQ+V++VASKT+D AGDGTTTATVLA  +++EGL+NV +GA PI++KRG+D+ V  +V EL   S+ I+ K EI QV TISAN+D +IGELIA AM+KVG DGVITVEEAKG++ EL VVEGMQFDRGY+SPYFVT+   M A+LE   ILI DKK+S++K++LPILE+  ++GRPLLIIA+D++GEAL T+VVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ ++++ G   +  T+  LGQA  V IDKDN+TIV+GKG + +I  RI++IK  IE + SDYD + L+ RLAKL+ GVAV+ +GA +EVE+KEKK RV+DAL AT+AA++EGIV GGG AL+   K +   T +   D+K G  I+  A+  P+ QIV+N G   G V+ E +++     GFNA T +Y ++   G++DP KVTR AL+NA SV+S+LLTTEA I D+ +DK D
  S:     3 AKDILFDSDARAKLKVGVDKLANAVKVTLGPAGRNVLIDKKFGAPTSTKDGVTVAKEIELEDAFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIYREGLKNVAAGARPIDLKRGIDRAVKEVVAELRSISRNISGKKEIAQVGTISANNDPEIGELIAEAMDKVGKDGVITVEEAKGMDTELKVVEGMQFDRGYLSPYFVTNPETMEAELEEALILIYDKKISNMKELLPILEKSAQSGRPLLIIAEDIEGEALATIVVNKLRGTLKVAAVKAPGFGDRRKAMLEDIAILTGGTVISEEKGYKLENATMAYLGQASRVNIDKDNTTIVEGKGKQEEITARINEIKGQIEKSTSDYDTEKLQERLAKLSGGVAVLNIGASTEVEMKEKKARVEDALHATRAAVQEGIVAGGGVALIRAIKGLERATAD-NDDQKTGIDIIRRALEEPLRQIVANTGTTDGAVVLEKVRSGEGDYGFNARTEEYENLVDAGVVDPTKVTRSALENAASVASILLTTEAAITDLPEDKAD 531
>gi|15599581|ref|NP_253075.1| chaperonin GroEL [Pseudomonas aeruginosa PAO1] >gi|116052420|ref|YP_792731.1| chaperonin GroEL [Pseudomonas aeruginosa UCBPP-PA14] >gi|122257575|sp|Q02H55|CH60_PSEAB 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|12230880|sp|P30718|CH60_PSEAE 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|9950615|gb|AAG07773.1|AE004854_9 GroEL protein [Pseudomonas aeruginosa PAO1] >gi|115587641|gb|ABJ13656.1| GroEL protein [Pseudomonas aeruginosa UCBPP-PA14] (547 aa)
Score = 1364, Expect = 1.7e-148, Identities = 301/528 (57%), Positives = 405/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGD---EKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AKE+KF DSAR K+  GV  L DAVK T+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQLVKDVASK  D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK   AIV +L + +K  A    I QV TISANSD+ IG++IA AMEKVG +GVITVEE  G+ +EL+VVEGMQFDRGY+SPYFV   + M A+L++P +L+ DKK+S+I+++LP+LE + K GRPLLI+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILTGG+ +++++G+S +  TL+ LG A+ VVI+K+N+TI+ G G+++ I+ R+ +I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV   + I      L GD   + +G  ++  A+ SP+ QIV+NAG +  VV++++ K  + + GFNAATG Y DM + GI+DP KVTR ALQ A S+  +++TTEA++ ++ +DK
  S:     3 AKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATVAIVAQLKELAKPCADTKAIAQVGTISANSDESIGQIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMAAELDSPLLLLVDKKISNIREMLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISEEVGLSLEGATLEHLGNAKRVVINKENTTIIDGAGVQADIEARVLQIRKQIEETTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRALQAIE----GLKGDNEEQNVGIALLRRAVESPLRQIVANAGDEPSVVVDKV-KQGSGNYGFNAATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMITTEAMVAEIVEDK 528
>gi|90823064|gb|ABE01059.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823070|gb|ABE01062.1| 60 kDa chaperonin [Lactobacillus salivarius] (524 aa)
Score = 1364, Expect = 1.8e-148, Identities = 303/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK +DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V  L   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIDLEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEANLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VAALEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|90823062|gb|ABE01058.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823066|gb|ABE01060.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823068|gb|ABE01061.1| 60 kDa chaperonin [Lactobacillus salivarius] (525 aa)
Score = 1364, Expect = 1.8e-148, Identities = 303/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK +DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V  L   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIDLEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEANLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VAALEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|166031214|ref|ZP_02234043.1| hypothetical protein DORFOR_00901 [Dorea formicigenerans ATCC 27755] >gi|166029061|gb|EDR47818.1| hypothetical protein DORFOR_00901 [Dorea formicigenerans ATCC 27755] (541 aa)
Score = 1364, Expect = 1.8e-148, Identities = 294/528 (55%), Positives = 409/528 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           MAKEIK+   AR  L  GV QL D V+VT+GP+GRNV++ KS+GAP+IT DGV++AKE++L +P ENMGAQ++K+VASKT D AGDGTTTATVLA  +  EG++N+ +GANPI +++GM K  +A V  +   S K+  KD+I +VA ISA S++ +G+++A+AMEKV +DGVIT+EE+K +  EL +VEGMQFDRGYIS Y  TD +KM A LE+PYILITDKK+S+I++ILP+LE+I+++G  LLIIA+DV+GEALTTL+VNK+RG FNVVAVKAP +GD+RK++L+DIAILTGG  ++++LG+     T+  LG+A+SV + K+N+ IV G G +  I+ R+++IK  IE T S++DK+ L+ RLAKL  GVAVI+VGA +EVE+KE K R++DAL+AT+AA+EEGI+ GGG+A +H +K +      L GDEK G  +V+ A+ +P+  I +NAG +  V+IN++   + P +GFNA T +YVDM + GI+DP KVTR ALQNA SV+S LLTTE+ + ++K+D
  S:     1 MAKEIKYGAEARAALEAGVNQLADTVRVTLGPKGRNVVLDKSFGAPLITNDGVTIAKEIELEDPFENMGAQIIKEVASKTNDVAGDGTTTATVLAQAMVHEGMKNLAAGANPIILRKGMQKATDAAVEAIKNMSSKVNGKDQIAKVAAISAASEE-VGQMVADAMEKVSNDGVITIEESKTMKTELDLVEGMQFDRGYISAYMATDMDKMEANLEDPYILITDKKISNIQEILPVLEQIVQSGSRLLIIAEDVEGEALTTLIVNKLRGTFNVVAVKAPGYGDRRKEMLKDIAILTGGQVISEELGLELKDTTMDQLGRAKSVKVQKENTVIVDGCGDKDSIQARVAQIKAQIEDTTSEFDKEKLQERLAKLAGGVAVIRVGAATEVEMKEAKLRMEDALAATRAAVEEGIISGGGSAYIHAAKEVAKYAATLEGDEKTGANVVLKALEAPLFHIAANAGLEGSVIINKV-SESEPGVGFNALTEEYVDMVEAGILDPAKVTRSALQNATSVASTLLTTESCVANIKED 526
>gi|81427973|ref|YP_394972.1| chaperonin GroEL [Lactobacillus sakei subsp. sakei 23K] >gi|119366247|sp|Q38YR7|CH60_LACSS 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|78609614|emb|CAI54660.1| Chaperonin GroEL (60 kDa chaperonin) (Protein Cpn60) [Lactobacillus sakei subsp. sakei 23K] (541 aa)
Score = 1364, Expect = 1.8e-148, Identities = 305/545 (55%), Positives = 409/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGMM 545
           MAKE+KFS+ AR+K+  GV QL + VK T+GP+GRNV+++K+YG+P IT DGV++AK ++L +  ENMGA+LV +VASKT D AGDGTTTATVLA  + +EG++NV +GANP+ I+RG++      V +L++ S K+  KD I QVA +S+ ++++ G LIA+AMEKVG+DGVITVEE+KGI+ EL+VVEGMQFDRGY+S Y VTD +KM A L+NPYILITDKK+S+I+D+LP+L+ I++ G+ LLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK+ LEDIA LTG + +T DLG+   + T+  LG A  V + KD++TIV+G G +S I ER+  IK  I  T SD+D++ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG AL+ V +  +V  L   GD + G  IV+ A+  P+ QI +NAG + G VI E +K+    +G+NAA G + +M + GI+DP KVTR ALQNA SV++++LTTEAV+ D  +D       M    MGGMM
  S:     1 MAKELKFSEDARSKMLAGVDQLANTVKTTLGPKGRNVVLEKAYGSPEITNDGVTIAKAIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLAQAIIREGMKNVTAGANPVGIRRGIELATREAVKKLHEISHKVESKDAIAQVAAVSS-ANEETGRLIADAMEKVGNDGVITVEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITDKKISNIQDVLPLLQSIVQEGKALLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKEQLEDIATLTGATVITSDLGLELKETTIDQLGTAGKVTVTKDDTTIVEGAGSKSAIAERVENIKKQIAETTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEQKYRIEDALNATRAAVEEGYVAGGGTALIDVIE--SVAALEEEGDVQTGINIVLRALEEPVRQIATNAGLE-GSVIVEKVKSQPVEVGYNAANGNWENMIEAGILDPTKVTRSALQNAASVAALMLTTEAVVADKPEDNPAPAAGMDPSAMGGMM 541
>gi|182704245|ref|ZP_02956656.1| chaperonin GroEL [Methylocella silvestris BL2] >gi|172066759|gb|EDT52884.1| chaperonin GroEL [Methylocella silvestris BL2] (547 aa)
Score = 1363, Expect = 1.9e-148, Identities = 295/536 (55%), Positives = 415/536 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMP 537
           AK+++FS  AR+++  G+  L +AVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L++  EN+GAQL+++VASK  D AGDGTTTAT+LA  + +EG + V +G NP+++KRG+D  V A+V +L  +SKK+   +EI QV TISAN DK +GE+I+ AM+KVG++GVITVEEAK +  EL VVEGMQFDRGY+SPYF+T+  KMIA+LE+P+IL+ +KK+SS++ +LP+LE ++++G+PL+IIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G+ +++++GI  + VTLQ LG+A+ + IDK+++TI+ G G + +I+ RI++IK+ I  T SDYD++ ++ RLAKL  GVAVI+VG  SEVE+KEKKDRVDDAL+AT+AA+EEG++ GGG AL+   K +   T+    D+K G  IV  AI +P  QIV N+G D  VV+ ++++  +   G+NA T +Y D+ + GIIDP KV R ALQ+A SV  +L+TTEA+I   +  K+DS PAMP
  S:     3 AKDVRFSSDARDRMLRGIDILNNAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELSDKFENLGAQLIREVASKQNDAAGDGTTTATILAASIVREGTKAVAAGLNPMDLKRGIDIAVAAVVADLKANSKKVTSNEEIAQVGTISANGDKSVGEMISTAMQKVGNEGVITVEEAKSLETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDPFILVHEKKLSSLQALLPVLEAVVQSGKPLVIIAEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTSGTLISEEIGIKLENVTLQMLGRAKRIRIDKESTTIIDGAGAKGEIEARIAQIKSQIAETTSDYDREKMQERLAKLAGGVAVIRVGGASEVEVKEKKDRVDDALNATRAAVEEGVLPGGGVALLRAIKALEGLTVE-NADQKTGVDIVRKAIQTPARQIVDNSGGDGAVVVGKLIENPSYAYGYNAQTDEYGDLVKLGIIDPTKVVRTALQDAASVGGLLITTEAII--AEQPKKDS-PAMP 534
>gi|188584508|ref|YP_001927953.1| chaperonin GroEL [Methylobacterium populi BJ001] >gi|179348006|gb|ACB83418.1| chaperonin GroEL [Methylobacterium populi BJ001] (546 aa)
Score = 1363, Expect = 1.9e-148, Identities = 300/523 (57%), Positives = 404/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPH-LGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK+++FS  AR+K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+D    A V ++   +KK+A  +E+ QV TISAN DK+IGE+IA+AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+  KM+A+LE+PYILI +KK+SS++ +LP+LE +++TG+PLLIIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  +++DLGI  + V L  LG+A+ V I+K+N+TI+ G G ++ I+ R+ +IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL+AT+AA+EEGIV GGG AL+   K +     + + D + G +IV+ A+ +PI QI  NAG +  +V+ +I   T     GFNA T +YVDM Q+GI+DP KV R ALQ+A SV+ +L+TTEA++ D
  S:     3 AKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKFVAAGINPMDLKRGIDLATQAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAVVQTGKPLLIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQTISEDLGIKLENVALPMLGRAKRVRIEKENTTIIDGLGEKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGTALLRAKKAV-AELKSDVPDVQAGIKIVLKALEAPIRQIAQNAGVEGSIVVGKITDNTGSETYGFNAQTEEYVDMIQSGIVDPAKVVRTALQDAASVAGLLVTTEAMVAD 525
>gi|167590159|ref|ZP_02382547.1| chaperonin GroEL [Burkholderia ubonensis Bu] (547 aa)
Score = 1363, Expect = 2.0e-148, Identities = 290/523 (55%), Positives = 406/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AKEI FSD AR KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A V+EL K SK      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++ENPYIL+ DKK+S+I+++LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G  + I+ R+ +I+  I+   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I   T     D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + +  + G+NA TG+Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +++
  S:     3 AKEIIFSDVARAKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVAAAVDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIENPYILLHDKKISNIRELLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAASIEARVKQIRVQIDEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVKQAIRELT-GANADQHAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGSG-NFGYNAQTGEYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVHE 523
>gi|27468547|ref|NP_765184.1| chaperonin GroEL [Staphylococcus epidermidis ATCC 12228] >gi|57867363|ref|YP_189050.1| chaperonin GroEL [Staphylococcus epidermidis RP62A] >gi|68566256|sp|Q5HMZ1|CH60_STAEQ 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|82581645|sp|P0C0N7|CH60_STAES 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat shock protein 60) >gi|27316094|gb|AAO05228.1|AE016749_174 GroEL protein [Staphylococcus epidermidis ATCC 12228] >gi|57638021|gb|AAW54809.1| chaperonin, 60 kDa [Staphylococcus epidermidis RP62A] (539 aa)
Score = 1363, Expect = 2.0e-148, Identities = 293/531 (55%), Positives = 406/531 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKED 531
           MAK++KFS+ AR  +  GV +L +AVKVT+GP+GRNV++ K Y  P+IT DGV++AKE++L +P ENMGA+LV++VA+KT + AGDGTTTATVLA  + +EGL+NV SGANP+ +++G+DK V   +  L++ S+K+  K+EI QV  ISA +D++IG  I+ AM+KVG+DGVIT+EE+ G N EL VVEGMQFDRGY SPY VTD++KMIA+LE PYIL+TDKK+SS +DILP+LE++++  RP+LI+AD+V+G+ALT +V+N+MRG F  VAVKAP FGD+RK +LED+AILTG   +TDDLG+     +L  LG A  V + KD++T+V G G E+ I  R+ +IK  IE TDS++DK+ L+ RLAKL  GVAVIKVGA SE ELKE+K R++DAL++T+AA+EEGIV GGG ALV++ ++  V+ +   GD + G  IV+ A+ +P+ QI  NAG + G +I E LK     +GFNAAT ++V+M + GI+DP KVTR ALQ+A SV++M LTTEAV+  + + + +
  S:     1 MAKDLKFSEDARQAMLRGVDKLANAVKVTIGPKGRNVVLDKDYTTPLITNDGVTIAKEIELEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQSMIQEGLKNVTSGANPVGLRQGIDKAVQVAIEALHEISQKVENKNEIAQVGAISA-ADEEIGRYISEAMDKVGNDGVITIEESNGFNTELEVVEGMQFDRGYQSPYMVTDSDKMIAELERPYILVTDKKISSFQDILPLLEQVVQASRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVITDDLGLELKDASLDMLGTANKVEVTKDHTTVVDGNGDENNIDARVGQIKAQIEETDSEFDKEKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNIYQK--VSEIKAEGDVETGVNIVLKALQAPVRQIAENAGLE-GSIIVERLKHAEAGVGFNAATNEWVNMLEEGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEPENN 527
>gi|86356911|ref|YP_468803.1| chaperonin GroEL [Rhizobium etli CFN 42] >gi|119366223|sp|Q2KAR0|CH603_RHIEC 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|86281013|gb|ABC90076.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (544 aa)
Score = 1363, Expect = 2.1e-148, Identities = 296/543 (54%), Positives = 401/543 (73%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           AKEIKFS  AR  L  GV+ L +AVKVT+GP+GRNV+I K+YGAP ITKDGV+VA+E++L N  ENMGAQ+V++VASKT D AGDGTTTATVLA  +F+EG + V +G NP++++RG+D  V+AIV E+   ++K+    EI QV  I+AN D  +GE+IA AMEKVG++GVITVEEA+    EL VVEGMQFDRGY+SPYFVT+  KM  +LE+PYIL+ +KK+ S++ +LPILE +++TG+PLL+I++DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIA LT G  +++DLGI  + VTL  LG+A+ V+I+KD +TI+ G G ++ I+ RI ++K  IE T SDYDK+ L+ RLAKL  GVAVI+VG  +E E+KEKKDR++DAL+AT+AA+EEGIV GGG AL+  +K      +    D   G  IV+ A+ +PI QI  NAGF+  +++  +    + + GF+A T  YVDM + GI+DP KV R ALQ+A S++++L+T E +I D+     +  PA+ N GMG M
  S:     3 AKEIKFSTDARAHLLRGVELLNNAVKVTLGPKGRNVVIDKAYGAPRITKDGVTVAREIELGNKFENMGAQMVREVASKTNDLAGDGTTTATVLAASIFREGAKLVAAGMNPMDLRRGIDLGVSAIVKEIQARARKVKSSGEIAQVGAIAANGDATVGEMIAKAMEKVGNEGVITVEEARTAETELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDPYILLHEKKLGSLQALLPILEAVVQTGKPLLLISEDVEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAALTSGQMISEDLGIKLENVTLYMLGRAKRVLIEKDTTTIIDGTGEKAAIQARIQQMKAQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATETEVKEKKDRIEDALNATRAAVEEGIVPGGGVALLR-AKSALTGMVGENADVTAGISIVLRALEAPIRQIAENAGFEGSIIVGRLTGRNDHNQGFDAQTETYVDMVEAGIVDPAKVVRTALQDAGSIAALLITAEVMIADIP--ARNPAPAVGNGGMGDM 542
>gi|78063463|ref|YP_373371.1| chaperonin GroEL [Burkholderia sp. 383] >gi|119366174|sp|Q391Y9|CH601_BURS3 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|77971348|gb|ABB12727.1| Chaperonin Cpn60/GroEL [Burkholderia sp. 383] (546 aa)
Score = 1363, Expect = 2.2e-148, Identities = 289/527 (54%), Positives = 405/527 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDD 528
           AKEI FSD AR KL  GV  L +AVKVT+GP+GRNV++++S+GAPV+TKDGVSVAKE++L + ++N+GAQLVK+VAS+T+D AGDGTTTATVLA  + +EG + V +G NP+++KRG+DK V A V+EL K S+      EI QVATISAN ++ IG+ IA A+++VG +GVITVE+ K + DEL VVEG+QFDRGY+SPYF+ + +K IA++E+PYIL+ DKK+S+I+D+LP+LE++ K+GRPLLIIA+DV+GEAL TLVVN +RG+   VAVKAP FGD+RK +LEDIAILTGG  + ++ G++ +K TL +LGQA+ + + K+N+T++ G G    I+ R+ +I+  I+   SDYD++ L+ R+AKL  GVAVIKVG  +E+E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+ V + I      +  D+  G +IV+ A+  P+ QIV+NAG +  VV+ ++ + +  + G+NA TG Y D+ ++G++DP KVTR ALQNA SV+ +LLTT+A +++   D
  S:     3 AKEIIFSDVARAKLTEGVNILANAVKVTLGPKGRNVVLERSFGAPVVTKDGVSVAKEIELADKLQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVAAAVDELKKISRPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLADELDVVEGLQFDRGYLSPYFINNPDKQIAEIESPYILLHDKKISNIRDLLPVLEQVAKSGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKALLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTVIDGAGDAKNIEARVKQIRVQIDEATSDYDREKLQERVAKLAGGVAVIKVGGATEIEVKEKKDRVDDALHATRAAVEEGIVPGGGVALIRVRQAIR-ELQGVNADQNAGIKIVLRALEEPLRQIVTNAGEEASVVVAKVAEGSG-NFGYNAQTGVYGDLVESGVLDPTKVTRTALQNAASVAGLLLTTDATVFEAPKD 527
>gi|115361133|ref|YP_778270.1| chaperonin GroEL [Burkholderia ambifaria AMMD] >gi|122319442|sp|Q0B1N7|CH603_BURCM 60 kDa chaperonin 3 (Protein Cpn60 3) (groEL protein 3) >gi|115286461|gb|ABI91936.1| chaperonin GroEL [Burkholderia ambifaria AMMD] (540 aa)
Score = 1363, Expect = 2.2e-148, Identities = 297/534 (55%), Positives = 406/534 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV-KDDKEDSVPA 535
           AK++KF DSAR ++  GV  L DAVKVT+GP+GRNV+I++S+GAP ITKDGVSVAKE++L +  ENMGAQ+VK VASKTAD AGDGTTTATVLA  + +EG+++V +G NP+++KRG+DK V A+++EL K SK I+   EI QV +ISAN+D+ IG++IA+AMEKVG +GVITVE+ K + +EL VVEGMQFDRGY+SPYF+ D  K  A L++  IL+ DKK+S+I+D+LP+LE   K G+PLLI+A+D+DGEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIAILTG + ++++ G    K +L+DLG A+ V + K+++ I+ G G + +I+ R+  I+T I+ T SDYD++ L+ R+AKL  GVAVIKVGA +EVE+KEKKDRVDDAL AT+AA+EEGIV GGG AL+  ++    +      D+  G QIV+ A+ +P+  I SNAG +  VVI ++L+    + G+NAATG+Y D+ + G++DP KVTR ALQNA S++ ++LTT+A + D  KD+K    PA
  S:     3 AKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDALILLHDKKISNIRDLLPVLEATSKAGKPLLIVAEDIDGEALATLVVNAMRGILKVAAVKAPGFGDRRKAMLEDIAILTGATVISEETGKQLQKASLEDLGSAKRVEVRKEDTIIIDGAGDQERIEARVKSIRTQIDETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDALHATRAAVEEGIVPGGGVALLR-ARSTATSLKGANSDQDAGIQIVLRALEAPLRVIASNAGDEPSVVIAKVLEGKG-NFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTTDATVADAPKDEKPAQAPA 535
>gi|90823056|gb|ABE01055.1| 60 kDa chaperonin [Lactobacillus salivarius] (522 aa)
Score = 1363, Expect = 2.2e-148, Identities = 304/524 (58%), Positives = 405/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK +DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V TL   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIDLEDYFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VATLEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|83590955|ref|YP_430964.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073] >gi|119366202|sp|Q2RGL8|CH602_MOOTA 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|83573869|gb|ABC20421.1| chaperonin GroEL [Moorella thermoacetica ATCC 39073] (536 aa)
Score = 1363, Expect = 2.3e-148, Identities = 290/529 (54%), Positives = 405/529 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           MAK++ F   AR  L  G+ +L +AV+VT+GPRGRNV+++K +GAP IT DGV++AKEV+L +P+EN+GA LV++VASKT D AGDGTTTA VLA  + +EG++NV +GANP+ +KRG++K V A+V  L   ++ +  KD I QVA+ISAN D +IG L+A+AMEKVG DGVITVEE+KG+   + VVEGMQFDRGYISPY VTD  +M A LE PYILITDKK++++ D++P+LE +++TG+PLLII +D++GEAL TLVVNK+RG F  VAVKAP FGD+RK +L+DIAILTGG  +T++ G+  +  TL  LGQA  V + K+ +TIV+G+G E  I+ RI++I+   E + SDYD++ L+ RLAKL  GVAVIKVGA +E E+KEKK R++DAL+AT+AA+EEGIV GGG ALV    +  ++ +   GDE  G ++V  A+  P+ QI +NAG D  VV+ ++ + +   +GFNAAT +YV++F+ GI+DP+KVTR AL+NA S++S++LTTE++I D+ +++
  S:     1 MAKQVVFDREAREALEKGITKLTEAVRVTLGPRGRNVVLEKKFGAPTITNDGVTIAKEVELEDPLENVGALLVREVASKTNDVAGDGTTTACVLAQAIVREGMKNVAAGANPMFMKRGIEKAVAAVVENLKAQARPVETKDSISQVASISAN-DPQIGALVADAMEKVGKDGVITVEESKGMETAVDVVEGMQFDRGYISPYMVTDNERMEAVLEEPYILITDKKITAVADLVPVLERVVRTGKPLLIICEDMEGEALATLVVNKIRGTFTCVAVKAPAFGDRRKAMLQDIAILTGGQVITEEAGLKLENTTLDMLGQARQVRVGKEETTIVEGRGKEEAIEARIAQIRREYEESTSDYDREKLQERLAKLAGGVAVIKVGAATETEMKEKKMRIEDALAATRAAVEEGIVPGGGTALVRA--QTALDGVQAQGDELTGVRLVYRALEEPMRQIAANAGVDGSVVVEKV-RQSGDSMGFNAATREYVNLFEAGIVDPLKVTRSALENAASIASLVLTTESLIADIPEEE 525
>gi|182419430|ref|ZP_02950682.1| chaperonin GroL [Clostridium butyricum 5521] >gi|182376761|gb|EDT74333.1| chaperonin GroL [Clostridium butyricum 5521] (542 aa)
Score = 1363, Expect = 2.4e-148, Identities = 304/544 (55%), Positives = 413/544 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           MAK +KF + AR  +  GV +L D VKVT+GP+GRNV++ K +GAP+IT DGVS+A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANPI ++ G+   V   V E+ K+SK++  K++I +VA ISA +D+++G+LIANAMEKVG++GVIT+EE+K +  EL VVEGMQFDRGY+SPY  TDT KM A LENPYILITDKK+++I++ILPILEEI+KTG+ LLIIA+D++GEA+ TLVVNK+RG F  VAVKAP FGD+RK++L+DIAILTGG+ + ++LG    +VT+  LG A+SV + K+N+ IV GKG  ++IKER+++I+  IE T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKEKK R++DAL+ATKAA+EEGIV GGG A V+V   +   T + + D +IG  I++ A+  P+ QI  NAG +  V+I ++ K + P +G++A   +Y +M ++GI+DP KVTR ALQNA SV+S  LTTEA + D+           P MGM GM
  S:     1 MAKMLKFGEEARRAMQIGVDKLADTVKVTLGPKGRNVVLDKKFGAPLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPILLRNGIKVAVEKAVEEIKKNSKQVEGKEDIARVAAISA-ADEEVGQLIANAMEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMATDTEKMEAVLENPYILITDKKITNIQEILPILEEIVKTGKKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGTVIAEELGRDLREVTIDMLGTADSVKVSKENTVIVNGKGNSAEIKERVNQIRAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALNATKAAVEEGIVAGGGTAYVNVINEVAKLTSD-VQDSQIGINIIVKALEEPVRQIAINAGVEGSVIIEKV-KNSEPGVGYDALHDEYKNMLKSGIVDPTKVTRSALQNAASVASTFLTTEAAVADIPSKDPVMPGGAPGMGMDGM 541
>gi|163795486|ref|ZP_02189452.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199] >gi|159179085|gb|EDP63618.1| Chaperonin Cpn60/TCP-1 [alpha proteobacterium BAL199] (552 aa)
Score = 1363, Expect = 2.4e-148, Identities = 289/528 (54%), Positives = 402/528 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDK 529
           AK++KF+  AR+++  GV  L +AVKVT+GP+GRNV++QKS+GAP ITKDGV+VAKE++L++  ENMGAQ+VK+VASKT+D AGDGTTTATVLA  + +EG+R V +G NP+++KRG+D  V A+V ++   +KKI   DEI QV TISAN  K IGE+IA AM+KVG +GVITVEEAK +  EL +VEGMQFDRGY+SPYFVT+ +KM+ +LE+P ILI +KK+S ++ +LP+LE++ +  RPLLI+A+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG A+ V + KD +TIV G G +  I+ R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +E+E+KE+KDRVDDA+ AT+AA+EEGIV GGG AL++ +K I+  T     D++ G+ I+  A+ +P  QI  NAG D  +++ ++L+  +   G+NA TG + D+ + G+IDP KV R ALQ+A S++ +L+TTEA++ D  + K
  S:     3 AKDVKFNVDARDRMLRGVDILANAVKVTLGPKGRNVVLQKSFGAPRITKDGVTVAKEIELSDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGVRAVAAGMNPMDLKRGIDLAVEAVVADVKSRTKKIKTSDEIAQVGTISANGAKDIGEMIAKAMDKVGREGVITVEEAKSLGTELDIVEGMQFDRGYLSPYFVTNADKMVCELESPLILIHEKKLSGLQAMLPLLEQVARGQRPLLILAEDIEGEALATLVVNKLRGGLKVSAVKAPGFGDRRKAMLEDIAILTGGTVISEDLGIQLENVTLDMLGTAKKVSLTKDTTTIVDGAGKKKDIQARCAQIRAQIEDTTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKERKDRVDDAMHATRAAVEEGIVPGGGTALLYAAKAIDKLTPG-NADQRTGFDIIRRALQAPARQIAENAGADGSIIVGKLLEQKSTSFGYNAQTGVFEDLIKAGVIDPTKVVRTALQDAASIAGLLITTEAMVADKPEPK 529
>gi|187931105|ref|YP_001891089.1| chaperonin GroEL (HSP60 family) [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712014|gb|ACD30311.1| chaperonin GroEL (HSP60 family) [Francisella tularensis subsp. mediasiatica FSC147] (544 aa)
Score = 1363, Expect = 2.4e-148, Identities = 305/526 (57%), Positives = 394/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:     3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGINPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNHGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 526
>gi|115504858|sp|Q93GT6|CH60_TETHA 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|49659608|dbj|BAB70661.2| chaperonin 60 [Tetragenococcus halophilus] (546 aa)
Score = 1362, Expect = 2.5e-148, Identities = 307/545 (56%), Positives = 409/545 (75%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAM-----PNMGMGGMM 545
           MAK+IKFS+ AR  + NGV +L D VKVT+GPRGRNV+++KSYG+P+IT DGV++AKE++L N  ENMGAQLV +VASKT D AGDGTTTATVLA  +  EGL+NV SGANP+ I+RG+++     V EL   S  +  K+ I+QV  +S+ S K++G+ IA+AM+KVG+DGVIT+E+++GI+ EL VVEGMQFDRGY+S Y VTD  KM A L++PYILITDKK+S+I+DILP+LE++++  +PLLIIADD+DGEAL TLV+NK+RG FNVVA KAP FGD+RK +LEDIA+LTG + +T+DLG+     T+  LG+A  V +DKDN+TIV+G G  + I++R+  IK  +  T SD+D++ L+ RLAKL  GVAVIKVGA +E E KE K R++DAL+A +A +EEG+V GGG ALV+V  +  V  L+   D   G  IV+ A+  P+ QI  NAGF+  V+I E LK+    +GFNAATG++V+M   GI+DP KV R ALQNA S+S++LL+TEAVI D  D+  +   A      P+M  GGMM
  S:     1 MAKDIKFSEDARRSMLNGVSKLADTVKVTLGPRGRNVVLEKSYGSPLITNDGVTIAKEIELENRFENMGAQLVSEVASKTNDIAGDGTTTATVLAQSIVSEGLKNVTSGANPLGIRRGIEQATQKAVEELQNISTPVESKEAIVQVGEVSSGS-KQVGQYIADAMDKVGNDGVITIEDSQGIDTELDVVEGMQFDRGYLSQYMVTDNEKMEADLDSPYILITDKKISNIQDILPLLEQVVQESKPLLIIADDIDGEALPTLVLNKIRGTFNVVATKAPGFGDRRKAMLEDIAVLTGATVITEDLGLELKDATMDSLGKANKVTVDKDNTTIVEGAGDSTAIEDRVQLIKNQVAETTSDFDREKLQERLAKLAGGVAVIKVGAATETEQKELKLRIEDALNAARAGVEEGMVSGGGTALVNVINK--VAELDADDDAITGVNIVLRALEEPVRQISENAGFEGSVII-EKLKSEKLGIGFNAATGQWVNMVDAGIVDPTKVVRSALQNAASISALLLSTEAVIADRPDESGNDAGAGAQGMDPSMMGGGMM 546
>gi|27380737|ref|NP_772266.1| chaperonin GroEL [Bradyrhizobium japonicum USDA 110] >gi|68566296|sp|Q89IK8|CH606_BRAJA 60 kDa chaperonin 6 (Protein Cpn60 6) (groEL protein 6) >gi|27353902|dbj|BAC50891.1| 60 KDA chaperonin [Bradyrhizobium japonicum USDA 110] (546 aa)
Score = 1362, Expect = 2.5e-148, Identities = 298/524 (56%), Positives = 412/524 (78%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDV 525
           AKE+KFS  AR+K+  GV  L +AVKVT+GP+GRNV++ KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASK+AD AGDGTTTATVLA  + +EG ++V +G NP+++KRG+D  V A+V +L K+SKK+   DEI QV TISAN D +IG+ +A+AM+KVG++GVITVEEAK +  EL VVEGMQFDRGYISPYFVT+ +KM  ++++ YILI +KK+SS+ ++LP+LE +++TG+PL+I+A+DV+GEAL TLVVN++RG   V AVKAP FGD+RK +L+DIAILTGG  +++DLGI  + VTL  LG+A+ V+IDK+N+TIV G G ++ I+ R+S+IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KE+KDRVDDA+ AT+AA+EEGIV GGG AL+  S+++  + T N   D+K G +IV  A+ +P  QI  NAG D  V++ +IL+      GF++ TG+YV++   GIIDP KV R A+QNA SV+++L+TTEA++ ++
  S:     3 AKEVKFSVDARDKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDAEIGKFLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDDAYILINEKKLSSLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMLQDIAILTGGQAISEDLGIKLENVTLNMLGRAKKVMIDKENTTIVNGAGKKADIEARVSQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKERKDRVDDAMHATRAAVEEGIVPGGGVALLRASEQLKGLRTKN--DDQKTGVEIVRKALSAPARQIAINAGEDGSVIVGKILENKTYAYGFDSQTGEYVNLVTKGIIDPTKVVRTAIQNAASVAALLITTEAMVAEL 525
>gi|90823058|gb|ABE01056.1| 60 kDa chaperonin [Lactobacillus salivarius] (524 aa)
Score = 1362, Expect = 2.5e-148, Identities = 303/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK +DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V  L   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIDLEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VAALEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|156452422|ref|ZP_02058793.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4] >gi|163854178|ref|YP_001642221.1| chaperonin GroEL [Methylobacterium extorquens PA1] >gi|156188682|gb|EDO20880.1| chaperonin GroEL [Methylobacterium chloromethanicum CM4] >gi|163665783|gb|ABY33150.1| chaperonin GroEL [Methylobacterium extorquens PA1] (546 aa)
Score = 1362, Expect = 2.6e-148, Identities = 299/523 (57%), Positives = 404/523 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           AK+++FS  AR+K+  GV  L DAVKVT+GP+GRNV+I+KS+GAP ITKDGV+VAKE++L +  ENMGAQ+V++VASKT D AGDGTTTATVLA  + +EG + V +G NP+++KRG+D    A V ++   +KK+A  +E+ QV TISAN DK+IGE+IA+AM+KVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+  KM+A+LE+PYILI +KK+SS++ +LP+LE +++TG+PL+IIA+D++GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILT G  +++DLGI  + V L  LG+A+ V I+K+ +TI+ G G ++ I+ R+ +IK  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL+AT+AA+EEGIV GGG AL+ ++K+      + I D + G +IV+ A+ +PI QI SNAG +  +V+ +I        GFNA T +YVDM Q GI+DP KV R ALQ+A SV+ +L+TTEA++ D
  S:     3 AKDVRFSADARDKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADRFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGINPMDLKRGIDLATAAAVKDITARAKKVASSEEVAQVGTISANGDKEIGEMIAHAMQKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNAEKMVAELEDPYILIHEKKLSSLQPMLPVLEAVVQTGKPLVIIAEDIEGEALATLVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAILTKGQTISEDLGIKLENVALPMLGRAKRVRIEKETTTIIDGLGEKADIEARVGQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVPGGGVALL-LAKKAVAELKSDIPDVQAGIKIVLKALEAPIRQIASNAGVEGSIVVGKITDNGGETFGFNAQTEEYVDMIQAGIVDPAKVVRTALQDAASVAGLLVTTEAMVAD 524
>gi|90823050|gb|ABE01052.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823052|gb|ABE01053.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823054|gb|ABE01054.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823076|gb|ABE01065.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823078|gb|ABE01066.1| 60 kDa chaperonin [Lactobacillus salivarius] >gi|90823084|gb|ABE01069.1| 60 kDa chaperonin [Lactobacillus salivarius] (525 aa)
Score = 1362, Expect = 2.6e-148, Identities = 303/524 (57%), Positives = 404/524 (77%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYD 524
           MAKEIKFS+ AR+K+  GV +L + VK T+GP+GRNV++++SYG+P IT DGV++AK +DL +  ENMGA+LV +VASKT D AGDGTTTATVL   +  EG++NV +GANP+ I+RG++    A V+ L++ S  +  K +I QVA+IS+ +++++G+LIA+AMEKVG+DGVIT+EE+KGI+  L VVEGMQFDRGY+S Y VTD +KM A L+NPYIL+TDKK+S+I+++LP+L+ I++ GRPLLIIADDVDGEAL TLV+NK+RG FNVVAVKAP FGD+RK +L+DIA LTG + +TDDLG+     T++ LG A  V + K+N+TIV+G G + +I ER+ +IK  I  T SD+D++ L+ RLAKL+ GVAVIKVGA +E ELKE+K R++DAL+AT+AA+EEG V GGG ALV+V  +  V  L   GD + G  IV  A+  P+ QI  NAG + G VI E LK   P +GFNAAT ++VDM + GI+DP KVTR ALQNA SVS++LLTTEAV+ D
  S:     1 MAKEIKFSEDARSKMLKGVDKLANTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKAIDLEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIELATKAAVDALHEMSHTVESKSDIAQVASISS-ANEEVGKLIADAMEKVGNDGVITIEESKGIDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILLTDKKISNIQEVLPLLQSIVQQGRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLQDIATLTGATVITDDLGLQLKDTTVEQLGSAGKVTVTKENTTIVEGAGDKDKIAERVEQIKKQISETTSDFDREKLQERLAKLSGGVAVIKVGAATETELKERKYRIEDALNATRAAVEEGFVPGGGTALVNVIGK--VAALEEEGDVQTGINIVKRALEEPVRQIAENAGLE-GSVIVEKLKEQKPGVGFNAATNEWVDMVEAGIVDPTKVTRSALQNAASVSALLLTTEAVVAD 520
>gi|188590668|ref|YP_001919807.1| chaperonin GroL [Clostridium botulinum E3 str. Alaska E43] >gi|188500949|gb|ACD54085.1| chaperonin GroL [Clostridium botulinum E3 str. Alaska E43] (540 aa)
Score = 1362, Expect = 2.7e-148, Identities = 306/544 (56%), Positives = 417/544 (76%)
  Q:     1 MAKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGMGGM 544
           MAK +KF + AR  +  GV +L D VKVT+GP+GRNV++ K +G+P+IT DGVS+A+E++L +P ENMGAQLVK+VA+KT D AGDGTTTAT+LA  + +EGL+NV +GANP+ I+ G+   V+  V E+ K SK +  K++I +VA ISA +D++IG+LIA+AMEKVG++GVIT+EE+K +  EL VVEGMQFDRGY+SPY  TDT KM A L+NPYILITDKK+ +I++ILPILE+I++ G+ LLIIA+D++GEA+ TLVVNK+RG F  VAVKAP FGD+RK++L+DIAILTGG+ + ++LG    +VTL  LGQAESV + KDN+ +V GKG    IK+RIS+IK  IE T S++DK+ L+ RLAKL  GVAVIKVGA +E ELKE+K R++DAL+ATKAA+EEGIV GGG A ++V   +   T + + D ++G +I++ ++  P+ QI SNAG +  V+I ++ K +    G++A  GKYV+M ++GI+DP KVTR ALQNA SVS+  LTTEA + ++   KE ++PA P MGM GM
  S:     1 MAKMLKFGEDARRSMQVGVDKLADTVKVTLGPKGRNVVLDKKFGSPLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLKNVTAGANPMLIRNGIRMAVDKAVEEIKKISKPVEGKEDIARVAAISA-ADEEIGKLIADAMEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMSTDTEKMEAVLDNPYILITDKKIGNIQEILPILEQIVQCGKKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGTVIAEELGRDLKEVTLDMLGQAESVKVSKDNTVVVNGKGNPENIKDRISQIKAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALAATKAAVEEGIVPGGGTAYINVINAVEKLTSD-VQDTELGIKIIVKSLEEPLRQIASNAGVEGSVIIEKV-KNSEVGTGYDALYGKYVNMIKSGIVDPTKVTRSALQNAASVSATFLTTEAAVAEIP-QKEPAMPA-PGMGMDGM 539
>gi|53805103|ref|YP_113217.1| chaperonin GroEL [Methylococcus capsulatus str. Bath] >gi|68566274|sp|Q60AY0|CH601_METCA 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1) >gi|53758864|gb|AAU93155.1| chaperonin, 60 kDa subunit [Methylococcus capsulatus str. Bath] (545 aa)
Score = 1362, Expect = 2.8e-148, Identities = 291/521 (55%), Positives = 400/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE+KFSD AR ++  GV  L  AVKVT+GP+GRNV+++KS+GAP +TKDGVSVAKE++L++  ENMGAQ+VK+VAS+T+D AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK V A V+E++  S      + I QV TISAN+D+ IG++IA AM+KVG +GVITVE+  G+ ++L +VEGMQFDRGY+SPYF+ +   M A+LENP+ILI +KK+S+I+++LP+LE + K GRPL+I+A+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +LEDIA+LTGG+ +++D+G+S +K TL DLG A+ V I K+N+TI+ G G    I+ R+++I+  IE T SDYD++ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEGIV GGG AL+    ++  +      D+ +G  I   A+  P+ QIV+NAG +  VV+N++ +    + G+NAATG+Y DM   GI+DP KVTR ALQNA SV+S+++TTEA++
  S:     3 AKEVKFSDDARTRMLRGVNILAHAVKVTLGPKGRNVVLEKSFGAPTVTKDGVSVAKEIELSDKFENMGAQMVKEVASQTSDVAGDGTTTATVLAQSILTEGLKAVAAGMNPMDLKRGIDKAVAAAVDEIHAMSVPCTDSNAIAQVGTISANADESIGKIIAEAMDKVGKEGVITVEDGSGLENQLDIVEGMQFDRGYLSPYFINNQQSMSAELENPFILINEKKISNIRELLPVLEGVAKAGRPLVIVAEDVEGEALATLVVNNMRGILKVAAVKAPGFGDRRKAMLEDIAVLTGGTVISEDIGLSLEKATLADLGTAKKVQITKENTTIIDGAGSSEAIQGRVAQIRKQIEDTTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRALAKLR-DLKGANHDQDVGISIARRAMEEPLRQIVANAGDEPSVVLNKVAEGAG-NFGYNAATGEYGDMVAMGILDPAKVTRSALQNAASVASLMITTEAMV 521
>gi|190890943|ref|YP_001977485.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] >gi|190696222|gb|ACE90307.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652] (542 aa)
Score = 1362, Expect = 2.9e-148, Identities = 293/521 (56%), Positives = 401/521 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE+KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVLA  + KEG + V +G NP+++KRG+D  V+A+V EL  +++KI+   EI QV TISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  +LE+PYILI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILTGG+ +++DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++++  R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ + T N   D+++G  IV  AI +P+ QI  NAG +  +++ ++ +      G+NA TG+Y D++  G+IDP KV R ALQ+A SV+ +L+TTEA+I
  S:     3 AKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVAAGMNPMDLKRGIDLAVDAVVGELKANARKISNNSEIAQVGTISANGDSEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGTVISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDIIKTAN--DDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKNEFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMI 522
>gi|86356879|ref|YP_468771.1| chaperonin GroEL [Rhizobium etli CFN 42] >gi|119366207|sp|Q2KAU2|CH602_RHIEC 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2) >gi|86280981|gb|ABC90044.1| 60 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42] (542 aa)
Score = 1362, Expect = 3.0e-148, Identities = 293/521 (56%), Positives = 402/521 (77%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRIN-VNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVI 522
           AKE+KF   AR ++  GV  L +AVKVT+GP+GRNV+I KS+GAP ITKDGVSVAKE++L +  ENMGAQ++++VASKT D AGDGTTTATVLA  + KEG + V SG NP+++KRG+D  V+A+V EL  +++KI+   EI QV TISAN D +IG  +A AMEKVG++GVITVEEAK    EL VVEGMQFDRGY+SPYFVT+ +KM  +LE+PYILI +KK+S+++ +LP+LE ++++G+PLLIIA+DV+GEAL TLVVNK+RG   + AVKAP FGD+RK +LEDIAILT G+ +++DLGI  + VTL  LG+A+ V I+K+N+TI+ G G ++++  R ++I+  IE T SDYD++ L+ RLAKL  GVAVI+VG  +EVE+KEKKDRVDDAL AT+AA+EEGI+ GGG AL+   K ++ + T N   D+++G  IV  AI +P+ QI  NAG +  +++ ++ + ++   G+NA TG+Y D++  G+IDP KV R ALQ+A SV+ +L+TTEA+I
  S:     3 AKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDLAVDAVVGELKANARKISNNSEIAQVGTISANGDAEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDPYILIHEKKLSNLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTAGTVISEDLGIKLENVTLNMLGRAKKVAIEKENTTIIDGAGSKAELDGRTAQIRAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDALHATRAAVEEGILPGGGVALLRAVKALDSIKTAN--DDQRVGVDIVRRAIEAPVRQIAENAGAEGSIIVGKLREKSDFSYGWNAQTGEYGDLYAQGVIDPAKVVRTALQDAASVAGLLVTTEAMI 522
>gi|114770766|ref|ZP_01448234.1| Chaperonin GroEL (HSP60 family) protein [alpha proteobacterium HTCC2255] (547 aa)
Score = 1362, Expect = 3.0e-148, Identities = 299/537 (55%), Positives = 409/537 (76%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGD---EKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPN 538
           AKE+ FSD AR ++ NGV  L +AV+VT+GP+GRNV++ KS+GAP ITKDGVSVAKE++L +  ENMGAQ+VK+VASK  DEAGDGTTTATVLA  +  EGL++V +G NP+++KRG+DK V A V EL   S   A    I QV TISANSD  +G++IA AM+KVG +GVITVEE + + +EL VVEGMQFDRGY+SPYF+ +      ++E+PYIL+ DKK+S+I+++LP LE + K+ +PLLIIA+DV+GEAL TLVVN MRG+  V AVKAP FGD+RK +L+DIAILTGG+ +++++G+  +KVTL+DLG A+ VVI+KDN+T+V G G ++ I+ R ++I+  IE + SDYDK+ L+ RLAKL  GVAVIKVGA +EVE+KEKK RV+DAL AT+AA+EEG+V GGG ALV V+ ++     +L GD   + +G ++ + A+ +P+ QI +NAG +  VV+N + KA + + G+NA    Y DM + GI+DP KVTR ALQ A S++S+++TTEA++ DV  D   + PAMP+
  S:     3 AKEVLFSDDARGRMLNGVNILANAVRVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVTEGLKSVAAGMNPMDLKRGIDKAVLAAVEELKALSTPCADNKSIAQVGTISANSDTVVGDIIAEAMDKVGKEGVITVEEGQALQNELDVVEGMQFDRGYLSPYFINNQENGTVEVESPYILLVDKKISNIRELLPTLEAVAKSSKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTVISEEIGLELEKVTLEDLGTAKRVVINKDNTTVVDGAGEQAGIEGRCAQIRAQIEDSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALVRVAAKL----ADLTGDNEEQTLGVKLALRAMEAPMRQIATNAGAEASVVVNNV-KAGDANYGYNAGNDTYGDMLEMGILDPTKVTRSALQFASSIASLMITTEAMVADVPADAS-AAPAMPD 536
>gi|51894033|ref|YP_076724.1| chaperonin GroEL [Symbiobacterium thermophilum IAM 14863] >gi|59797716|sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|51857722|dbj|BAD41880.1| 60 kDa family chaperonin [Symbiobacterium thermophilum IAM 14863] (540 aa)
Score = 1362, Expect = 3.0e-148, Identities = 306/540 (56%), Positives = 402/540 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIGDEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKDDKEDSVPAMPNMGM 541
           AK+I F ++AR KL  GV  L + VKVT+GPRGRNV++ K +GAP +  DGV++A+E++L +P ENMGAQLVK+VA+KT D AGDGTTT+TVLA  + KEGL+NV  GANP+ +KRG++K V   V EL K +  +     I +VA ISAN+D++IGEL+A AM+ VG DGVITVEE+K ++ EL  VEGMQFDRGY+S Y VTDT KM A L  PYILITDKK+S+++D+LPILE++++ G+PLLIIA+DV+GEAL TLVVNK+RG   V AVKAP FGD+RK +LEDIAILTGG  V+++LG   +  T++ LGQA  V I+K+ +TI+ G G    IK R++ IK  IE T SD+D++ L+ RLAKL  GVAVIKVGA +EVELKEKK R++DAL+AT+AA+EEGIV GGG AL+   K I+     L GDEK+G QIV  A+  P+  IV N G +  VV+ ++      H GF+A   +YVDM   GIIDPVKVTR ALQNA S+++++LTTEA++ + K +K+++ PA PNM M
  S:     3 AKQIIFDEAARRKLQAGVDALANTVKVTLGPRGRNVVLDKKFGAPAVANDGVTIAREIELEDPFENMGAQLVKEVATKTNDVAGDGTTTSTVLAQAIVKEGLKNVTGGANPMILKRGIEKAVQVAVEELRKQAIPVETNKAIAEVAAISANNDREIGELVAKAMDTVGKDGVITVEESKTLHTELETVEGMQFDRGYVSAYMVTDTEKMEAVLNEPYILITDKKISAVQDLLPILEKVVQRGKPLLIIAEDVEGEALATLVVNKLRGTLQVAAVKAPGFGDRRKAMLEDIAILTGGEVVSEELGRKLENATIEMLGQARQVRIEKEKTTIIDGAGSSEAIKNRVAAIKRQIEETTSDFDREKLQERLAKLAGGVAVIKVGAATEVELKEKKLRIEDALNATRAAVEEGIVAGGGVALLQTQKAIDELIKTLEGDEKVGAQIVRRAVEEPLRCIVENGGLEGSVVVEKVRTLPVGH-GFDAMKEEYVDMVAAGIIDPVKVTRSALQNAASIAALILTTEALVTE-KPEKKENNPA-PNMDM 539
>gi|56708705|ref|YP_170601.1| chaperonin GroEL [Francisella tularensis subsp. tularensis SCHU S4] >gi|110671177|ref|YP_667734.1| chaperonin GroEL [Francisella tularensis subsp. tularensis FSC198] >gi|81677002|sp|Q5NEE1|CH60_FRATT 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|123359341|sp|Q14FU4|CH60_FRAT1 60 kDa chaperonin (Protein Cpn60) (groEL protein) >gi|50428814|gb|AAT77113.1| GroEL [Francisella tularensis subsp. tularensis] >gi|56605197|emb|CAG46329.1| Chaperone protein, groEL [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321510|emb|CAL09712.1| Chaperone protein, groEL [Francisella tularensis subsp. tularensis FSC 198] >gi|151569574|gb|EDN35228.1| hypothetical protein FTBG_01119 [Francisella tularensis subsp. tularensis FSC033] (544 aa)
Score = 1362, Expect = 3.0e-148, Identities = 304/526 (57%), Positives = 393/526 (74%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIARKDEIIQVATISANSDKKIGELIANAMEKVGSDGVITVEEAKGINDELTVVEGMQFDRGYISPYFVTDTNKMIAKLENPYILITDKKVSSIKDILPILEEIMKTGRPLLIIADDVDGEALTTLVVNKMRGVFNVVAVKAPEFGDKRKQVLEDIAILTGGSFVTDDLGISFDKVTLQDLGQAESVVIDKDNSTIVKGKGLESQIKERISKIKTAIEMTDSDYDKDSLRNRLAKLNKGVAVIKVGAVSEVELKEKKDRVDDALSATKAAIEEGIVIGGGAALVHVSKRINVNTLNLIG---DEKIGYQIVMSAIMSPISQIVSNAGFDKGVVINEILKATNPHLGFNAATGKYVDMFQTGIIDPVKVTRIALQNAVSVSSMLLTTEAVIYDVKD 527
           AK++ FSD AR K+ +GV  L +AVKVT+GP+GRNV++ KS+G P ITKDGVSVAKE++L +  ENMGAQ+VK+VASKTAD AGDGTTTATVLA  +  EGL+ V +G NP+++KRG+DK    +V EL   SK  +    I QV TISANSD  +G+LIA+AM KVG +GVITVEE KG  DEL VVEGMQFDRGY+SPYF T+   M   LENPYILI DKK+S+I+D+LPILE + K+GR LLIIA+DV+ EAL TLVVN MRGV  V AVKAP FGD+RK +LEDIA LTG +FV++DL +  ++  ++ LG A  V + KDN+TI+ G G +  I +RI+ IK  I   +SDYD++ L+ RLAKL+ GVAVIKVGAV+E E+KEKKDRVDDAL AT+AA+EEGIV GGG AL+   K ++     L G   D+  G  ++  AI +P+ QIVSNAG +  VV+N++ KA   + G+NAA   Y DM + GI+DP KVTR ALQ+A S++ +++TTEA+I ++K+
  S:     3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGTPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILIVDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGFGDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVQVTKDNTTIIDGAGEKEAIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDALHATRAAVEEGIVAGGGVALIRAQKALD----GLTGENDDQNYGIALLRKAIEAPLRQIVSNAGGESSVVVNQV-KANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITTEAMIGEIKE 526
>gi|95930572|ref|ZP_01313307.1| chaperonin GroEL [Desulfuromonas acetoxidans DSM 684] >gi|95133407|gb|EAT15071.1| chaperonin GroEL [Desulfuromonas acetoxidans DSM 684] (545 aa)
Score = 1362, Expect = 3.0e-148, Identities = 304/528 (57%), Positives = 401/528 (75%)
  Q:     2 AKEIKFSDSARNKLFNGVQQLFDAVKVTMGPRGRNVLIQKSYGAPVITKDGVSVAKEVDLTNPIENMGAQLVKDVASKTADEAGDGTTTATVLAYGVFKEGLRNVISGANPIEIKRGMDKTVNAIVNELNKSSKKIAR